Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00043768 ID=TCONS_00043768|Name=TCONS_00043768|organism=Clytia hemisphaerica|type=transcript|length=797bpRun BLAST on NCBI protein sequence of TCONS_00043768-protein >TCONS_00043768-protein ID=TCONS_00043768-protein|Name=TCONS_00043768-protein|organism=Clytia hemisphaerica|type=polypeptide|length=125bp RSSTQCTEQFTLRTRGFAPRVPAVRRGDILQIKGRNLYNLGYSHYAIVVDRun BLAST on NCBI transcript from alignment at sc0004556:430..1509+ Legend: exonfive_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00043768 ID=TCONS_00043768|Name=TCONS_00043768|organism=Clytia hemisphaerica|type=transcript|length=1080bp|location=Sequence derived from alignment at sc0004556:430..1509+ (Clytia hemisphaerica) Coding sequence (CDS) from alignment at sc0004556:430..1509+ >TCONS_00043768 ID=TCONS_00043768|Name=TCONS_00043768|organism=Clytia hemisphaerica|type=CDS|length=378bp|location=Sequence derived from alignment at sc0004556:430..1509+ (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Annotated Terms
The following terms have been associated with this transcript:
Blast
BLAST of TCONS_00043768 vs. Swiss-Prot (Human)
Match: HRSL4 (Retinoic acid receptor responder protein 3 OS=Homo sapiens GN=RARRES3 PE=1 SV=1) HSP 1 Score: 73.9442 bits (180), Expect = 3.847e-16 Identity = 41/122 (33.61%), Postives = 68/122 (55.74%), Query Frame = 2 Query: 74 RRGDILQIKGRNLYNLGYSHYAIVVDDCYVIHVKK------VGGNTI---------IAKEKLAEAFKGKFVRINNTMDGEFSVLDIQDIIVSAESMIGHDKWPYDLLAHNCEHFVT*CRYGK 394 + GD+++I + LGY H+A+ + D YVIH+ G +++ + +E+L + G R+NN++D E+ ++ II SA+ M+G K Y +++ NCEHFVT RYGK Sbjct: 9 KPGDLIEI-----FRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMVGQ-KMKYSIVSRNCEHFVTQLRYGK 124 The following BLAST results are available for this feature:
BLAST of TCONS_00043768 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|