Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00002260 (transcript) - C. hemisphaerica

Overview
NameTCONS_00002260
Unique NameTCONS_00002260
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1186

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00002260 ID=TCONS_00002260|Name=TCONS_00002260|organism=Clytia hemisphaerica|type=transcript|length=1186bp
TTTGGAAACTCATCAATCAATATTCTGTTACAGTACATAAAAAgcttttt
ctcaaaaacaattttgtgtGCAGGTTGCACATACTGTAGTGCAGATTGAA
AgagagattttatttatttccgaAACATTTCGACTACAGAGAGAAGTATT
TTTGAACGAGAGAAGAAAGCTAGTGTTATTAAATTTAGGCGACCTCTTGA
AAAGGAAATCATTCTCTACATTATAAATAGTCATGACAAGCAAAAGTGCC
ATTCGACAAAACTACAATGGTGATTGTGAAGCTCTCGTCAACAAGCATGC
AAATATGGAGTTGTACGCATCTTACctttatacttcattgaGTTTCCATT
TCGATCGTTCAGACATTTCGTCTCACGGATATTCTCAATTCTTCAAGAAA
ATGTCAACAAAGAAATCTTCTGCTGCACACGAGtttttaaaGTATCAAAA
CAAGCGTGGAGGGCGTGTATGTTTCCAAGACATAAGTACGCCACCAGTTG
AATGGAAAACGCCCGATGACGCCCTTCAAGAATcacttgaaattgaaaag
agaatAAATGCACATCTAATCGCATTGAAATCTACAGCAGACGCAAATAA
AGATGCTCATCTAGAACACTTCTTAGATGGTCATATAGACTCTGTTGTGG
AATGCATCAATACTTTTGGTCACTTGATAACGAATTTGAAACGTTGTGGT
ACTGGACTTGGTGGCTACCAGTTTGATCATCTAACCATGGAGAAAATGTA
ATTTTGTTCGTCAattaattttctgaaatttaacattatatatataCTGA
TTCCAGGTATACTCCAATATGCTCATTTGACcaagtgaaaatttgaattg
tttctTTTAGTTCTTTGATGTTCTCATTTACGACAAAATTATGtatggat
ttttttttgaacTATGATTAATACTTTAACTTTATTGggcaacttttttt
aaaaacagaaaacGCATGTAATTCCTGCTTGGTTTtagttttctgaattt
tatttccttccagggtcggatacaggaggcaggctatcttattcatggag
agtaattagtttccatataaggtaatacgataataaagtgcactctcctc
cattggttatagcctccctctgtatccgagcctgcaTTCTGGCTTGAAAC
CTACTTATTAGGTGAAAATTTTGAGgtgatggtttg
Run BLAST on NCBI

protein sequence of TCONS_00002260-protein

>TCONS_00002260-protein ID=TCONS_00002260-protein|Name=TCONS_00002260-protein|organism=Clytia hemisphaerica|type=polypeptide|length=172bp
MTSKSAIRQNYNGDCEALVNKHANMELYASYLYTSLSFHFDRSDISSHGY
SQFFKKMSTKKSSAAHEFLKYQNKRGGRVCFQDISTPPVEWKTPDDALQE
SLEIEKRINAHLIALKSTADANKDAHLEHFLDGHIDSVVECINTFGHLIT
NLKRCGTGLGGYQFDHLTMEKM
Run BLAST on NCBI

transcript from alignment at sc0000019:595127..599396+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00002260 ID=TCONS_00002260|Name=TCONS_00002260|organism=Clytia hemisphaerica|type=transcript|length=4270bp|location=Sequence derived from alignment at sc0000019:595127..599396+ (Clytia hemisphaerica)
TTTGGAAACTCATCAATCAATATTCTGTTACAGTACATAAAAAgcttttt ctcaaaaacaattttgtgtGCAGGTTGCACATACTGTAGTGCAGATTGAA AgagagattttatttatttccgaAACATTTCGACTACAGAGAGAAGTATT TTTGAACGAGAGAAGAAAGCTAGTGTTATTAAATTTAGGCGACCTCTTGA AAAGGAAATCATTCTCTACATTATAAATAGGCAGGTATTCTTTTACTTTC TTGTTCCTTTCTCAGATTGTTTACGCTTCAATAACGTGGAAAGCTAACAA CGACGAAAGCTTTTTTCAGAATCTCAGACCCCGATTCAATAGTCCTATAG GAGATGGTACTACCAACTTTGTTTGACAGTTTCTCCAGCTCTTTTTTTTC CGTCGATTTCTATGGTTACGACGGAATTTTGGTAAACGTCAACCAAGATG GAAGTACCATCTCCTAGAGAACTATAATTCATACCGTGAAGtcgagtaac ttgcatcagtggagggaatacttgcatagccatcaaatgactaacgaatc aaagcagcaaaatttcaaaacaaatggtacgcagctctgctcgcagctct actctaccatttttgatttgatttaactTAGTATTTGATTTCTCTTTGTA TTGACCAGCCAgttcattcatttgagggctatgcatgttagcctcaattg atgcaagttacccgatctcacggtaatGGTCCTGGCTTCAGCAACGGGTC AATTCATCGGGGCATTTCTCGGACAGTGTGCTTTGTGCGTCTAAtgtgat gttttttttataatagatTCGAAAAGTGAATAAAGAAAAGAAGTATAaac actttctttcttttttgactttttttttgccaaaattgaaaaagagaGTT AGTGTAAGTTAGTGGATGAAAGTTCGTagcgaaatcccaatggggataga aattctattgttcctagGTAAAAAATCTGACGGGAAtagttttgaagtgc aattttttaccaTTGAATTTACAATGGGAATAAAAACATAATCAATTTCC TAGTGGGACTAAAATTGTGGGTTGTTTTTTTCCACCGGATACAAAATTTT AGCAATATTTTCCggcgggtctatgacacagtGTTGTTCAAAGGCTCGAA ATTACTTTCAACATAAATAAGACTCGTCCATCATTGCATTTTAGTCATGA CAAGCAAAAGTGCCATTCGACAAAACTACAATGGTGATTGTGAAGCTCTC GTCAACAAGCATGCAAATATGGAGTTGTACGCATCTTACctttatacttc attggtaaGTTaaactcccttctcacagacccaatcGGGATTTTTCAACA GCGAGAATAAAAGTAACGGACTGAAAATCGATGGGGATCAAAGTCAGAGA ATTCATTAGAGAATATATTGTcagaaagttgataaaatgtcttTAGCAGG GACATGACGAAATATTGTGGAAAAAGAGAAGCTTTAAAATTTCTATGGCA CTACTTGCTCCGaaagtaaataaatttttgtctgACCATATTCTTTTTTT CCCACCCTATATTGTCAAATCCTAAATCGTTGGTTACTTAATTTCAGAAT TTATTCATTTAATTTTCAGAGGCGCACGGGGTCAAAAATTCGAGTATAAA TTTCCACCGGGGAagatattttttccaatttttccagtaggaGAGGGTCC CACTGGGTCCATAAGAAAGTTGTACTAATCAAGTTCGAGGGTAAGATTTC CTACCATTAATGAACTTGCAAAATCATAAGAAACACCTGGATTTATTTTA CTTGCACACCTAACTTACCTGTTCACTTAAGactattttttgtgatttca gaGTTTCCATTTCGATCGTTCAGACATTTCGTCTCACGGATATTCTCAAT TCTTCAAGAAAATGTCAACAAAGAAATCTTCTGCTGCACACGAGGTGAGT ATTTAacaaacccagctggcacacaacgttgtttcaacgtttttctaacg ttatatggacgttgtaaacgttagaaaaacgtcgaaacaacgttgtgtgc cagctgtgAACAAATATAACCATTTCTTGCCATACCTATTCTTATTGTGA ATCAAAAAGGGTAGAAAATAAGCAGACTAAAGTCAACGTGTTTCCCTCTA TTATGACGTcactacaatgacttctttaaatctttttcaGCCCACTTTTT ACCTACTATAACAATTAATATTGGCAGGGCagaaatttggccctgtttaa ACTAGAGTCAACTTAAAGGGGAACTcagcaaatttttcatttttattttt ttcctgatttttggtaatattaagtataaaaatgagaaagaaagtatATA GGTTCGATctctcaaataaaaatcatgANNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNTCTTCACTGATTTTTAGCCTGAGAAGATAAG CATCTTCCTCTTTCTGAATGCAGCTACGTCATAAAACAGCTGAAAGTgcg tcttttttatttgataaacaaGTCCATTTTAGTAGAGGGGAGCCTCTATT TAAAAGCTCATTAAACTAATTTTTAGAGTGAAAGGAGAGTtgcaaccttg aaattttgaaatttatcgttgaaacaaaccatttcaggatagaaacaaaa aaatccaaaatttgttgagttcccctttaaaTAATCTTTTGTTGACCACA TGAACAAATCAAATCTAGTTGACAGCCATAGCCTAGTCTTAATCCCTTAA AAAGatctttctttcagtttttaaaGTATCAAAACAAGCGTGGAGGGCGT GTATGTTTCCAAGACATAAGTACGCCACCAGTTGAATGGAAAACGCCCGA TGACGCCCTTCAAGAATcacttgaaattgaaaagagaatAAATGCACATC TAATCGCATTGAAATCTACAGCAGACGCAAATAAAGATGCTCATCTAGAA CACTTCTTAGATGGTCATATAGACTCTGTTGTGGAATGCATCAATACTTT TGGTCACTTGATAACGAATTTGAAACGTTGTGGTACTGGACTTGGTGGCT ACCAGTTTGATCATCTAACCATGGAGAAAATGTAATTTTGTTCGTCAatt aattttctgaaatttaacattatatatataCTGATTCCAGGTATACTCCA ATATGCTCATTTGACcaagtgaaaatttgaattgtttctTTTAGTTCTTT GATGTTCTCATTTACGACAAAATTATGtatggatttttttttgaacTATG ATTAATACTTTAACTTTATTGggcaactttttttaaaaacagaaaacGCA TGTAATTCCTGCTTGGTTTtagttttctgaattttatttccttccagggt cggatacaggaggcaggctatcttattcatggagagtaattagtttccat ataaggtaatacgataataaagtgcactctcctccattggttatagcctc cctctgtatccgagcctgcaTTCTGGCTTGAAACCTACTTATTAGGTGAA AATTTTGAGgtgatggtttg

Coding sequence (CDS) from alignment at sc0000019:595127..599396+

>TCONS_00002260 ID=TCONS_00002260|Name=TCONS_00002260|organism=Clytia hemisphaerica|type=CDS|length=1557bp|location=Sequence derived from alignment at sc0000019:595127..599396+ (Clytia hemisphaerica)
ATGACAAGCAAAAGTGCCATTCGACAAAACTACAATGGTGATTGTGAAGC
TCTCGTCAACAAGCATGCAAATATGGAGTTGTACGCATCTTACctttata
cttcattgaGTTTCCATTTCGATCGTTCAGACATTTCGTCTCACGGATAT
TCTCAATTCTTCAAGAAAATGTCAACAAAGAAATCTTCTGCTGCACACGA
GtttttaaaGTATCAAAACAAGCGTGGAGGGCGTGTATGTTTCCAAGACA
TAAGTACGCCACCAGTTGAATGGAAAACGCCCGATGACGCCCTTCAAGAA
TcacttgaaattgaaaagagaatAAATGCACATCTAATCGCATTGAAATC
TACAGCAGACGCAAATAAAGATGCTCATCTAGAACACTTCTTAGATGGTC
ATATAGACTCTGTTGTGGAATGCATCAATACTTTTGGTCACTTGATAACG
AATTTGAAACGTTGTGGTACTGGACTTGGTGGCTACCAGTTTGATCATCT
AACCATGGAGAAAATGTAAATGACAAGCAAAAGTGCCATTCGACAAAACT
ACAATGGTGATTGTGAAGCTCTCGTCAACAAGCATGCAAATATGGAGTTG
TACGCATCTTACctttatacttcattgaGTTTCCATTTCGATCGTTCAGA
CATTTCGTCTCACGGATATTCTCAATTCTTCAAGAAAATGTCAACAAAGA
AATCTTCTGCTGCACACGAGtttttaaaGTATCAAAACAAGCGTGGAGGG
CGTGTATGTTTCCAAGACATAAGTACGCCACCAGTTGAATGGAAAACGCC
CGATGACGCCCTTCAAGAATcacttgaaattgaaaagagaatAAATGCAC
ATCTAATCGCATTGAAATCTACAGCAGACGCAAATAAAGATGCTCATCTA
GAACACTTCTTAGATGGTCATATAGACTCTGTTGTGGAATGCATCAATAC
TTTTGGTCACTTGATAACGAATTTGAAACGTTGTGGTACTGGACTTGGTG
GCTACCAGTTTGATCATCTAACCATGGAGAAAATGTAAATGACAAGCAAA
AGTGCCATTCGACAAAACTACAATGGTGATTGTGAAGCTCTCGTCAACAA
GCATGCAAATATGGAGTTGTACGCATCTTACctttatacttcattgaGTT
TCCATTTCGATCGTTCAGACATTTCGTCTCACGGATATTCTCAATTCTTC
AAGAAAATGTCAACAAAGAAATCTTCTGCTGCACACGAGtttttaaaGTA
TCAAAACAAGCGTGGAGGGCGTGTATGTTTCCAAGACATAAGTACGCCAC
CAGTTGAATGGAAAACGCCCGATGACGCCCTTCAAGAATcacttgaaatt
gaaaagagaatAAATGCACATCTAATCGCATTGAAATCTACAGCAGACGC
AAATAAAGATGCTCATCTAGAACACTTCTTAGATGGTCATATAGACTCTG
TTGTGGAATGCATCAATACTTTTGGTCACTTGATAACGAATTTGAAACGT
TGTGGTACTGGACTTGGTGGCTACCAGTTTGATCATCTAACCATGGAGAA
AATGTAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_001195XLOC_001195Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00002260-proteinTCONS_00002260-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00002260-exon-sc0000019-1491911889:595127..595356TCONS_00002260-exon-sc0000019-1491911889:595127..595356Clytia hemisphaericaexon
TCONS_00002260-exon-sc0000019-1510915933:595127..595356TCONS_00002260-exon-sc0000019-1510915933:595127..595356Clytia hemisphaericaexon
TCONS_00002260-exon-sc0000019-1575043694:595127..595356TCONS_00002260-exon-sc0000019-1575043694:595127..595356Clytia hemisphaericaexon
TCONS_00002260-exon-sc0000019-1491911889:596321..596430TCONS_00002260-exon-sc0000019-1491911889:596321..596430Clytia hemisphaericaexon
TCONS_00002260-exon-sc0000019-1510915933:596321..596430TCONS_00002260-exon-sc0000019-1510915933:596321..596430Clytia hemisphaericaexon
TCONS_00002260-exon-sc0000019-1575043694:596321..596430TCONS_00002260-exon-sc0000019-1575043694:596321..596430Clytia hemisphaericaexon
TCONS_00002260-exon-sc0000019-1491911889:596978..597070TCONS_00002260-exon-sc0000019-1491911889:596978..597070Clytia hemisphaericaexon
TCONS_00002260-exon-sc0000019-1510915933:596978..597070TCONS_00002260-exon-sc0000019-1510915933:596978..597070Clytia hemisphaericaexon
TCONS_00002260-exon-sc0000019-1575043694:596978..597070TCONS_00002260-exon-sc0000019-1575043694:596978..597070Clytia hemisphaericaexon
TCONS_00002260-exon-sc0000019-1491911889:598644..599396TCONS_00002260-exon-sc0000019-1491911889:598644..599396Clytia hemisphaericaexon
TCONS_00002260-exon-sc0000019-1510915933:598644..599396TCONS_00002260-exon-sc0000019-1510915933:598644..599396Clytia hemisphaericaexon
TCONS_00002260-exon-sc0000019-1575043694:598644..599396TCONS_00002260-exon-sc0000019-1575043694:598644..599396Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000019supercontigsc0000019:595127..599396 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
55.2508 54.4356 44.1276 31.5782 2.19557 0.895534 10.7239 8.81061 9.61003 21.6767 10.4957 21.8562 4.37253 4.73226 7.33585 8.33458 2.94066 6.4971 8.86986e-06 3.43939e-06 15.2895 11.3526 34.9554 25.088 6.37148 4.46727 56.0274 59.6031 11.2028 14.1805
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR012347Ferritin-rel
IPR008331Ferritin_DPS_dom
IPR009040Ferritin-like_diiron
IPR009078Ferritin-like_SF
Vocabulary: Biological Process
TermDefinition
GO:0006879cellular iron ion homeostasis
Vocabulary: Molecular Function
TermDefinition
GO:0008199ferric iron binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006879 cellular iron ion homeostasis
molecular_function GO:0008199 ferric iron binding
Blast
BLAST of TCONS_00002260 vs. Swiss-Prot (Human)
Match: FRIL (Ferritin light chain OS=Homo sapiens GN=FTL PE=1 SV=2)

HSP 1 Score: 139.428 bits (350), Expect = 9.303e-39
Identity = 74/171 (43.27%), Postives = 101/171 (59.06%), Query Frame = 2
Query:  245 SAIRQNYNGDCEALVNKHANMELYASYLYTSLSFHFDRSDISSHGYSQFFKKMSTKKSSAAHEFLKYQNKRGGRVCFQDISTPPV-EWKTPDDALQESLEIEKRINAHLIALKSTADANKDAHLEHFLDGH-IDSVVECINTFGHLITNLKRCG---TGLGGYQFDHLTME 742
            S IRQNY+ D EA VN   N+ L ASY Y SL F+FDR D++  G S FF++++ +K       LK QN+RGGR  FQDI  P   EW    DA++ ++ +EK++N  L+ L +   A  D HL  FL+ H +D  V+ I   G  +TNL R G    GLG Y F+ LT++
Sbjct:    3 SQIRQNYSTDVEAAVNSLVNLYLQASYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQNQRGGRALFQDIKKPAEDEWGKTPDAMKAAMALEKKLNQALLDLHALGSARTDPHLCDFLETHFLDEEVKLIKKMGDHLTNLHRLGGPEAGLGEYLFERLTLK 173          
The following BLAST results are available for this feature:
BLAST of TCONS_00002260 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
FRIL9.303e-3943.27Ferritin light chain OS=Homo sapiens GN=FTL PE=1 S... [more]
back to top