Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00002274 (transcript) - C. hemisphaerica

Overview
NameTCONS_00002274
Unique NameTCONS_00002274
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1763

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00002274 ID=TCONS_00002274|Name=TCONS_00002274|organism=Clytia hemisphaerica|type=transcript|length=1763bp
gtaaatttggattttttaatttcgctaAAACATCATCACAAAATTGCCAA
ACGAAATATTTGATACCATGAAGATGAATATGTTTCAAACAAAGATGAAC
GCAAAACGACTCCTTTGTTACGCAATCTCGGTCGTTCTCAAGTTCACCAA
TGCTGTTGTGGACATAGAAATTGGTCATGGAGAAGATATACAGATGACGT
GGAACATACCACCAACCGCAAACAACCTCTTCATTTATCTCGGAAGCCAA
CGAGATGCACCCGTACTAGCACACATATCAAAAGGTGAAATAGCATATTC
AAAGAAGCTAACAGAAGCAAGGTTCGGCACCCGGCTGTTTATACAAATGG
TGGACAGCGATTTGAAATTAACGATCGTAGATGCACAAGACAGTGACGAA
GAAACATATACAGCGACAGCACAATTCGGAATCGGCGAAGTCAAGATATT
GCAAAGTTTTCGAGTTGAAGTCACAGGACTTTCATCTACCGACACCGGCA
TTATAGTCGGCATCGTCGTCGCAATCGTCGTTCTTATTGTCGTCCTTATC
CTGATACGTTATTGTTACGATCGTAATTATAATCCTGCCGACCATTTAAC
CGATCCTGAGAAAGACAGCGAAACGCatatttgatgattttgattggttg
atcgCTTTGTAAATTATCATTTCAAAGTGATTTGTTGGTAGTACCAAAGC
TGGTAAGCTTGCTGTCGACATTTCGATTGAATTCCTACGATCAGCATCGA
CAACTAAATTTCAACTTTGATGCGACAAGGGGCTGGATCTTATTATTAGA
GTTGCCGAGTGATGACAGATCGCTTTATCTGTGACAAATGCGTCTTGGGC
ATTTAGCGTTATTTTTCCAGTTGACCGATAATGTGTACCAATGCGTCGTA
ACAAAAAATCTTAcagaattttgtgttttttaatcAGAATTCctaaagtt
ttgataaaataactCGGATTCTACCAGGAAAACTAATTTAGAAAGTTTAG
CAAGCGTAGACAAGCGAAAGATGGGAATTTTAATCCTGGGCATTTTAATT
AATGAAATTGAAACTGAATTTTGTGTTCTTTTGGTGGAAAATCTTTATCG
CGgatgtatttttaatttttagtgttAGTAGTAATTTGAATACAATTATC
TAATTCATATTTTAGTCTAttaatcaataaaatcaaatttattttctaaa
aaatacttatttgtttTTGAGCATGAAAATGTATAAATGTATTGGGAGAT
TCAACACTCTAAAGACGTTTAGTCAGCTCAGGCAGAGGCTTTCGCttcca
aaagtaaaaaaaatctacaattaTTTCTCGACAAAATTAGTTTAATTAAA
TTTCATACTACTTTTTAAGAATTTAGGATTTTTAGCAACTTACTTGAAAA
GAACGACGTGAacgaaaacaagaaaacaagaaaacaaaaaaagattaaaa
attgactaaaatttaCGTGGTAAACTCATTTTTTCCAATGATTAATAATG
CATAAGATGAATATAAAAGCCATGAATTCTGGTCATCCACTGATAACGTA
AGCCAATCATTTTTGACTCAAGCTGAAGGAGAAAAAATTGACTGTTTTAA
TTTTATTGTAAGACTCTAATCCCTTATATGGAGATGATAAATCCATTGTA
ATTGCGAAGGGCTAGAGATGAATCTCTTGGAAGGGGATGGGAAATAAAGC
CGCCTATTTCCCATCCGAAGTGGATTTTACACAAACGACGGATAGAAAgc
gaggattccaaaa
Run BLAST on NCBI

protein sequence of TCONS_00002274-protein

>TCONS_00002274-protein ID=TCONS_00002274-protein|Name=TCONS_00002274-protein|organism=Clytia hemisphaerica|type=polypeptide|length=188bp
MKMNMFQTKMNAKRLLCYAISVVLKFTNAVVDIEIGHGEDIQMTWNIPPT
ANNLFIYLGSQRDAPVLAHISKGEIAYSKKLTEARFGTRLFIQMVDSDLK
LTIVDAQDSDEETYTATAQFGIGEVKILQSFRVEVTGLSSTDTGIIVGIV
VAIVVLIVVLILIRYCYDRNYNPADHLTDPEKDSETHI
Run BLAST on NCBI

transcript from alignment at sc0000019:751067..758212+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00002274 ID=TCONS_00002274|Name=TCONS_00002274|organism=Clytia hemisphaerica|type=transcript|length=7146bp|location=Sequence derived from alignment at sc0000019:751067..758212+ (Clytia hemisphaerica)
gtaaatttggattttttaatttcgctaAAACATCATCACAAAATTGTAGG TTTACATCTTGTATTGTAGTATAGGTATAAATTACTGACCTTAAATCCTG GGGCAAactatatctgccatctttcaTCATAGTTTTTAGAAAAGTGTTAT CccggtaccctaatggtagctaCTTGATGTTGGTCAATTTGTATTTTAGT TTGAATATTTTTGCACCACCATTGAGCAGTGCTACCAATGGGATACCCCT ATAAAAAATCTCCGTCCATTTTTCTTGGCCGGGATCGACAAACTGTGTCC AGAATGTATAAAAGTCATTGGTTTACATGACATTTGGCCTTAGCGTGGTC ATGAAAACACCTCTATGTCACAAATTGGTTGGGATGGCCTacctactgga aaatttgtcCAAGATTTCGTtgtgaaaaataccctacaatccCAGCCCCA CTGGCACTGGGAAATTgatactttgatttcatcctcattcgaaattcaat ctAAAAAATCTCCACTGGATTTCTTATACTTGAGACAATAGTATTTCTAC CCCTATTGGGATttaaatagaatttttatatccccaatgtgggaaaaagt tccacttgggctgtgagacaggggtgtataaaagAAAGATGTTATAGACA CAGGGTGGTGAAATgtttaaagttttgtttttaaataagagtgatatagT TTGCTTAcacatcaattttaatttacaagctttttcgtattggattgaca cggatagTTTGCGTAGATTGGTCAGAAAGCGGaaaagaaaaacgtttttt tgcttatatcagcataacataacaataggaagacactgtcccgatatgaa atatgtgtctgatttgaaacgggaacacctgtataaaaacaaaaccttta aatgtaTTTGTTTTAAATTCCAGGCCAAACGAAATATTTGATACCATGAA GATGAATATGTTTCAAACAAAGATGAACGCAAAACGACTCCTTTGTTACG CAATCTCGGTCGTTCTCAGTAAGTAGTCAAAGCAACCCTCTTGGAATTTT agtgagaattaattttggcgagtgtCGTGTCCtttaaataaagatttttt tttgaaagaaaatatttttgtgtatttttgaaggaaattcaTTCAATGTA TTTTAGAAGGAAAATCATTTTGTGTATTTATGAAGGAAATTAATTTAAAG TATTTTAGAaggaaaatcatttaatgtatttttgaaggaaaattcttctg attgtttttgaaagaaatttcttaaAACGAATAAAGTCAGTTTGTGTATT TCAAGAAGGAAGGAGAATATAGTCACATAAAATTGCGGGAATACCCTTTT CAAAACCACTGATCACAaacctaaagtctattcacgataagtgtgcactc ttttttcctctacctataacttttgaaggaattcttcaatctttataaat ttggtatcatcggaaagatattagtgagtggaacaatttgaaataaaaaa aatctttaaaaNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNtgacgttcgatgattaaggattcacttcagtgaa aatgatagttatagcacttttctacaagatcttcattgttttcttcttca ttttcatcttcaattttataatcttcttaaatttttttctatttcaaatc gttccactcactaatatctttccaatgataccaaatttataaagattgaa gaattccttcaaaagttataggtaaatgaaaaaagagtgcacacttatcg tgaatagactttagtaacCTACTATCAATTAAGCTGGAGATATGGAaatg gaaaactttttttggaaattctgtatatctttaatttcattttttgcgcT ACTTTATAAAGACACTTCAGCCTGTCCAGACACGATACAGCTGGCTAGAT AGctggtttacaaaaattcatttATGCCATTTTTCATTCGCAGAGTTCAT CAATACTGTCCAGACATCAGATACAACTGACTAGATAAACTGTCTTACAA AAGTTCATTTATTAAATAATTGTCAACTTTGTTCATTCACCAGAGTTCAC CAATGCTGTTGTGGACATAGAAATTGGTCATGGAGAAGATATACAGATGA CGTGGAACATACCACCAACCGCAAACAACCTCTTCATTTATCTCGGAAGC CAACGAGATGCACCCGTACTAGCACACATATCAAAAGGTGATATTTAAGT TGGTTTTAATCTTGTTCCCGGTTCAGAATGGGCTCTTGCAGAAAATGCCC TTACATGGGGGTGGATGATATAGTGTCCAGGGGGTAGTGAAAGCTCTACA AAATCTACCTTGTCCaagggtaaacttgctctgtttgagtgtaattttgc tctgtttgagggtaattttaaTTATCCAtggggtcaactaatgcttgtcc ggggggccaaaagtcacaatgtccggggggccaaaagtcacaatgtccgg ggggggggggaaatttcCAAATGTtaaatcctccacccccctaagtgcta agttttaatgggtaattaatctttttctttcgaagtcttttcaaactgtc tgcaaagaattgaactgtttgaatcttttcggaaaaaatttctaaattaa tacatcaaaagttatggatgtttttttatgagaaattgggatgaaaaatt ggtcaaaaagcactattttcaaaattgtgagacaaataagcttttagaaa aattttccgaaaatccgtttttagttcggtaaaagatacaccatctaccg cgaaaaacttttcaaaatattttttcttcgccgaaaataagctcttctag gttgaaatactcttcttctcaaaaatctttattttcttcttcatcaaatt ttttcattgcgattcttaaattttcagactcaaggataattggcctaGCA GAAAACGTATATCATAAGATTGGTGCCaacaattttgttattttattttg acaatATAATATTTCGGATTATTATCCATCATCAGGtctaaaagtaaaat aaatagatataaaaacagttaaaatcaATCGTCAACATTTATACATACCC TCTAAAAATTACATCCATACATCTATCCTACATCTACAACtcaaacaaaa agtaaaattgaatcatttttcaaaacaaattgagAAACGATTCCCAGGCA ACTTCTCACCTGGGAATAGTGAAAATAGAAAGTGTATAatatgccacagt tttgtgtgctacatcaagtagaaattcatattttgtatgtggcaaatatt aaaaattcactatggtcagagcccttaaactaGCAAGAATAAGGCccaaa atggttttcttatCATTAACACTGGAATGAAGTAAGTAAGACCAGGTTCT GTTgggaaaacaagaaaaaacaagaattttttttgagccaaaaggtcatc tacgtgaagcaacaatcATTTCATGCAACACAAAAGGCACTGGATGGGTA CAGTGAGAAATTCTTAAGCCGAAATTTTCAAATCCAAACATTTTGATGCG TCATAGAAGAAACCTTGGTACCTGTTGGTACAGCAAAAATCAACCAAGAA TTTATCCATCTTAGATAGTGATCTAACTGACTTAGACATTATAGTAAAGG GTAAACTAGTCTAAAGTCATAATAGTCTAAACAGACTTATAAATACAAAC TTCTTTCTGCCGTACAAAGTACTCCGTAAAGTCTTTACCCCAATTTCCGT AGATCAAGCTCTCTAAAATATTGTCCAATTCATTCCACGATGTCTCTgcc aagttttttaaaaatgtcaaacacATTGGATGAGGCTAGGAGTACTGACT TGTATGGTCGGCGGGACGTGCAGCTGAAGTTTATAAAATAGACATTGTca aatatgaatgtttggtagaTTTCGGATCCAGTCAGAACGAATATTTTTCT CGTTTTCATCCTGAAAAGTCGCAACAATGTTGCAAAAGGCGAACAATTGT AAAAAATTGCTTTCTACCCTGAAAACAGTCCAAAATAACCAAAGGTCGAC GCTGTCAGATACACAACTTAAAAGTTgataaatttgggaccctgtcagat atcttcacaGCAAATAGCAAAAAAGAGACCCTGACATTAAGCGACACGTT CCCCTTCCAACCCAGAGGTTTAGCCTTATTCAGAGGTTACAAGCTGGCTG AATAGTTCAAATGTTTTAAAGAACTtgttaattattttcaaaatacagGT GAAATAGCATATTCAAAGAAGCTAACAGAAGCAAGGTTCGGCACCCGGCT GTTTATACAAATGGTGGACAGCGATTTGAAATTAACGATCGTAGATGCAC AAGACAGTGACGAAGAAACATATACAGCGACAGCACAATTCGGAATCGGC GAAGTCAAGATATTGCAAAGTTTTCGAGTTGAAGTCACAGGTGAGCTACC TTAAGtatattaattttggcgggattaaatttggcggattttagtaaaaa atatcTTCTGggttgttttattacaggttacaTTAAAAATATTCCagtac attttttttcttttattaggcgagaccaatttaatttgttgttctacggg cccgaccgaccctatttttgctaaaatgaaaaaaataataatatcgaatt tctactacaatatattttacacactagttatttgtaagaattaagcttga ataaagctgaaaattaattcaagaaattgaaaatcataaaaagcattcca tacactaaaattttattatggtCTTCATCGAAGAGATCCAGATacttttt agaagattttgtcgttaccttaccaaccctgataaatgaaaaatttattt ttattttgccgaccgaccgacccatatttttctaacgatctgtccgtaga acaacaaattaaattggtctcgccttagaaTAACATttatatgcaggctc agtttttgtggtacctaaacaatggctctattacTAAAGAACAATAGAGT GCTAAGCAttatgcgagcctgatatagggacagtcagttgcttataaaaa aacatgtaaatctcaaaacgtctaaaaatatctaaaaacgcCTTTTTTAA AACGTAATACGGGTGCAAGAACATTTTTACCCTAAGGTATCTTTTCCTGT CTTCGCATCTTTATTTCCAGCTCAATCATCACACGATAAATCTATTTCTT TGGGTTCAGGACTTTCATCTACCGACACCGGCATTATAGTCGGCATCGTC GTCGCAATCGTCGTTCTTATTGTCGTCCTTATCCTGATACGTTATTGTTA CGATCGTAATTATAATCCTGCCGACCATTTAACCGATCCTGAGAAAGACA GCGAAACGCatatttgatgattttgattggttgatcgCTTTGTAAATTAT CATTTCAAAGTGATTTGTTGGTAGTACCAAAGCTGGTAAGCTTGCTGTCG ACATTTCGATTGAATTCCTACGATCAGCATCGACAACTAAATTTCAACTT TGATGCGACAAGGGGCTGGATCTTATTATTAGAGTTGCCGAGTGATGACA GATCGCTTTATCTGTGACAAATGCGTCTTGGGCATTTAGCGTTATTTTTC CAGTTGACCGATAATGTGTACCAATGCGTCGTAACAAAAAATCTTAcaga attttgtgttttttaatcAGAATTCctaaagttttgataaaataactCGG ATTCTACCAGGAAAACTAATTTAGAAAGTTTAGCAAGCGTAGACAAGCGA AAGATGGGAATTTTAATCCTGGGCATTTTAATTAATGAAATTGAAACTGA ATTTTGTGTTCTTTTGGTGGAAAATCTTTATCGCGgatgtatttttaatt tttagtgttAGTAGTAATTTGAATACAATTATCTAATTCATATTTTAGTC TAttaatcaataaaatcaaatttattttctaaaaaatacttatttgtttT TGAGCATGAAAATGTATAAATGTATTGGGAGATTCAACACTCTAAAGACG TTTAGTCAGCTCAGGCAGAGGCTTTCGCttccaaaagtaaaaaaaatcta caattaTTTCTCGACAAAATTAGTTTAATTAAATTTCATACTACTTTTTA AGAATTTAGGATTTTTAGCAACTTACTTGAAAAGAACGACGTGAacgaaa acaagaaaacaagaaaacaaaaaaagattaaaaattgactaaaatttaCG TGGTAAACTCATTTTTTCCAATGATTAATAATGCATAAGATGAATATAAA AGCCATGAATTCTGGTCATCCACTGATAACGTAAGCCAATCATTTTTGAC TCAAGCTGAAGGAGAAAAAATTGACTGTTTTAATTTTATTGTAAGACTCT AATCCCTTATATGGAGATGATAAATCCATTGTAATTGCGAAGGGCTAGAG ATGAATCTCTTGGAAGGGGATGGGAAATAAAGCCGCCTATTTCCCATCCG AAGTGGATTTTACACAAACGACGGATAGAAAgcgaggattccaaaa

Coding sequence (CDS) from alignment at sc0000019:751067..758212+

>TCONS_00002274 ID=TCONS_00002274|Name=TCONS_00002274|organism=Clytia hemisphaerica|type=CDS|length=2268bp|location=Sequence derived from alignment at sc0000019:751067..758212+ (Clytia hemisphaerica)
ATGAAGATGAATATGTTTCAAACAAAGATGAACGCAAAACGACTCCTTTG
TTACGCAATCTCGGTCGTTCTCAAGTTCACCAATGCTGTTGTGGACATAG
AAATTGGTCATGGAGAAGATATACAGATGACGTGGAACATACCACCAACC
GCAAACAACCTCTTCATTTATCTCGGAAGCCAACGAGATGCACCCGTACT
AGCACACATATCAAAAGGTGAAATAGCATATTCAAAGAAGCTAACAGAAG
CAAGGTTCGGCACCCGGCTGTTTATACAAATGGTGGACAGCGATTTGAAA
TTAACGATCGTAGATGCACAAGACAGTGACGAAGAAACATATACAGCGAC
AGCACAATTCGGAATCGGCGAAGTCAAGATATTGCAAAGTTTTCGAGTTG
AAGTCACAGGACTTTCATCTACCGACACCGGCATTATAGTCGGCATCGTC
GTCGCAATCGTCGTTCTTATTGTCGTCCTTATCCTGATACGTTATTGTTA
CGATCGTAATTATAATCCTGCCGACCATTTAACCGATCCTGAGAAAGACA
GCGAAACGCatatttgaATGAAGATGAATATGTTTCAAACAAAGATGAAC
GCAAAACGACTCCTTTGTTACGCAATCTCGGTCGTTCTCAAGTTCACCAA
TGCTGTTGTGGACATAGAAATTGGTCATGGAGAAGATATACAGATGACGT
GGAACATACCACCAACCGCAAACAACCTCTTCATTTATCTCGGAAGCCAA
CGAGATGCACCCGTACTAGCACACATATCAAAAGGTGAAATAGCATATTC
AAAGAAGCTAACAGAAGCAAGGTTCGGCACCCGGCTGTTTATACAAATGG
TGGACAGCGATTTGAAATTAACGATCGTAGATGCACAAGACAGTGACGAA
GAAACATATACAGCGACAGCACAATTCGGAATCGGCGAAGTCAAGATATT
GCAAAGTTTTCGAGTTGAAGTCACAGGACTTTCATCTACCGACACCGGCA
TTATAGTCGGCATCGTCGTCGCAATCGTCGTTCTTATTGTCGTCCTTATC
CTGATACGTTATTGTTACGATCGTAATTATAATCCTGCCGACCATTTAAC
CGATCCTGAGAAAGACAGCGAAACGCatatttgaATGAAGATGAATATGT
TTCAAACAAAGATGAACGCAAAACGACTCCTTTGTTACGCAATCTCGGTC
GTTCTCAAGTTCACCAATGCTGTTGTGGACATAGAAATTGGTCATGGAGA
AGATATACAGATGACGTGGAACATACCACCAACCGCAAACAACCTCTTCA
TTTATCTCGGAAGCCAACGAGATGCACCCGTACTAGCACACATATCAAAA
GGTGAAATAGCATATTCAAAGAAGCTAACAGAAGCAAGGTTCGGCACCCG
GCTGTTTATACAAATGGTGGACAGCGATTTGAAATTAACGATCGTAGATG
CACAAGACAGTGACGAAGAAACATATACAGCGACAGCACAATTCGGAATC
GGCGAAGTCAAGATATTGCAAAGTTTTCGAGTTGAAGTCACAGGACTTTC
ATCTACCGACACCGGCATTATAGTCGGCATCGTCGTCGCAATCGTCGTTC
TTATTGTCGTCCTTATCCTGATACGTTATTGTTACGATCGTAATTATAAT
CCTGCCGACCATTTAACCGATCCTGAGAAAGACAGCGAAACGCatatttg
aATGAAGATGAATATGTTTCAAACAAAGATGAACGCAAAACGACTCCTTT
GTTACGCAATCTCGGTCGTTCTCAAGTTCACCAATGCTGTTGTGGACATA
GAAATTGGTCATGGAGAAGATATACAGATGACGTGGAACATACCACCAAC
CGCAAACAACCTCTTCATTTATCTCGGAAGCCAACGAGATGCACCCGTAC
TAGCACACATATCAAAAGGTGAAATAGCATATTCAAAGAAGCTAACAGAA
GCAAGGTTCGGCACCCGGCTGTTTATACAAATGGTGGACAGCGATTTGAA
ATTAACGATCGTAGATGCACAAGACAGTGACGAAGAAACATATACAGCGA
CAGCACAATTCGGAATCGGCGAAGTCAAGATATTGCAAAGTTTTCGAGTT
GAAGTCACAGGACTTTCATCTACCGACACCGGCATTATAGTCGGCATCGT
CGTCGCAATCGTCGTTCTTATTGTCGTCCTTATCCTGATACGTTATTGTT
ACGATCGTAATTATAATCCTGCCGACCATTTAACCGATCCTGAGAAAGAC
AGCGAAACGCatatttga
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_001205XLOC_001205Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00002274-exon-sc0000019-1491911889:751067..751111TCONS_00002274-exon-sc0000019-1491911889:751067..751111Clytia hemisphaericaexon
TCONS_00002274-exon-sc0000019-1510915933:751067..751111TCONS_00002274-exon-sc0000019-1510915933:751067..751111Clytia hemisphaericaexon
TCONS_00002274-exon-sc0000019-1575043694:751067..751111TCONS_00002274-exon-sc0000019-1575043694:751067..751111Clytia hemisphaericaexon
TCONS_00002274-exon-sc0000019-1491911889:751990..752084TCONS_00002274-exon-sc0000019-1491911889:751990..752084Clytia hemisphaericaexon
TCONS_00002274-exon-sc0000019-1510915933:751990..752084TCONS_00002274-exon-sc0000019-1510915933:751990..752084Clytia hemisphaericaexon
TCONS_00002274-exon-sc0000019-1575043694:751990..752084TCONS_00002274-exon-sc0000019-1575043694:751990..752084Clytia hemisphaericaexon
TCONS_00002274-exon-sc0000019-1491911889:753810..753953TCONS_00002274-exon-sc0000019-1491911889:753810..753953Clytia hemisphaericaexon
TCONS_00002274-exon-sc0000019-1510915933:753810..753953TCONS_00002274-exon-sc0000019-1510915933:753810..753953Clytia hemisphaericaexon
TCONS_00002274-exon-sc0000019-1575043694:753810..753953TCONS_00002274-exon-sc0000019-1575043694:753810..753953Clytia hemisphaericaexon
TCONS_00002274-exon-sc0000019-1491911889:755965..756156TCONS_00002274-exon-sc0000019-1491911889:755965..756156Clytia hemisphaericaexon
TCONS_00002274-exon-sc0000019-1510915933:755965..756156TCONS_00002274-exon-sc0000019-1510915933:755965..756156Clytia hemisphaericaexon
TCONS_00002274-exon-sc0000019-1575043694:755965..756156TCONS_00002274-exon-sc0000019-1575043694:755965..756156Clytia hemisphaericaexon
TCONS_00002274-exon-sc0000019-1491911889:756926..758212TCONS_00002274-exon-sc0000019-1491911889:756926..758212Clytia hemisphaericaexon
TCONS_00002274-exon-sc0000019-1510915933:756926..758212TCONS_00002274-exon-sc0000019-1510915933:756926..758212Clytia hemisphaericaexon
TCONS_00002274-exon-sc0000019-1575043694:756926..758212TCONS_00002274-exon-sc0000019-1575043694:756926..758212Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00002274-proteinTCONS_00002274-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000019supercontigsc0000019:751067..758212 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.00615739 0.000674464 0 0.00723124 0.0523213 0 1.78566 1.59753 1.0614 0.918085 1.34907 1.35926 0.059127 0 0 0.00344446 0 0 0.542178 0.374317 0.394889 0.718953 0.211636 0.386603 0.233837 0.269674 0.0872292 0 2.29015e-05 0.00863654
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR013783Ig-like_fold
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00002274 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top