Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00007424 ID=TCONS_00007424|Name=TCONS_00007424|organism=Clytia hemisphaerica|type=transcript|length=482bpRun BLAST on NCBI transcript from alignment at sc0000076:451747..452228 Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00007424 ID=TCONS_00007424|Name=TCONS_00007424|organism=Clytia hemisphaerica|type=transcript|length=482bp|location=Sequence derived from alignment at sc0000076:451747..452228 (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00007424 vs. Swiss-Prot (Human)
Match: RPAB4 (DNA-directed RNA polymerases I, II, and III subunit RPABC4 OS=Homo sapiens GN=POLR2K PE=1 SV=1) HSP 1 Score: 94.7449 bits (234), Expect = 1.937e-25 Identity = 41/58 (70.69%), Postives = 47/58 (81.03%), Query Frame = 1 Query: 52 MDNSTQNGAAASKAMIYICGECHSENEIKTRDPIRCRECGYRIMYKKRTRRMIVFDAR 225 MD + MIYICGECH+ENEIK+RDPIRCRECGYRIMYKKRT+R++VFDAR Sbjct: 1 MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR 58 The following BLAST results are available for this feature:
BLAST of TCONS_00007424 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|