Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00004433 ID=TCONS_00004433|Name=TCONS_00004433|organism=Clytia hemisphaerica|type=transcript|length=2204bpRun BLAST on NCBI protein sequence of TCONS_00004433-protein >TCONS_00004433-protein ID=TCONS_00004433-protein|Name=TCONS_00004433-protein|organism=Clytia hemisphaerica|type=polypeptide|length=258bp MSVNKIDAGKGRLTLQGDYVVHHEKNITFSLEGDRLPAVLKGTHSGDVFIRun BLAST on NCBI transcript from alignment at sc0000044:782360..794959- Legend: exonfive_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00004433 ID=TCONS_00004433|Name=TCONS_00004433|organism=Clytia hemisphaerica|type=transcript|length=12600bp|location=Sequence derived from alignment at sc0000044:782360..794959- (Clytia hemisphaerica) Coding sequence (CDS) from alignment at sc0000044:782360..794959- >TCONS_00004433 ID=TCONS_00004433|Name=TCONS_00004433|organism=Clytia hemisphaerica|type=CDS|length=6993bp|location=Sequence derived from alignment at sc0000044:782360..794959- (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Annotated Terms
The following terms have been associated with this transcript:
Blast
BLAST of TCONS_00004433 vs. Swiss-Prot (Human)
Match: WBP2 (WW domain-binding protein 2 OS=Homo sapiens GN=WBP2 PE=1 SV=1) HSP 1 Score: 101.679 bits (252), Expect = 2.051e-23 Identity = 45/98 (45.92%), Postives = 67/98 (68.37%), Query Frame = 1 Query: 235 LPAVLKGTHSGDVFITNLRLIFVNNGK-GYNTFSMDFQSIRNTEVKQPIFGSNHIKGYVKSEINGGWEGSANFKIDFPKGGAIEFAERFQKTVKESLR 525 +P KGT G V++T R+IF++ GK +F M F +++ E+KQP+FG+N+IKG VK+E GGWEGSA++K+ F GGAIEF +R + ++ R Sbjct: 38 VPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQPVFGANYIKGTVKAEAGGGWEGSASYKLTFTAGGAIEFGQRMLQVASQASR 135 The following BLAST results are available for this feature:
BLAST of TCONS_00004433 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|