Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00014667 ID=TCONS_00014667|Name=TCONS_00014667|organism=Clytia hemisphaerica|type=transcript|length=167bpRun BLAST on NCBI transcript from alignment at sc0000197:31155..31502+ Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00014667 ID=TCONS_00014667|Name=TCONS_00014667|organism=Clytia hemisphaerica|type=transcript|length=348bp|location=Sequence derived from alignment at sc0000197:31155..31502+ (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
No biomaterial libraries express this feature.
Blast
BLAST of TCONS_00014667 vs. Swiss-Prot (Human)
Match: METH (Methionine synthase OS=Homo sapiens GN=MTR PE=1 SV=2) HSP 1 Score: 78.5666 bits (192), Expect = 2.855e-18 Identity = 39/54 (72.22%), Postives = 44/54 (81.48%), Query Frame = -3 Query: 1 YLEAGADFIETNTFSGTSIAQADYALEHLVYRLNKVSAELARKAADDVTEITGM 162 YL AGAD IETNTFS TSIAQADY LEHL YR+N SA +ARKAA++VT TG+ Sbjct: 85 YLLAGADIIETNTFSSTSIAQADYGLEHLAYRMNMCSAGVARKAAEEVTLQTGI 138 The following BLAST results are available for this feature:
BLAST of TCONS_00014667 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|