Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00002241 (transcript) - C. hemisphaerica

Overview
NameTCONS_00002241
Unique NameTCONS_00002241
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2667

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00002241 ID=TCONS_00002241|Name=TCONS_00002241|organism=Clytia hemisphaerica|type=transcript|length=2667bp
AAATAATCaatccaaaatttttatatgaattcACAATTTAAAACcagatt
gtaattttttttctagcaGTCATCAGGATCTTCACTGGTTCATGTTGATG
CTTCACAAGTCTCAACTACTCAACAACCCACTTATGTTTTGTTGCAAGCT
CCGGGTGATTCTGAATCAGGTGGTCAACCACAAGTTTTTCTTGCAATGCA
AACAACCAACATTAGTACAGATGCGCAAGGATCCACACCTTACATCACCC
TGCAGCCTGTATCAGTTGACGGTGGAGAGTTGACGTCAGGCACATTGGTT
CAGGAAGGCGTCAATCTTCAACAGGCTGTCATGACAAATAGTAATAGTTC
TGACGTTAAAGGAGATTCTTCTGAAAACAATccacaacagcaacaacaac
agGTTGTTTTGAGCATTCCAAGCCAACAATCTATTCTGTCAGCTACAAAC
GGCAACAGTGGGCAATTAGTGACCTATCTTCAACCACTTGGCAACATTGG
TGTGCCAGTGTCAAACATGGATCAAGGCCAAGTTTTAATGGCTGCCAGTG
ATCTCCAAGGCAACGTTACATTACATAATATGGCAAACATAAATGGTGGT
AAAAGAAATGTTCTTACTACAAACAGACAAGCTACTCAAGTGAATTTGTC
CACTCCTCGACGTCGTTTGAGTACAGATCCAAGAAGCTGTGATCAATGTG
GCCGGACTTTCAAATACCCATCTGATCTCAAGAAACATTTACAAATCCAT
ACGGATATCAAGAAGTTTCAATGCGAAGACTGCAATCGATCCTTTCGACG
ATTGCATCAACTCAACGTTCATCGTCGTATTCACACCGGTGAAAAGCCCT
ATGTTTGTAATAGATGTAACGCGCAATTTCGACACGATTCAACACTTACG
ATGCATATCCGAACACGTCACGATCATTTGAAACCGTTCACTTGCGATGG
TTGCTCTAAGAAATTTGGTCGAATGTCTCACCTACGGAAACACCAACACA
ATGTATGCGGGCGCACCAGTATCCGGACGTCCATAGCTCAATGTAAATAT
TGTGACGCTATTTTCTCCAAGAAGTCCGACTTGAAGTCTCACTTTCCGGT
CTGTGAAAAGAAGCCAGAACGCGTTGAGAAAGACTTGAACGCACAACAAG
TTTATCAGTGTGAAACATGTGGTAAAGTTTTCTCGCGCGTTTACGATTTC
AAACGTCATCAGTTATCCCATTCCGATGAGAAACCATACGGATGTCCTCA
GTGCGGAAAGACATTTAAAGAGCGTTCTTCATTGAATAAACACGTGAAAC
GTATGCATTGTAGTGAAGGCGACGGCACGATCCCGATTGACGACGACGGA
ATAATCGCTGACGATGATGACGAGGACGAAGACGAATTGTCGGTGGACGA
AAACGAACTCGCTTCTCAAGCCAACATTACGGTACCGAAGGCAGCAGTTT
TCACTCAATCAGGAATCATGACCAATGCTGTCAGTCAAGTTGTTACTGCG
AACGGTCAAACTATCCCTGCTTCTGAgattttgaatttcccagaAGTTGC
AGAAGCCTTAGGTATCAATTCCGGATCACACGCACGTGTACTCAACACTG
ACGGCCATTCAACCATGATCGCAATAACGCAACCAGGGAACCTGGAAACC
AGTGAGGTTTCCATGGATATGGAACAAAACATGATGCAAGATGGTACCAT
AATAGTGACAGATAACTCGACAACAAATACTGAACCTTTTATAACACCAA
ACGAACAATTAAATCAAATTACACCCGTTGACGAAAGTGAGCCAATAGAA
ACTGTGGACGGGATACCCGTTATTTATAATCCGGAAAATGTAGACAGTTC
GGCAGCTTCGAGTATTTATACAACGTCACTGGCATCCTCTATGGTATTCA
AAAGAGACAGTGTGAAAGATTACGCCATCAAACACGAAGAAGAAGTGGCG
GATCATGTGAAGGCGGAACAGGCGGCCGCCCATGATTTACAGCCAGTTGA
GGACCCTAACATGTTAGTGGAAGAGTGAAATTTGTGTAGAAATTCGCACT
TGGGTTGTAGAAATTCTTGATAtacgtaagtcatttttctagcggaagca
cccgaaaaaagccgggatttgacctctctctgttactaaaaatagaaaca
cggaggtcaaaatccggcttttttgggtgcttccgctaaaaaaatatgac
gtcatcttgacttacgcatatcaagaataggtTGGgttattttgaagaat
atggTCATCTTGAAAACCTTGACTAATGATGTGTGAAAAATAACAACATT
AAAATATATCACGCAGTTCTTTCCCTACCtttcattttgatgattttctt
tattttcttcctATTTATTGGGGCTATCTGGAGAAGATTTGGTCCTAGTA
TCTTTTTGTGGGTCTTATCTCTTCAAACTTGGTTCTTTTAAAGCTCTTTG
ATTAAATGATTTACTAAACAGGAATCTTTTTGGGACTGCGGTTATTAAAG
ACTTTGTAGTATAGAGGGTGTATCTATTTTGGCTTTATTTTGTACATACT
TTATTAGACTAGAGTTTCCTAATAATAATATAGAACTTAttcgaaatgaa
aaagtttttatatcTTATTTTTTCTGATGGCTACAGAAGAGAATGGAACA
AATAGAATGCGTTTTCC
Run BLAST on NCBI

protein sequence of TCONS_00002241-protein

>TCONS_00002241-protein ID=TCONS_00002241-protein|Name=TCONS_00002241-protein|organism=Clytia hemisphaerica|type=polypeptide|length=610bp
MQTTNISTDAQGSTPYITLQPVSVDGGELTSGTLVQEGVNLQQAVMTNSN
SSDVKGDSSENNPQQQQQQVVLSIPSQQSILSATNGNSGQLVTYLQPLGN
IGVPVSNMDQGQVLMAASDLQGNVTLHNMANINGGKRNVLTTNRQATQVN
LSTPRRRLSTDPRSCDQCGRTFKYPSDLKKHLQIHTDIKKFQCEDCNRSF
RRLHQLNVHRRIHTGEKPYVCNRCNAQFRHDSTLTMHIRTRHDHLKPFTC
DGCSKKFGRMSHLRKHQHNVCGRTSIRTSIAQCKYCDAIFSKKSDLKSHF
PVCEKKPERVEKDLNAQQVYQCETCGKVFSRVYDFKRHQLSHSDEKPYGC
PQCGKTFKERSSLNKHVKRMHCSEGDGTIPIDDDGIIADDDDEDEDELSV
DENELASQANITVPKAAVFTQSGIMTNAVSQVVTANGQTIPASEILNFPE
VAEALGINSGSHARVLNTDGHSTMIAITQPGNLETSEVSMDMEQNMMQDG
TIIVTDNSTTNTEPFITPNEQLNQITPVDESEPIETVDGIPVIYNPENVD
SSAASSIYTTSLASSMVFKRDSVKDYAIKHEEEVADHVKAEQAAAHDLQP
VEDPNMLVEE
Run BLAST on NCBI

transcript from alignment at sc0000019:323569..327825+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00002241 ID=TCONS_00002241|Name=TCONS_00002241|organism=Clytia hemisphaerica|type=transcript|length=4257bp|location=Sequence derived from alignment at sc0000019:323569..327825+ (Clytia hemisphaerica)
AAATAATCaatccaaaatttttatatgaattcACAATTTAAAACcagatt gtaattttttttctagcaGTCATCAGGATCTTCACTGGTTCATGTTGATG CTTCACAAGTCTCAACTACTCAACAACCCACTTATGTTTTGTTGCAAGCT CCGGGTGATTCTGAATCAGGTGAGTTGacaatatattaaaaaaatccTGT AAAAGAGGTTTGCGTGCTATATTGAAACTTTGAGTGGATATATTGATACT AATGAACATAACCCATAGCTCAGTTTCCAAGATATGTATTTCAGGGTCAG TTTTCTGttgaatttaaagattttaggTGAAGTATGGATTTTCGtctaaa atataaatttttgtattAAGTTCCATTTTTCcactattttagaaaaaaga gtaCCCTGTGATTTATTCTCTTTTTGAAcaagttttgttaaaaatttcta aagtaTTTTTCATTCATTCCTGTATTGCTAGGTGGTCAACCACAAGTTTT TCTTGCAATGCAAACAACCAACATTAGTACAGATGCGCAAGGATCCACAC CTTACATCACCCTGCAGCCTGTATCAGTTGACGGTGGAGAGTTGACGTCA GGCACATTGGTTCAGGAAGGCGTCAATCTTCAACAGGCTGTCATGACAAA TAGTAATAGTTCTGACGTTAAAGGAGATTCTTCTGAAAACAATccacaac agcaacaacaacaggTTTGAAAATACTCTCCATGAACTACTTAATTGCAT GcagttttttgtttataatacGTCTTTATCTGTTAGTTCTGGTTAGTTAT CAATACTTGTGACTCCTCTTTATTAAccaaatttcttcaatttttaataG TACTGCAAAAATACCTACCACTGTGCTTTTATATAACAATTCctatttgt cttttttttctcctttgCTTTAGGTTGTTTTGAGCATTCCAAGCCAACAA TCTATTCTGTCAGCTACAAACGGCAACAGTGGGCAATTAGTGACCTATCT TCAACCACTTGGCAACATTGGTGTGCCAGTGTCAAACATGGATCAAGGCC AAGTTTTAATGGCTGCCAGTGATCTCCAAGGCAACGTTACATTACATAAT ATGGCAAACATAAATGGTGGTAAAAGAAATGGTGAGTTTGGGCGCATTAA GAATCCTCTAAAACCTTTTTTCTTGTTGTTTGATGAATAGCCAAATAAAT TAACGGAGTGAATGAAAAGAGTTGTCATTTGTGTCACCAAAAGTCAGTTG ATTAACAAAATGAGAATCAAAGAGTTTTCCTTCTTAACATCTGACTCTGC GTGTCAATCAGGAAAAGGAAATAAACATCATCTCCCCATGCCGGTTTTGT GtttctaataaaagtttttcatgttttattccAGTTCTTACTACAAACAG ACAAGCTACTCAAGTGAATTTGTCCACTCCTCGACGTCGTTTGAGTACAG ATCCAAGAAGCTGTGATCAATGTGGCCGGACTTTCAAATACCCATCTGAT CTCAAGAAACATTTACAAATCCATACGGGTATGCCAATACTCTCAATTTC TCACTTATTATTACTTACATTAACGATTATTTATCTCACTTTCTCTTATA ACTCCCACACTAATTATAGAAAATGCAAAACCGAGCTTTCAGCCTCGGAA AACAGCAGAGTATTCTCATATTGTAATGAGGTTATACCAATACTTACTCA ATACTTTCAATTACTCACTTTCTATACATTTATAATTAAGCATACAATCG GCTACAATTAAAAGGGGCTCCAACACTAATTCTTTGGGAATGCAAAATTT ACAGAATTTACAGCCTCCAAAAACAGCATATGAAAATATTGTAATGAGGT TATCTTCATGACCATAATAGAGGCTTAATCCAAATACATGCAGACGTCTC TTTAAAAGAATTCATTGTATATGTATGTGTATACAGGTGTATAGTCAATG TTTTGAATTCTTACTGAAAATGTTGAACCACTAAACTGTTTTTTTCCCAT AGATATCAAGAAGTTTCAATGCGAAGACTGCAATCGATCCTTTCGACGAT TGCATCAACTCAACGTTCATCGTCGTATTCACACCGGTGAAAAGCCCTAT GTTTGTAATAGGTAGGTGCAATTTTGTGTATCTCTCTTAATTAATATCAA ACTCTCTTGTCAGCTTTTAGATTAAGATTAGTGTAATTTTCGGATTATCA TTCGTACTGTGCATCCTATTAATCTTACCAACGCGATAAGGCTATTCTTG GACGTACCAGGATGAACGGTAATGACTTTATAGTATATCAATGTAATGAC AAACGTTTTGGTCATTCTGCTCTAacttgattttcaaaatatatttgatt taCATCGAGTAAGAGAGCGTATCGAATAAAAAGAAGTCACTCTAATTCGA TAAGCAAAAGAATATCAAATTATAGCTTGATTGTAACTGTTTTTGTTTTC CAGATGTAACGCGCAATTTCGACACGATTCAACACTTACGATGCATATCC GAACACGTCACGATCATTTGAAACCGTTCACTTGCGATGGTTGCTCTAAG AAATTTGGTCGAATGTCTCACCTACGGAAACACCAACACAATGTATGCGG GCGCACCAGTATCCGGACGTCCATAGCTCAATGTAAATATTGTGACGCTA TTTTCTCCAAGAAGTCCGACTTGAAGTCTCACTTTCCGGTCTGTGAAAAG AAGCCAGAACGCGTTGAGAAAGACTTGAACGCACAACAAGTTTATCAGTG TGAAACATGTGGTAAAGTTTTCTCGCGCGTTTACGATTTCAAACGTCATC AGTTATCCCATTCCGATGAGAAACCATACGGATGTCCTCAGTGCGGAAAG ACATTTAAAGAGCGTTCTTCATTGAATAAACACGTGAAACGTATGCATTG TAGTGAAGGCGACGGCACGATCCCGATTGACGACGACGGAATAATCGCTG ACGATGATGACGAGGACGAAGACGAATTGTCGGTGGACGAAAACGAACTC GCTTCTCAAGCCAACATTACGGTACCGAAGGCAGCAGTTTTCACTCAATC AGGAATCATGACCAATGCTGTCAGTCAAGTTGTTACTGCGAACGGTCAAA CTATCCCTGCTTCTGAgattttgaatttcccagaAGTTGCAGAAGCCTTA GGTATCAATTCCGGATCACACGCACGTGTACTCAACACTGACGGCCATTC AACCATGATCGCAATAACGCAACCAGGGAACCTGGAAACCAGTGAGGTTT CCATGGATATGGAACAAAACATGATGCAAGATGGTACCATAATAGTGACA GATAACTCGACAACAAATACTGAACCTTTTATAACACCAAACGAACAATT AAATCAAATTACACCCGTTGACGAAAGTGAGCCAATAGAAACTGTGGACG GGATACCCGTTATTTATAATCCGGAAAATGTAGACAGTTCGGCAGCTTCG AGTATTTATACAACGTCACTGGCATCCTCTATGGTATTCAAAAGAGACAG TGTGAAAGATTACGCCATCAAACACGAAGAAGAAGTGGCGGATCATGTGA AGGCGGAACAGGCGGCCGCCCATGATTTACAGCCAGTTGAGGACCCTAAC ATGTTAGTGGAAGAGTGAAATTTGTGTAGAAATTCGCACTTGGGTTGTAG AAATTCTTGATAtacgtaagtcatttttctagcggaagcacccgaaaaaa gccgggatttgacctctctctgttactaaaaatagaaacacggaggtcaa aatccggcttttttgggtgcttccgctaaaaaaatatgacgtcatcttga cttacgcatatcaagaataggtTGGgttattttgaagaatatggTCATCT TGAAAACCTTGACTAATGATGTGTGAAAAATAACAACATTAAAATATATC ACGCAGTTCTTTCCCTACCtttcattttgatgattttctttattttcttc ctATTTATTGGGGCTATCTGGAGAAGATTTGGTCCTAGTATCTTTTTGTG GGTCTTATCTCTTCAAACTTGGTTCTTTTAAAGCTCTTTGATTAAATGAT TTACTAAACAGGAATCTTTTTGGGACTGCGGTTATTAAAGACTTTGTAGT ATAGAGGGTGTATCTATTTTGGCTTTATTTTGTACATACTTTATTAGACT AGAGTTTCCTAATAATAATATAGAACTTAttcgaaatgaaaaagttttta tatcTTATTTTTTCTGATGGCTACAGAAGAGAATGGAACAAATAGAATGC GTTTTCC

Coding sequence (CDS) from alignment at sc0000019:323569..327825+

>TCONS_00002241 ID=TCONS_00002241|Name=TCONS_00002241|organism=Clytia hemisphaerica|type=CDS|length=9165bp|location=Sequence derived from alignment at sc0000019:323569..327825+ (Clytia hemisphaerica)
ATGCAAACAACCAACATTAGTACAGATGCGCAAGGATCCACACCTTACAT
CACCCTGCAGCCTGTATCAGTTGACGGTGGAGAGTTGACGTCAGGCACAT
TGGTTCAGGAAGGCGTCAATCTTCAACAGGCTGTCATGACAAATAGTAAT
AGTTCTGACGTTAAAGGAGATTCTTCTGAAAACAATccacaacagcaaca
acaacagGTTGTTTTGAGCATTCCAAGCCAACAATCTATTCTGTCAGCTA
CAAACGGCAACAGTGGGCAATTAGTGACCTATCTTCAACCACTTGGCAAC
ATTGGTGTGCCAGTGTCAAACATGGATCAAGGCCAAGTTTTAATGGCTGC
CAGTGATCTCCAAGGCAACGTTACATTACATAATATGGCAAACATAAATG
GTGGTAAAAGAAATGTTCTTACTACAAACAGACAAGCTACTCAAGTGAAT
TTGTCCACTCCTCGACGTCGTTTGAGTACAGATCCAAGAAGCTGTGATCA
ATGTGGCCGGACTTTCAAATACCCATCTGATCTCAAGAAACATTTACAAA
TCCATACGGATATCAAGAAGTTTCAATGCGAAGACTGCAATCGATCCTTT
CGACGATTGCATCAACTCAACGTTCATCGTCGTATTCACACCGGTGAAAA
GCCCTATGTTTGTAATAGATGTAACGCGCAATTTCGACACGATTCAACAC
TTACGATGCATATCCGAACACGTCACGATCATTTGAAACCGTTCACTTGC
GATGGTTGCTCTAAGAAATTTGGTCGAATGTCTCACCTACGGAAACACCA
ACACAATGTATGCGGGCGCACCAGTATCCGGACGTCCATAGCTCAATGTA
AATATTGTGACGCTATTTTCTCCAAGAAGTCCGACTTGAAGTCTCACTTT
CCGGTCTGTGAAAAGAAGCCAGAACGCGTTGAGAAAGACTTGAACGCACA
ACAAGTTTATCAGTGTGAAACATGTGGTAAAGTTTTCTCGCGCGTTTACG
ATTTCAAACGTCATCAGTTATCCCATTCCGATGAGAAACCATACGGATGT
CCTCAGTGCGGAAAGACATTTAAAGAGCGTTCTTCATTGAATAAACACGT
GAAACGTATGCATTGTAGTGAAGGCGACGGCACGATCCCGATTGACGACG
ACGGAATAATCGCTGACGATGATGACGAGGACGAAGACGAATTGTCGGTG
GACGAAAACGAACTCGCTTCTCAAGCCAACATTACGGTACCGAAGGCAGC
AGTTTTCACTCAATCAGGAATCATGACCAATGCTGTCAGTCAAGTTGTTA
CTGCGAACGGTCAAACTATCCCTGCTTCTGAgattttgaatttcccagaA
GTTGCAGAAGCCTTAGGTATCAATTCCGGATCACACGCACGTGTACTCAA
CACTGACGGCCATTCAACCATGATCGCAATAACGCAACCAGGGAACCTGG
AAACCAGTGAGGTTTCCATGGATATGGAACAAAACATGATGCAAGATGGT
ACCATAATAGTGACAGATAACTCGACAACAAATACTGAACCTTTTATAAC
ACCAAACGAACAATTAAATCAAATTACACCCGTTGACGAAAGTGAGCCAA
TAGAAACTGTGGACGGGATACCCGTTATTTATAATCCGGAAAATGTAGAC
AGTTCGGCAGCTTCGAGTATTTATACAACGTCACTGGCATCCTCTATGGT
ATTCAAAAGAGACAGTGTGAAAGATTACGCCATCAAACACGAAGAAGAAG
TGGCGGATCATGTGAAGGCGGAACAGGCGGCCGCCCATGATTTACAGCCA
GTTGAGGACCCTAACATGTTAGTGGAAGAGTGAATGCAAACAACCAACAT
TAGTACAGATGCGCAAGGATCCACACCTTACATCACCCTGCAGCCTGTAT
CAGTTGACGGTGGAGAGTTGACGTCAGGCACATTGGTTCAGGAAGGCGTC
AATCTTCAACAGGCTGTCATGACAAATAGTAATAGTTCTGACGTTAAAGG
AGATTCTTCTGAAAACAATccacaacagcaacaacaacagGTTGTTTTGA
GCATTCCAAGCCAACAATCTATTCTGTCAGCTACAAACGGCAACAGTGGG
CAATTAGTGACCTATCTTCAACCACTTGGCAACATTGGTGTGCCAGTGTC
AAACATGGATCAAGGCCAAGTTTTAATGGCTGCCAGTGATCTCCAAGGCA
ACGTTACATTACATAATATGGCAAACATAAATGGTGGTAAAAGAAATGTT
CTTACTACAAACAGACAAGCTACTCAAGTGAATTTGTCCACTCCTCGACG
TCGTTTGAGTACAGATCCAAGAAGCTGTGATCAATGTGGCCGGACTTTCA
AATACCCATCTGATCTCAAGAAACATTTACAAATCCATACGGATATCAAG
AAGTTTCAATGCGAAGACTGCAATCGATCCTTTCGACGATTGCATCAACT
CAACGTTCATCGTCGTATTCACACCGGTGAAAAGCCCTATGTTTGTAATA
GATGTAACGCGCAATTTCGACACGATTCAACACTTACGATGCATATCCGA
ACACGTCACGATCATTTGAAACCGTTCACTTGCGATGGTTGCTCTAAGAA
ATTTGGTCGAATGTCTCACCTACGGAAACACCAACACAATGTATGCGGGC
GCACCAGTATCCGGACGTCCATAGCTCAATGTAAATATTGTGACGCTATT
TTCTCCAAGAAGTCCGACTTGAAGTCTCACTTTCCGGTCTGTGAAAAGAA
GCCAGAACGCGTTGAGAAAGACTTGAACGCACAACAAGTTTATCAGTGTG
AAACATGTGGTAAAGTTTTCTCGCGCGTTTACGATTTCAAACGTCATCAG
TTATCCCATTCCGATGAGAAACCATACGGATGTCCTCAGTGCGGAAAGAC
ATTTAAAGAGCGTTCTTCATTGAATAAACACGTGAAACGTATGCATTGTA
GTGAAGGCGACGGCACGATCCCGATTGACGACGACGGAATAATCGCTGAC
GATGATGACGAGGACGAAGACGAATTGTCGGTGGACGAAAACGAACTCGC
TTCTCAAGCCAACATTACGGTACCGAAGGCAGCAGTTTTCACTCAATCAG
GAATCATGACCAATGCTGTCAGTCAAGTTGTTACTGCGAACGGTCAAACT
ATCCCTGCTTCTGAgattttgaatttcccagaAGTTGCAGAAGCCTTAGG
TATCAATTCCGGATCACACGCACGTGTACTCAACACTGACGGCCATTCAA
CCATGATCGCAATAACGCAACCAGGGAACCTGGAAACCAGTGAGGTTTCC
ATGGATATGGAACAAAACATGATGCAAGATGGTACCATAATAGTGACAGA
TAACTCGACAACAAATACTGAACCTTTTATAACACCAAACGAACAATTAA
ATCAAATTACACCCGTTGACGAAAGTGAGCCAATAGAAACTGTGGACGGG
ATACCCGTTATTTATAATCCGGAAAATGTAGACAGTTCGGCAGCTTCGAG
TATTTATACAACGTCACTGGCATCCTCTATGGTATTCAAAAGAGACAGTG
TGAAAGATTACGCCATCAAACACGAAGAAGAAGTGGCGGATCATGTGAAG
GCGGAACAGGCGGCCGCCCATGATTTACAGCCAGTTGAGGACCCTAACAT
GTTAGTGGAAGAGTGAATGCAAACAACCAACATTAGTACAGATGCGCAAG
GATCCACACCTTACATCACCCTGCAGCCTGTATCAGTTGACGGTGGAGAG
TTGACGTCAGGCACATTGGTTCAGGAAGGCGTCAATCTTCAACAGGCTGT
CATGACAAATAGTAATAGTTCTGACGTTAAAGGAGATTCTTCTGAAAACA
ATccacaacagcaacaacaacagGTTGTTTTGAGCATTCCAAGCCAACAA
TCTATTCTGTCAGCTACAAACGGCAACAGTGGGCAATTAGTGACCTATCT
TCAACCACTTGGCAACATTGGTGTGCCAGTGTCAAACATGGATCAAGGCC
AAGTTTTAATGGCTGCCAGTGATCTCCAAGGCAACGTTACATTACATAAT
ATGGCAAACATAAATGGTGGTAAAAGAAATGTTCTTACTACAAACAGACA
AGCTACTCAAGTGAATTTGTCCACTCCTCGACGTCGTTTGAGTACAGATC
CAAGAAGCTGTGATCAATGTGGCCGGACTTTCAAATACCCATCTGATCTC
AAGAAACATTTACAAATCCATACGGATATCAAGAAGTTTCAATGCGAAGA
CTGCAATCGATCCTTTCGACGATTGCATCAACTCAACGTTCATCGTCGTA
TTCACACCGGTGAAAAGCCCTATGTTTGTAATAGATGTAACGCGCAATTT
CGACACGATTCAACACTTACGATGCATATCCGAACACGTCACGATCATTT
GAAACCGTTCACTTGCGATGGTTGCTCTAAGAAATTTGGTCGAATGTCTC
ACCTACGGAAACACCAACACAATGTATGCGGGCGCACCAGTATCCGGACG
TCCATAGCTCAATGTAAATATTGTGACGCTATTTTCTCCAAGAAGTCCGA
CTTGAAGTCTCACTTTCCGGTCTGTGAAAAGAAGCCAGAACGCGTTGAGA
AAGACTTGAACGCACAACAAGTTTATCAGTGTGAAACATGTGGTAAAGTT
TTCTCGCGCGTTTACGATTTCAAACGTCATCAGTTATCCCATTCCGATGA
GAAACCATACGGATGTCCTCAGTGCGGAAAGACATTTAAAGAGCGTTCTT
CATTGAATAAACACGTGAAACGTATGCATTGTAGTGAAGGCGACGGCACG
ATCCCGATTGACGACGACGGAATAATCGCTGACGATGATGACGAGGACGA
AGACGAATTGTCGGTGGACGAAAACGAACTCGCTTCTCAAGCCAACATTA
CGGTACCGAAGGCAGCAGTTTTCACTCAATCAGGAATCATGACCAATGCT
GTCAGTCAAGTTGTTACTGCGAACGGTCAAACTATCCCTGCTTCTGAgat
tttgaatttcccagaAGTTGCAGAAGCCTTAGGTATCAATTCCGGATCAC
ACGCACGTGTACTCAACACTGACGGCCATTCAACCATGATCGCAATAACG
CAACCAGGGAACCTGGAAACCAGTGAGGTTTCCATGGATATGGAACAAAA
CATGATGCAAGATGGTACCATAATAGTGACAGATAACTCGACAACAAATA
CTGAACCTTTTATAACACCAAACGAACAATTAAATCAAATTACACCCGTT
GACGAAAGTGAGCCAATAGAAACTGTGGACGGGATACCCGTTATTTATAA
TCCGGAAAATGTAGACAGTTCGGCAGCTTCGAGTATTTATACAACGTCAC
TGGCATCCTCTATGGTATTCAAAAGAGACAGTGTGAAAGATTACGCCATC
AAACACGAAGAAGAAGTGGCGGATCATGTGAAGGCGGAACAGGCGGCCGC
CCATGATTTACAGCCAGTTGAGGACCCTAACATGTTAGTGGAAGAGTGAA
TGCAAACAACCAACATTAGTACAGATGCGCAAGGATCCACACCTTACATC
ACCCTGCAGCCTGTATCAGTTGACGGTGGAGAGTTGACGTCAGGCACATT
GGTTCAGGAAGGCGTCAATCTTCAACAGGCTGTCATGACAAATAGTAATA
GTTCTGACGTTAAAGGAGATTCTTCTGAAAACAATccacaacagcaacaa
caacagGTTGTTTTGAGCATTCCAAGCCAACAATCTATTCTGTCAGCTAC
AAACGGCAACAGTGGGCAATTAGTGACCTATCTTCAACCACTTGGCAACA
TTGGTGTGCCAGTGTCAAACATGGATCAAGGCCAAGTTTTAATGGCTGCC
AGTGATCTCCAAGGCAACGTTACATTACATAATATGGCAAACATAAATGG
TGGTAAAAGAAATGTTCTTACTACAAACAGACAAGCTACTCAAGTGAATT
TGTCCACTCCTCGACGTCGTTTGAGTACAGATCCAAGAAGCTGTGATCAA
TGTGGCCGGACTTTCAAATACCCATCTGATCTCAAGAAACATTTACAAAT
CCATACGGATATCAAGAAGTTTCAATGCGAAGACTGCAATCGATCCTTTC
GACGATTGCATCAACTCAACGTTCATCGTCGTATTCACACCGGTGAAAAG
CCCTATGTTTGTAATAGATGTAACGCGCAATTTCGACACGATTCAACACT
TACGATGCATATCCGAACACGTCACGATCATTTGAAACCGTTCACTTGCG
ATGGTTGCTCTAAGAAATTTGGTCGAATGTCTCACCTACGGAAACACCAA
CACAATGTATGCGGGCGCACCAGTATCCGGACGTCCATAGCTCAATGTAA
ATATTGTGACGCTATTTTCTCCAAGAAGTCCGACTTGAAGTCTCACTTTC
CGGTCTGTGAAAAGAAGCCAGAACGCGTTGAGAAAGACTTGAACGCACAA
CAAGTTTATCAGTGTGAAACATGTGGTAAAGTTTTCTCGCGCGTTTACGA
TTTCAAACGTCATCAGTTATCCCATTCCGATGAGAAACCATACGGATGTC
CTCAGTGCGGAAAGACATTTAAAGAGCGTTCTTCATTGAATAAACACGTG
AAACGTATGCATTGTAGTGAAGGCGACGGCACGATCCCGATTGACGACGA
CGGAATAATCGCTGACGATGATGACGAGGACGAAGACGAATTGTCGGTGG
ACGAAAACGAACTCGCTTCTCAAGCCAACATTACGGTACCGAAGGCAGCA
GTTTTCACTCAATCAGGAATCATGACCAATGCTGTCAGTCAAGTTGTTAC
TGCGAACGGTCAAACTATCCCTGCTTCTGAgattttgaatttcccagaAG
TTGCAGAAGCCTTAGGTATCAATTCCGGATCACACGCACGTGTACTCAAC
ACTGACGGCCATTCAACCATGATCGCAATAACGCAACCAGGGAACCTGGA
AACCAGTGAGGTTTCCATGGATATGGAACAAAACATGATGCAAGATGGTA
CCATAATAGTGACAGATAACTCGACAACAAATACTGAACCTTTTATAACA
CCAAACGAACAATTAAATCAAATTACACCCGTTGACGAAAGTGAGCCAAT
AGAAACTGTGGACGGGATACCCGTTATTTATAATCCGGAAAATGTAGACA
GTTCGGCAGCTTCGAGTATTTATACAACGTCACTGGCATCCTCTATGGTA
TTCAAAAGAGACAGTGTGAAAGATTACGCCATCAAACACGAAGAAGAAGT
GGCGGATCATGTGAAGGCGGAACAGGCGGCCGCCCATGATTTACAGCCAG
TTGAGGACCCTAACATGTTAGTGGAAGAGTGAATGCAAACAACCAACATT
AGTACAGATGCGCAAGGATCCACACCTTACATCACCCTGCAGCCTGTATC
AGTTGACGGTGGAGAGTTGACGTCAGGCACATTGGTTCAGGAAGGCGTCA
ATCTTCAACAGGCTGTCATGACAAATAGTAATAGTTCTGACGTTAAAGGA
GATTCTTCTGAAAACAATccacaacagcaacaacaacagGTTGTTTTGAG
CATTCCAAGCCAACAATCTATTCTGTCAGCTACAAACGGCAACAGTGGGC
AATTAGTGACCTATCTTCAACCACTTGGCAACATTGGTGTGCCAGTGTCA
AACATGGATCAAGGCCAAGTTTTAATGGCTGCCAGTGATCTCCAAGGCAA
CGTTACATTACATAATATGGCAAACATAAATGGTGGTAAAAGAAATGTTC
TTACTACAAACAGACAAGCTACTCAAGTGAATTTGTCCACTCCTCGACGT
CGTTTGAGTACAGATCCAAGAAGCTGTGATCAATGTGGCCGGACTTTCAA
ATACCCATCTGATCTCAAGAAACATTTACAAATCCATACGGATATCAAGA
AGTTTCAATGCGAAGACTGCAATCGATCCTTTCGACGATTGCATCAACTC
AACGTTCATCGTCGTATTCACACCGGTGAAAAGCCCTATGTTTGTAATAG
ATGTAACGCGCAATTTCGACACGATTCAACACTTACGATGCATATCCGAA
CACGTCACGATCATTTGAAACCGTTCACTTGCGATGGTTGCTCTAAGAAA
TTTGGTCGAATGTCTCACCTACGGAAACACCAACACAATGTATGCGGGCG
CACCAGTATCCGGACGTCCATAGCTCAATGTAAATATTGTGACGCTATTT
TCTCCAAGAAGTCCGACTTGAAGTCTCACTTTCCGGTCTGTGAAAAGAAG
CCAGAACGCGTTGAGAAAGACTTGAACGCACAACAAGTTTATCAGTGTGA
AACATGTGGTAAAGTTTTCTCGCGCGTTTACGATTTCAAACGTCATCAGT
TATCCCATTCCGATGAGAAACCATACGGATGTCCTCAGTGCGGAAAGACA
TTTAAAGAGCGTTCTTCATTGAATAAACACGTGAAACGTATGCATTGTAG
TGAAGGCGACGGCACGATCCCGATTGACGACGACGGAATAATCGCTGACG
ATGATGACGAGGACGAAGACGAATTGTCGGTGGACGAAAACGAACTCGCT
TCTCAAGCCAACATTACGGTACCGAAGGCAGCAGTTTTCACTCAATCAGG
AATCATGACCAATGCTGTCAGTCAAGTTGTTACTGCGAACGGTCAAACTA
TCCCTGCTTCTGAgattttgaatttcccagaAGTTGCAGAAGCCTTAGGT
ATCAATTCCGGATCACACGCACGTGTACTCAACACTGACGGCCATTCAAC
CATGATCGCAATAACGCAACCAGGGAACCTGGAAACCAGTGAGGTTTCCA
TGGATATGGAACAAAACATGATGCAAGATGGTACCATAATAGTGACAGAT
AACTCGACAACAAATACTGAACCTTTTATAACACCAAACGAACAATTAAA
TCAAATTACACCCGTTGACGAAAGTGAGCCAATAGAAACTGTGGACGGGA
TACCCGTTATTTATAATCCGGAAAATGTAGACAGTTCGGCAGCTTCGAGT
ATTTATACAACGTCACTGGCATCCTCTATGGTATTCAAAAGAGACAGTGT
GAAAGATTACGCCATCAAACACGAAGAAGAAGTGGCGGATCATGTGAAGG
CGGAACAGGCGGCCGCCCATGATTTACAGCCAGTTGAGGACCCTAACATG
TTAGTGGAAGAGTGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_001186XLOC_001186Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00002241-exon-sc0000019-1491911889:323569..323737TCONS_00002241-exon-sc0000019-1491911889:323569..323737Clytia hemisphaericaexon
TCONS_00002241-exon-sc0000019-1510915933:323569..323737TCONS_00002241-exon-sc0000019-1510915933:323569..323737Clytia hemisphaericaexon
TCONS_00002241-exon-sc0000019-1575043694:323569..323737TCONS_00002241-exon-sc0000019-1575043694:323569..323737Clytia hemisphaericaexon
TCONS_00002241-exon-sc0000019-1491911889:324050..324282TCONS_00002241-exon-sc0000019-1491911889:324050..324282Clytia hemisphaericaexon
TCONS_00002241-exon-sc0000019-1510915933:324050..324282TCONS_00002241-exon-sc0000019-1510915933:324050..324282Clytia hemisphaericaexon
TCONS_00002241-exon-sc0000019-1575043694:324050..324282TCONS_00002241-exon-sc0000019-1575043694:324050..324282Clytia hemisphaericaexon
TCONS_00002241-exon-sc0000019-1491911889:324492..324699TCONS_00002241-exon-sc0000019-1491911889:324492..324699Clytia hemisphaericaexon
TCONS_00002241-exon-sc0000019-1510915933:324492..324699TCONS_00002241-exon-sc0000019-1510915933:324492..324699Clytia hemisphaericaexon
TCONS_00002241-exon-sc0000019-1575043694:324492..324699TCONS_00002241-exon-sc0000019-1575043694:324492..324699Clytia hemisphaericaexon
TCONS_00002241-exon-sc0000019-1491911889:324953..325096TCONS_00002241-exon-sc0000019-1491911889:324953..325096Clytia hemisphaericaexon
TCONS_00002241-exon-sc0000019-1510915933:324953..325096TCONS_00002241-exon-sc0000019-1510915933:324953..325096Clytia hemisphaericaexon
TCONS_00002241-exon-sc0000019-1575043694:324953..325096TCONS_00002241-exon-sc0000019-1575043694:324953..325096Clytia hemisphaericaexon
TCONS_00002241-exon-sc0000019-1491911889:325571..325679TCONS_00002241-exon-sc0000019-1491911889:325571..325679Clytia hemisphaericaexon
TCONS_00002241-exon-sc0000019-1510915933:325571..325679TCONS_00002241-exon-sc0000019-1510915933:325571..325679Clytia hemisphaericaexon
TCONS_00002241-exon-sc0000019-1575043694:325571..325679TCONS_00002241-exon-sc0000019-1575043694:325571..325679Clytia hemisphaericaexon
TCONS_00002241-exon-sc0000019-1491911889:326022..327825TCONS_00002241-exon-sc0000019-1491911889:326022..327825Clytia hemisphaericaexon
TCONS_00002241-exon-sc0000019-1510915933:326022..327825TCONS_00002241-exon-sc0000019-1510915933:326022..327825Clytia hemisphaericaexon
TCONS_00002241-exon-sc0000019-1575043694:326022..327825TCONS_00002241-exon-sc0000019-1575043694:326022..327825Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00002241-proteinTCONS_00002241-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000019supercontigsc0000019:323569..327825 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
9.48975 8.90866 3.28094 2.4598 48.7692 35.0234 31.0663 34.145 15.7589 21.0281 16.308 13.3762 11.9435 12.7524 10.7724 16.4886 21.5501 17.8462 10.0867 9.89557 13.3312 14.2032 19.7095 18.3751 17.5438 18.2174 12.9157 13.6773 16.3993 19.8158
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR013087Znf_C2H2_type
IPR013083Znf_RING/FYVE/PHD
Vocabulary: Molecular Function
TermDefinition
GO:0003676nucleic acid binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0003676 nucleic acid binding
Blast
BLAST of TCONS_00002241 vs. Swiss-Prot (Human)
Match: ZFP37 (Zinc finger protein 37 homolog OS=Homo sapiens GN=ZFP37 PE=2 SV=3)

HSP 1 Score: 158.688 bits (400), Expect = 2.328e-40
Identity = 84/207 (40.58%), Postives = 114/207 (55.07%), Query Frame = 1
Query:  679 PRSCDQCGRTFKYPSDLKKHLQIHTDIKKFQCEDCNRSFRRLHQLNVHRRIHTGEKPYVCNRCNAQFRHDSTLTMHIRTRHDHLKPFTCDGCSKKFGRMSHLRKHQHNVCGRTSIRTSIAQCKYCDAIFSKKSDLKSHFPVCEKKPERVEKDLNAQQVYQCETCGKVFSRVYDFKRHQLSHSDEKPYGCPQCGKTFKERSSLNKHVK 1299
            P  C++CG+ FKY S L KH++IHT  K F+C +C ++F +   L +H+R HT EKPY CN C   F H S+LT H+RT H    PF C+ C K F ++  L +HQ     R        +C  C   FS+KS L  H           ++    ++ Y+C  C K F+       HQ SH+ EKPY C +CGKTFK+ +SL KHVK
Sbjct:  432 PYECNECGKAFKYSSSLTKHMRIHTGEKPFECNECGKAFSKKSHLIIHQRTHTKEKPYKCNECGKAFGHSSSLTYHMRT-HTGESPFECNQCGKGFKQIEGLTQHQ-----RVHTGEKPYECNECGKAFSQKSHLIVH-----------QRTHTGEKPYECNECEKAFNAKSQLVIHQRSHTGEKPYECNECGKTFKQNASLTKHVK 621          

HSP 2 Score: 126.716 bits (317), Expect = 4.467e-30
Identity = 74/207 (35.75%), Postives = 97/207 (46.86%), Query Frame = 1
Query:  679 PRSCDQCGRTFKYPSDLKKHLQIHTDIKKFQCEDCNRSFRRLHQLNVHRRIHTGEKPYVCNRCNAQFRHDSTLTMHIRTRHDHLKPFTCDGCSKKFGRMSHLRKHQHNVCGRTSIRTSIAQCKYCDAIFSKKSDLKSHFPVCEKKPERVEKDLNAQQVYQCETCGKVFSRVYDFKRHQLSHSDEKPYGCPQCGKTFKERSSLNKHVK 1299
            P  C++CG  F   S L  H + HT  K ++C  C ++    H L  H RIHTGEKPY C  C   FRH S L  H+R+ H   KP+ C  C K F   S L +H      RT       +C  C   F   S L  H  +              ++ ++C  CGK FS+      HQ +H+ EKPY C +CGK F   SSL  H++
Sbjct:  320 PYECNECGIAFSQKSHLVVHQRTHTGEKPYECIQCGKAHGHKHALTDHLRIHTGEKPYECAECGKTFRHSSNLIQHVRS-HTGEKPYECKECGKSFRYNSSLTEHV-----RTHTGEIPYECNECGKAFKYSSSLTKHMRI-----------HTGEKPFECNECGKAFSKKSHLIIHQRTHTKEKPYKCNECGKAFGHSSSLTYHMR 509          

HSP 3 Score: 99.7525 bits (247), Expect = 1.828e-21
Identity = 65/194 (33.51%), Postives = 88/194 (45.36%), Query Frame = 1
Query:  733 KHLQIHTDIKKFQCEDCNRSFRRLHQLNVHRRIHTGEKPYVCNRCNAQFRHDSTLTMHIRTRHDHLKPFTCDGCSKKFGRMSHLRKHQHNVCGRTSIRTSIA--QCKYCDAIFSKKSDLKSHFPVCEKKPERVEKDLNAQQVYQCETCGKVFSRVYDFKRHQLSHSDEKPYGCPQCGKTFKERSSLNKHVKRMH 1308
            KH +    +K ++C  C +       L  H+R+HTGEKPY CN C   F   S L +H RT H   KP+ C  C K  G       H+H +     I T     +C  C   F   S+L  H            +    ++ Y+C+ CGK F        H  +H+ E PY C +CGK FK  SSL KH+ R+H
Sbjct:  282 KHEKPQACVKPYECNQCGKVLSHKQGLIDHQRVHTGEKPYECNECGIAFSQKSHLVVHQRT-HTGEKPYECIQCGKAHG-------HKHALTDHLRIHTGEKPYECAECGKTFRHSSNLIQHV-----------RSHTGEKPYECKECGKSFRYNSSLTEHVRTHTGEIPYECNECGKAFKYSSSLTKHM-RIH 455          

HSP 4 Score: 98.2117 bits (243), Expect = 5.276e-21
Identity = 51/145 (35.17%), Postives = 71/145 (48.97%), Query Frame = 1
Query:  658 RRRLSTDPRSCDQCGRTFKYPSDLKKHLQIHTDIKKFQCEDCNRSFRRLHQLNVHRRIHTGEKPYVCNRCNAQFRHDSTLTMHIRTRHDHLKPFTCDGCSKKFGRMSHLRKHQHNVCGRTSIRTSIAQCKYCDAIFSKKSDLKSH 1092
            R      P  C++CG+ F + S L  H++ HT    F+C  C + F+++  L  H+R+HTGEKPY CN C   F   S L +H RT H   KP+ C+ C K F   S L  HQ     R+       +C  C   F + + L  H
Sbjct:  481 RTHTKEKPYKCNECGKAFGHSSSLTYHMRTHTGESPFECNQCGKGFKQIEGLTQHQRVHTGEKPYECNECGKAFSQKSHLIVHQRT-HTGEKPYECNECEKAFNAKSQLVIHQ-----RSHTGEKPYECNECGKTFKQNASLTKH 619          

HSP 5 Score: 85.1149 bits (209), Expect = 6.480e-17
Identity = 63/205 (30.73%), Postives = 85/205 (41.46%), Query Frame = 1
Query:  685 SCDQCGRTFKYPSDLKKHLQIHTDIKKFQCEDCNRSFRRLHQLNVHRRIHTGEKPYVCNRCNAQFRHDSTLTMHIRTRHDHLKPFTCDGCSKKFGRMSHLRKHQHNVCGRTSIRTSIAQCKYCDAIFSKKSDLKSHFPVCEKKPERVEKDLNAQQVYQCETCGKVFSRVYDFKRHQLSHSDEKPYGCPQCGKTFKERSSLNKHVK 1299
            S D+C +T K    L  H   H    K Q  + +     L     H +     KPY CN+C     H   L  H R  H   KP+ C+ C   F + SHL  HQ     RT       +C  C      K  L  H  +              ++ Y+C  CGK F    +  +H  SH+ EKPY C +CGK+F+  SSL +HV+
Sbjct:  238 SSDKCNKTGKKHDKLCCHSSSHIKQDKIQTGEKHEKSPSLSSSTKHEKPQACVKPYECNQCGKVLSHKQGLIDHQRV-HTGEKPYECNECGIAFSQKSHLVVHQ-----RTHTGEKPYECIQCGKAHGHKHALTDHLRI-----------HTGEKPYECAECGKTFRHSSNLIQHVRSHTGEKPYECKECGKSFRYNSSLTEHVR 425          
The following BLAST results are available for this feature:
BLAST of TCONS_00002241 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
ZFP372.328e-4040.58Zinc finger protein 37 homolog OS=Homo sapiens GN=... [more]
back to top