Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00018126 ID=TCONS_00018126|Name=TCONS_00018126|organism=Clytia hemisphaerica|type=transcript|length=2725bpRun BLAST on NCBI protein sequence of TCONS_00018126-protein >TCONS_00018126-protein ID=TCONS_00018126-protein|Name=TCONS_00018126-protein|organism=Clytia hemisphaerica|type=polypeptide|length=575bp MESPKRNRSRSRSPIQRSRSPRRDDRRGRDRRSGGASIKGTKGKEYRVYVRun BLAST on NCBI transcript from alignment at sc0000290:61054..67473+ Legend: exonfive_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00018126 ID=TCONS_00018126|Name=TCONS_00018126|organism=Clytia hemisphaerica|type=transcript|length=6420bp|location=Sequence derived from alignment at sc0000290:61054..67473+ (Clytia hemisphaerica) Coding sequence (CDS) from alignment at sc0000290:61054..67473+ >TCONS_00018126 ID=TCONS_00018126|Name=TCONS_00018126|organism=Clytia hemisphaerica|type=CDS|length=17280bp|location=Sequence derived from alignment at sc0000290:61054..67473+ (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Annotated Terms
The following terms have been associated with this transcript:
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Blast
BLAST of TCONS_00018126 vs. Swiss-Prot (Human)
Match: MYEF2 (Myelin expression factor 2 OS=Homo sapiens GN=MYEF2 PE=1 SV=3) HSP 1 Score: 94.3597 bits (233), Expect = 8.372e-20 Identity = 42/78 (53.85%), Postives = 58/78 (74.36%), Query Frame = 1 Query: 1597 RVFVRNLPFSLKWQDLKDRFRDAGRIIRADIKQDDNNRSKGCGTVTFETADEAVKAISIFNGMRIDGREIEVRMDRVA 1830 ++FVRNLPF L WQ LK++F G ++ A+IK + N +SKGCGTV F++ + A KA I NG++I GREI+VR+DR A Sbjct: 524 QIFVRNLPFDLTWQKLKEKFSQCGHVMFAEIKME-NGKSKGCGTVRFDSPESAEKACRIMNGIKISGREIDVRLDRNA 600 The following BLAST results are available for this feature:
BLAST of TCONS_00018126 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|