Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00006829 ID=TCONS_00006829|Name=TCONS_00006829|organism=Clytia hemisphaerica|type=transcript|length=783bpRun BLAST on NCBI transcript from alignment at sc0000070:441778..442560 Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00006829 ID=TCONS_00006829|Name=TCONS_00006829|organism=Clytia hemisphaerica|type=transcript|length=783bp|location=Sequence derived from alignment at sc0000070:441778..442560 (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00006829 vs. Swiss-Prot (Human)
Match: DDR2 (Discoidin domain-containing receptor 2 OS=Homo sapiens GN=DDR2 PE=1 SV=2) HSP 1 Score: 94.3597 bits (233), Expect = 2.114e-21 Identity = 43/92 (46.74%), Postives = 59/92 (64.13%), Query Frame = -3 Query: 470 GTFKNPTDIWSFGVTLWEIFSFARESPYSELTDLQIIEAACESVQHPDREFVFRLEQPATCPDEVYRLMLKCWNKNPDNRPPFAFLNRQFMQ 745 G F +D+W+FGVTLWE F+F +E PYS+L+D Q+IE E + R+ L QPA CPD VY+LML CW ++ NRP F ++ +Q Sbjct: 762 GKFTTASDVWAFGVTLWETFTFCQEQPYSQLSDEQVIENTGEFFRDQGRQTY--LPQPAICPDSVYKLMLSCWRRDTKNRPSFQEIHLLLLQ 851 The following BLAST results are available for this feature:
BLAST of TCONS_00006829 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|