Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00008734 ID=TCONS_00008734|Name=TCONS_00008734|organism=Clytia hemisphaerica|type=transcript|length=3968bpRun BLAST on NCBI protein sequence of TCONS_00008734-protein >TCONS_00008734-protein ID=TCONS_00008734-protein|Name=TCONS_00008734-protein|organism=Clytia hemisphaerica|type=polypeptide|length=749bp MGEALNIMEVSCPSIFSNNSSTVEISDEEAKLSCIFNEEVHHIPTPPTGARun BLAST on NCBI transcript from alignment at sc0000087:452719..482639+ Legend: exonfive_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00008734 ID=TCONS_00008734|Name=TCONS_00008734|organism=Clytia hemisphaerica|type=transcript|length=29921bp|location=Sequence derived from alignment at sc0000087:452719..482639+ (Clytia hemisphaerica) Coding sequence (CDS) from alignment at sc0000087:452719..482639+ >TCONS_00008734 ID=TCONS_00008734|Name=TCONS_00008734|organism=Clytia hemisphaerica|type=CDS|length=24750bp|location=Sequence derived from alignment at sc0000087:452719..482639+ (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Annotated Terms
The following terms have been associated with this transcript:
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Blast
BLAST of TCONS_00008734 vs. Swiss-Prot (Human)
Match: PPRC1 (Peroxisome proliferator-activated receptor gamma coactivator-related protein 1 OS=Homo sapiens GN=PPRC1 PE=1 SV=1) HSP 1 Score: 99.7525 bits (247), Expect = 8.150e-21 Identity = 53/132 (40.15%), Postives = 77/132 (58.33%), Query Frame = 1 Query: 2011 ERKNIYVGGINKQTTKQDLIKRFRRFGKIEKTTLHFRAKGDNYAFIVYEHPGCAMRAIEEGN-----DDPSYPRLELCFGGRRKFVGGSYVDFDGNNSYLEETEQNSRNLRCDSPENDFDSLLKMATQKMRR 2391 ER+ +++G I + T+ +L +RF FG+IE+ T+HFR +GDNY F+ Y + A AIE G+ D+ + +LCFGGRR+F SY D D N + S + DS DFD+LLK A + +RR Sbjct: 1541 ERRVVFIGKIPGRMTRSELKQRFSVFGEIEECTIHFRVQGDNYGFVTYRYAEEAFAAIESGHKLRQADEQPF---DLCFGGRRQFCKRSYSDLDSNREDFDPAPVKS---KFDS--LDFDTLLKQAQKNLRR 1664 The following BLAST results are available for this feature:
BLAST of TCONS_00008734 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|