Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00006949 ID=TCONS_00006949|Name=TCONS_00006949|organism=Clytia hemisphaerica|type=transcript|length=2546bpRun BLAST on NCBI transcript from alignment at sc0000072:435905..461649- Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00006949 ID=TCONS_00006949|Name=TCONS_00006949|organism=Clytia hemisphaerica|type=transcript|length=25745bp|location=Sequence derived from alignment at sc0000072:435905..461649- (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00006949 vs. Swiss-Prot (Human)
Match: REQU (Zinc finger protein ubi-d4 OS=Homo sapiens GN=DPF2 PE=1 SV=2) HSP 1 Score: 114.775 bits (286), Expect = 5.212e-27 Identity = 48/104 (46.15%), Postives = 69/104 (66.35%), Query Frame = 1 Query: 721 CDYCQQNSKKNQ-FGQPEDLLICKDCSNKAHPSCLSYSQELVEQIRSDSSWQCIDCKACSICDGTGDPDTLLFCDACDKGYHMQCHTPKLEQTPSGKWACATCI 1029 CD+C +SK N+ GQPE+L+ C DC HPSCL ++ ++ +++ WQCI+CK C+IC + + D LLFCD CD+GYHM C TP + + P G W+C C+ Sbjct: 273 CDFCLGDSKINKKTGQPEELVSCSDCGRSGHPSCLQFTPVMMAAVKT-YRWQCIECKCCNICGTSENDDQLLFCDDCDRGYHMYCLTPSMSEPPEGSWSCHLCL 375 The following BLAST results are available for this feature:
BLAST of TCONS_00006949 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|