Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00002240 (transcript) - C. hemisphaerica

Overview
NameTCONS_00002240
Unique NameTCONS_00002240
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2110

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00002240 ID=TCONS_00002240|Name=TCONS_00002240|organism=Clytia hemisphaerica|type=transcript|length=2110bp
ATCTTACCGGCGAAGAAGCCTAAACCAGACTGCCAGATCCACCCATCCAC
AAGCTCCACACTCTTGTTTTGGCTCTGCTTTGTGAAGATTATCCCCGAAG
ATCATAATTAATCTCATTGGTCTCTTaTAATTGTCCTCAGACTTCAAACA
AGATGTCAACTACCaacaaaaaatTCTTCTCACTTGAATGTGCAGTTCAG
AATTACCATTGGGGAAAGTTTGGAGAGCAATCAACAGTAGCATCATTGGG
AAGAATGcaaaagaatttcaattttgacgctGAGAAGCATTATGCAGAGC
TTTGGATGGGTGATCACCACAGAGGACCAAGCATCGTTCAAAACATGTCA
GAACCAACAACCCTCACTCAACTTCTTCAAAACAACCCATCTTTAGTCGG
TGAAAACATTATCAAGAGATTTGGCAAAGCtaatctaccatttttgttta
aagTGTTATCAGTTGAAACGGCTCTGTCCATCCAAGCTCATCCCAATAAA
GAACACGCGGAGATCTTGAATCGCACGAGACCAGACGTCTACCAGGATGA
TAACCATAAACCAGAGATTGCCATAGCTATCACGCCATTCGAAGCTTTAT
GTGGATTCCGACCAGCTTCGGAGATTTTGAGTTATTTTCACGAAGTCGAA
GAATTACTGTTTGTGGTTGGACAAAAAGCTGTCGATGAATTGATCAATGC
TGAAATGGCTACTGATAAAAAGGCGAAGGATGAAGCTGTACGCCGTGCTA
TTAAGGGCTGCCTCTCGCAACTCATGGCGTGTGATCCAAACACCATCAAA
GAGCAACTAGCAAAGCTGATCACGCGGTTGAACGAATGTCATAAGAAACA
CGAGGATACTAGTCTATATCTTGGTAGGCTCTTACTGAGAGTCCATTCAC
AATACCCAGGCGATGTTGGATGTTTTGTCATCtattttttgaattatata
CAATTGGAACCGTTTGAATCGATCTTCCTTGGACCTGATGTCCCACACGC
TTATATCTACGGAGATATTATTGAGTGTATGGCGAACAGTGACAATGTGG
TGCGTGCTGGCTTCACACCTAAATTCAAAGATGTCGATACTTTAATTGAG
ATGTTAGACTACAAACCACAGACGGTAGAAGAAACGAAATTNCAAATTCA
AAGATGTCGACACTTTAATTGAGATGTTAGACTACAAACCACAGACGGTA
GAAGAAACGAAATTCAAACCCACCTCTTGTTCAGATGATCCACATGTCTC
GATTTATAATCCACCCATTGATGATTTCTCTGTTAAAAAGATCCAGATTC
CAGCTGGAAACGCGTCCGAATATGACGTCCAATCCGTTAAGGGGCCAAGT
ATCCTACTCACATTATCCGGACATGCTGATGTTCAGTATGAAACCGAGGC
TGGTTGCCTAGCAACATCACGTGGATCAGTATTTTTCGTTGGCAATGgaa
cTAAAGCTCAATTGTGACGTTACTTCATTATTTTGCTCCAAATAGGGAAg
aaaagctctatctagtgttttgtTTAAGATATCTGTGCAACGAACTCGTA
TTTGTAACATTCTTAGGCCAGGGGCTGTTCTTGGGTCGTCTCTTTTACAG
GCCAGGTATAGTATTCTTTGCTATTATGTGATATGCTCcctcaaccaata
agatttcgTCATTTTGAGGGGAAGATTTCGTCATTTTGAGGGGAAAACAA
agacttttttgtttactgATTACACCAGAGATTACACACACCTGgatttt
agtgagttaaacctaGCAATGTTCTGCTTTCATCCAGAGTTTCTGTCGTC
GatggaaaattattttatagTGATAACTTTAAGAACCGGTATGTTCGGTT
CTATCAATCCACAAAATATACATTGTTCATTTTAATCACTATATAATTGA
aggaatatatatttttgtacgttattttcattttcaagatttgtatatat
tatttttatcGTTATTTGTAAGTTGGTAGCAACaagtaattatttaaaaa
aactgcttaagaattttgttgaagaaaatattttttaaatggattttttt
tgtgtgtaaaaaaagattatttcgaatttattcgcgctgtgatactcacg
gtaatgaAAG
Run BLAST on NCBI

protein sequence of TCONS_00002240-protein

>TCONS_00002240-protein ID=TCONS_00002240-protein|Name=TCONS_00002240-protein|organism=Clytia hemisphaerica|type=polypeptide|length=339bp
MSTTNKKFFSLECAVQNYHWGKFGEQSTVASLGRMQKNFNFDAEKHYAEL
WMGDHHRGPSIVQNMSEPTTLTQLLQNNPSLVGENIIKRFGKANLPFLFK
VLSVETALSIQAHPNKEHAEILNRTRPDVYQDDNHKPEIAIAITPFEALC
GFRPASEILSYFHEVEELLFVVGQKAVDELINAEMATDKKAKDEAVRRAI
KGCLSQLMACDPNTIKEQLAKLITRLNECHKKHEDTSLYLGRLLLRVHSQ
YPGDVGCFVIYFLNYIQLEPFESIFLGPDVPHAYIYGDIIECMANSDNVV
RAGFTPKFKDVDTLIEMLDYKPQTVEETKXQIQRCRHFN
Run BLAST on NCBI

transcript from alignment at sc0000019:286712..316441+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00002240 ID=TCONS_00002240|Name=TCONS_00002240|organism=Clytia hemisphaerica|type=transcript|length=29730bp|location=Sequence derived from alignment at sc0000019:286712..316441+ (Clytia hemisphaerica)
ATCTTACCGGCGAAGAAGCCTAAACCAGACTGCCAGATCCACCCATCCAC AAGCTCCACACTCTTGTTTTGGCTCTGCTTTGTGAAGATTATCCCCGAAG ATCATAATTAATCTCATTGGTCTCTTGTAAGTATAATTCCTCAGTTATAA ATATAAACGGTGAAAAAATTGACTATTACAggggatacacgtttttttat aagaacattttaaggcttcgtggactTTATTAAACCACTGCGGACGGCCC CTGCTGGGGGTCCCAGCGGCCGGTACTGGGGGGTCcgatcggtgctcact ggtcagggggatgtgagagtacacgcctgcaccgttgaGGGTCCTTCAAA TCTTCTCTTTAAGtgccgtcaaaagccggcaaaaattgccaataaTGACC TACCTCCTCACAATTGAGGCtgctacacccctttctcaccaggAAAAATT GCCAGTGAGATCAATTAAGGCCTCTAAAGCCCTCCACAGCCCCCCATAGC CCTTCGGATACCCTCTGCATTGCTctccctcaaagccagcaccctccatc aatCCTTTAAAAAGCTTGgaggaaaggcttgaaaattggcaaaaaattgg tcaaaattggaaaaaattaccTCCTTTATTTGGGTACCACCATTGACAGC CCCTGGAGGTCCCGGCCGGGGTTTCCAGGGAGTTTGatcggtgcccactg gtcagggtggatgtgagggtacacgcctgcaccggtgggggtccttcaaa gttcctcaaagcgtcgtcgtcaaaagccggcaaaaattggaaaattggag AAAATTAGGAAAAATGACCTCATCatttgggtaccaccgtggacggcccc tgggggtcccggctgGGGTTCCGGGAGGTTTGattggtgcccactggtca gggggatgtgagggCACATGCCTTCACCAGTGGGTGACgagggtgcttca aagttcctcaaatacaccttatcggaaattccacaaaaacaatcgcgcta aaatggatccgttgaaattgggaggtaaacataaatggGACCAATGGTGG CGTAAGTAGCGCTAAAAGTTCCCGCGTAAAACAAGAACTCATTTGCTTAT ATCTGGCTTGTTTAtatgttcctaaaaatacactgaatttgaaaaaaaac aaacaaaacaaagctttcaagatgctagcagaagctataagaaagagaaa aacaacaactttgGTGGTTTTTCAGTTGATTTGGAGGCTCTTTTGGCATC AATATTCTGggtgttttgtaaggctttttaCCTGAAAACCGCAATAGCAc gctttgtttacctcccaaaaagtgttgcgtagcaacaacgcaaggaggtg gaatttccgataaggtgtattgtctaccgtgaatagcacaggtcaaaatc ttATATTGACACTGTGCCGACGAATctagattctattcagcgcgcaatca acgaagacaaaagtaaccatgacgaccatccaagatcttggatgaagttc aaagttgatatttttattcccgTCGTTGAAAACATAacttaaaaaagtca tcaatgctttgtaaaaagagtcagtgatagagaatcataacataaagtct gtctattatttcgattcaatttttaaaagtgacatttccataattaaaag tttagtaattactgttatacattttggggatcatgtaaaagatttctttc aaaataaactcatttcaattacacttggaggtttctggggaattcgtaaa tagtaaactgcatactgatgtacagtctgctagacattaatatggtaata tttgctcttcatcctgcttcatctttgatttttttctacagtgattaaat tgacacatgcgcgataaaatttctattattggtcctcagaggttgatata ttatttaaaaacttaatctgatactcagggtacaaaGTGTCGTCAAAGGC CGGCAAAAAGTGCAATCGAATTATGCCTAAGTGGAGCTGCCTTCAGTTCC Tcgggttttctcaaaattttgttcgataaacttgacaaagtttgattaag tttgattagtttgattaagttcgaaTAATGTaattgaactaatcgaactg tcgaggtctctttaaaaaaagttcaattaagttcgatttcagtaatcaaa cttaatcgaactttgtattttgagaaatttgtgagtattcgattaaagtt cgacaaccGATTGAACTGCTCTTCTGTTTTATTTTGCACTCTGGCGATTG TAATTTTCGTGACCACATAGCAGACTCAAGTAAATACAAAGCTAGCAATC CACAAGGGACAGTAAAATTATGAATATACAAAATAGAAATGATTATTCTC TAGAGTGAAATAAACTCGTTATCTAGACAATAATGTCGTAAAATAAGTAG TTATAAATTATTATTGTCACAATGAAAAGTAtacaaaaggaaaataaaat tgaattgcAATGAATTAACAAAAGGACTTgagtttttcataaaaaacaga ATCTTAGCAAATGATAAATCGTCATTTATCAGGGTCCAAGCTATGATCTG GAATGTAGAGGGGCCAAAAATATACTGGAAGTTTTTTCTAATGGCGACAT CCATCTTCTAATTCTGTCGAAATCCCTGACGCCAAGACCACAAAAACCTT GGGCCTATTTGTTTCACTTACTATAAATGCTGTAGTTGCTATCTGCTAAA AGTGCTATGAAATtccatgaaaactttgaaaatgatatgATAGCAAATAT TGCAAGTTTTGTTGTCTGCCATCTTGATAATCCCTGGTTGtactttgaat tttaaaaagtaaCTTAGGATCCATTGTTTTATTATTAGCAGGGGAGCTGT GTGGCCACTATCCTGCCATTATGAAAGTAACTGCTATTTTGATTCAGATA TAGACCCGTGCGTGGAGCAAGCTACAGTTTCAGCTCTTCACTTCTTTAGT TTAATTGGTTCAAAATCGGCAATCAGGCTAATAAAATATCATCATGTCTG ATTTAAGATGCAATTTTTACTGtgaagaaattgcgattttgcTTTGCTTG CAGAAGGTTGaagtttttactatttttgctaATAGGGAGTTTGCAAGTTT ATTTGCAAGAAGTGCAACAGATTTGGACAGATAAAATTTAAATGAGAGCA CTTACAGTAAATGTAgcaaaaatagtgatgaaacaaataggcccCTTGTG TCATCGTTGTCCGACagactaaattttttttgattttctatttctttgaC AAAGATATTTCAAGTGACAAAATAGTTGGATTTTTATCCAATTCCATTCT TTGCTTCAAACGTCATCTTTACTTCCATTATTTATAGCATATTATGtaca ttttttatggaaatattcaaaatagaATGGAGATAATATCCCACTCTTTC CTTTAGGTTTGTAGGAATGTGTTATCATCTCCCTAATCATAAAAATGCTA GATTGATACCACCTTTGAAAAAAGAGGGGCAGCATTGAATCtagaaagga aaaaaatttacagtgggaaattcgaatttagcgctgtcgttgtattcaaa aaatattttattaaaaatctatTCCATACATCAAGGTGCTCTTCGAGTGT TTTAAACAATAGGAAAAGTAAACATAAAGAGAATTTCTCCtctttttttt gcagaaaaaattgcAGAAAGCTGCAACAAAATAGATCTGATCCATTTTGT TGCAGcctcttgcaattttttttgcaatatttttttgcgtttttattGTG TTGCAGAAAAGATTGCAGAGAATTTGACCTggctacactcattttttttt tcgagcgctTAAAGGCAATCTAGATTGCATTGCAAGTGCCTGAAAAAATT Gctcagtgtagccttagcttaagggtcaaaatgagcaaaaatgagaaaaa gcgAACTCCTAGAGGTGTAAGATTTATTAAGTCTCACCATATTTTGCCTT GAAATGGTCAGAATTTTCAGAAAAACGCACCGTAAGGGTTtatttttcgc ccaaatttactcGAATTTAGCTAagttttctctgcactgtaagggtctga tttCAGAGGCCTAATTTGGGCCTTCTATGAAGTGTTCAccaacatttttg ttttcaacaaatacaaaaattcaaattaaatcTCATGACTTTCatcttca aaatgttttttattcaatcttgtTTGCAAATTTTCAATTCTGTCATTATA TATATCCTGACtttatcaaatattttaaattgtttttatagaTAATTGTC CTCAGACTTCAAACAAGATGTCAACTACCaacaaaaaatgtaagaaaact GCCTTTTAATACCTCCCTTTGAGACTATTTCAAATCTAGTCATTGAATTG CTTTTCAAAAGCCATATTCCTTACCCACCTTATTAAAAGATAGAACACCC AAGAAGAGACTTTCAGTGAGGTATTTATGTAAAAGTACCAAAACTATACA GTCCCTCTATTAAAAAAGTCCATGTCCATTATTGCTTGACATTTTATTTA GCTTTGAGGAAATCTTTAATCTCTTCAAACTAAACTTGCAAATTTGGAAC TAATTTAGATTTCCTTTTGTATaaactaataaaataataaattttctatT AGAAAAATCAATCTGATTATTTCTCTCTTTCAGTCTTCTCACTTGAATGT GCAGTTCAGAATTACCATTGGGGAAAGTTTGGAGAGCAATCAACAGTAGC ATCATTGGGAAGAATGcaaaagaatttcaattttgacgctGAGAAGCATT ATGCAGAGGTATAGAATGTTTATTTTGATGACAACAATAAATCTGACAAA TAAAGGTAATACAGTCGGTCCCAGGGAATACAGTCGGTCCAACATTTCAT ACAATAACAGAAAAACCGACTTAAACTTAGTGGAGACCAGcctttaataa tatttttatgatatttcCAAGGGTATCTTGGCAAAATAACCTTACACCCT TCAATGCTCcatagaaaattttccccagctttgctagcttggcaaaaact ggtttaaaatcccaagggaccatataataggaaaatataaaataaaaacc cataaatACAACTTGTAAAGGTCGAAGGAAAAAAGATTAGTTCGCCACTA GACTACTGTTTTATTTGACAATGAAATGTCGTCTCTAAAATTGCATAATA CAGACCATAAAATTTCGAATGCTTCTGACGTTGATTNACTGTTTTATTTG ACAATGAAATATCGTCTCTAAAATTGCATAATACAGACCATAAAATTTCG AACGCTTCTGACGTTGATTATGTATGAATAAGAATTACAGCAAATGGTTA CATTTTTATGATCCAAGTAAATAAtttgaattgcttttgcaaTATCAGCA CGCAAAATTATTTACATGCGTAAAATTGTTATGTtaacttaaatgttttt tatgttttttttatcaGATAAAAAGATTTTGTCCTAAATTACCTAACAga acaaacattttttttctgtaGAAGATGGTCAGTGAGTTTTTTTTAATGCT CCACTTAGAACAATTATATCGAaggaaacaaaataaagaatcattttcag atttttcagtCTGCAATCATGAAATGAGATGGGAATAAGCTCTTTTGTAG AATTTTTAGTGTTTGATTTTCCCATTAAATTTCAATTTGTCTTCTAAACA TTGAACATCCGTGTGAAACGGTGTGTTGGATTTCTTTTCCCATTCGTTTC ACttgtttcacaaaaatgtaaatcacttttcaaaaaaaagcaaCATGTTT TTTAAAGGCTTCGATTTCgttgaaaaaggtttcaatgGTATGTATGGATG CTCTTGAAATTATAagcctttttgaaaaaagtattgTCAAATTTTATAAC GATAAGATAACGATAGacgaaaaaaatgagaaaatggtATCATCATATTA TTTGCCTACAAAGCATTTTTCAAACCAAACAAAAGAACTCCTCTTCCACA CAGCAAGAGCACAAATTTTTTCTGATATGTCATCATAAGTTAGGGTAGGG TGTTaacagtcatttttggggcaaagtcaCAAAATTCACTATGTAGTgtt tttttgtataaatttatccttaaaaagcattttgctacctaAAATTTGCT TAAAGTGGCTCATATAATTTAGTTAaactaatgaaaatattaagagtaat aataataataataattttgacATGTTTAAAGTCCTGAAAAGGCCAAAAAA TGCTaacttttctaatttttgcctgtagtgcaaATCGGGGGGAGGGGTCG GCCAATATTGGATatcgcagaatgcctcacaatattTGGCCACCTATtta ggttaaattttcacaaaaaaacgcTATATCTTGAATTTTCTACATCATAA AAAGAATGTCTTTAACCTTTATAAGGGAAATTGATATAAAACAGACATTA AGCATTTCGAACGACTTCCTTTCAAAcgtgtttttatgtttttaattagG TTGAAATATCATCCgctaaaaaaggaaaataagatACCATTTCTGccatt aaaaatgaagaaaaaagattttcttgttTGCTGGCTGATATGACACTTAT TTAGAGTTCAATTTTTGCCATTGGGATATTATAGTTTGAATTTTGTTGAG TAGTTTTTTAACAGTTTAAAAAATAACTTTAGGCCtaatttactacaaaa aataTTACGTAATAACGCAAGTAGTTAATTTTGCTACACTCATGAAAAAG CTGTCTTCGATGCAAACATAAGCTCTATGAATTTTTCAGAAACTATATTA CCTTAGTCACAAATAAACCCTGTAAAAACATTTTGTCAATTAttacaaaa gttaaaaatgattaaattttttttcctcatttttctgaaacttgaataga tatttttttcgatttcattgAATTCCAGCTTTGGATGGGTGATCACCACA GAGGACCAAGCATCGTTCAAAACATGTCAGAACCAACAACCCTCACTCAA CTTCTTCAAAACAACCCATCTTTAGTCGGTGAAAACATTATCAAGAGATT TGGCAAAGCtaatctaccatttttgtttaaagTGTTATCAGTTGAAACGG CTCTGTCCATCCAAGCTCATCCCAATAAAGAACACGCGGAGATCTTGAAT CGCACGAGACCAGACGTCTACCAGGATGATAACCATAAACCAGAGATTGC CATAGGTATGCTTTTTTATTTGcgagtttattttttttgctagTTCATTT TTTCAATACAGTACAGTACAATACAGctcaaatttgaaatgattttaCGT ATTTTACGTAACAAATATCATGGAAAAGGTTTTTTGACGtaaattttata cttttaaAAGGACAAGTTAAACCTTGTATGAAAGATTTCTTTGACATAAG TTTTAAGCAAATCCCTTTTAAAGTCAATCTCGCATGATCAGTTGACTTTT TCATATTATTCATATAGACTGGAGTGGTTTATAATCCgtgtaatgggctt ttccagaaaaaaattgaatatggagggtggaggatataacatttttaaaa gatttaccccccagacattgtgacttttgatccCCCGGACATttaaaatt accctcaaacagagcaagtttacccctgggacaaggaaaattttgtagat ttttcactacccctggacactatatcctccacccccatgtacgaacattt tctggaagagccaaaTATACTCCGGTTGTTTCCtctcatttttatattta cTCTTCGCCTGGAAAAAATAGAACATCTTAGAAAATCTTTTAGCCACCTC TGttcacgtttttataagaacaaactataagaacataaggattcgatcgc caaaatattaagaacaagctaggaatattttaaggctttgcagattCTAA AATACTCAATTTCTAAGGAAATCGcacaaaaatacccacaaaaaaatggt gaaaattagaacattttaagaatattttcggGCTTAAACTCAAGGGAAAT GTCAGGTAGAATTTTCTAGAAcattattataattattatatGACTTGTAT ATAAGTACAAAATGTAGTACAATGGTCTCCATTTTAatgcaaatttgttc gagttatggaaatttcgagttatagaaacgGGTTtataaaacattgaaaa aaggtataagaaaacttgttcgagttcaAGAGActttcgagttgtagagg ttcgatCAGGTCTCTTCTGACTTGAAACAGTTGCCTTGAATGTTATGTGC CAATGGACAcgtagaacaatagaaaatatAAACATTAATTTCGCCACATC ATTTGGAAAGATTGTCGAAGGTCGATCAGAGCATGCTGCGTCTCATTGAA AAAcataataaaccagccgaggctggaaggtcagccaatatagTTAGATT ATTAGTTGGATCGTTTGTAAAGAAGTTAAATAGCTGCGATGGAAGGAAGG ACTATATGCATAAAGAATCAAGCAACATTGGAAAACTTAATAGAGCTAGA AAATCACATTTTGCCTAAATGTTTCTCCAGGTTACTCAAAACTCCTAGTA GTAAGATTGAATAGAAAATTGACATTCCGTATCTAAAGCATTTAAATTCA ACATTTAACATTTTGaagataaagtaaaaatttagggacaaatcacaaaa ttttagatATGTCCTGTTATAAACTTATACAAAGATTCTATCAAAAATTC AATTGACAGGTCACATAGACTGACCATTTACTTTAACAAatagaaatagt ttttttttcaaataatagtTCATTATATTTATCACAGCAGCATCTTTGCA AtaatcaagcaaaacaaaacaatgcaaTACGAAATGGTTAATGGACAAGT ATAGATAACACTTATGATATCATTTTGATCACTTTCATTCACTGAGCGAA GAAACGTTatgaatttcaaaatcagcAACAAATAACTCTATTATGAACAA AATTTAAATGGTCGTCAGTCGGTTTTTCTTTGACGACAATTTGACAATTG AACAGCATACCGATTGATTGAAATGTTGTTGTTGATCGTATATAATCTGg tagagaaaacaaaaaataaaaataaaaggtgATGATATAAACTTTATAAG TTATTTGGTGAATGGAGACATTCAGCAAATGTGACAGTTTCTTATGTAAG AAAATAGAAAGCCTTCaggtttttaaatgttttgtaaGGTTTAATTAAAA TACCTGAATGTGCTTTGTAGCGACTTTGAGTTCGGAGTAACACAGTGACA ATTGTTTACGAGTCATGACAGCCAAATGACAATTGATCGTTGATTGATAT CTAAAATAACAGAGTAAAATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTTCTTTGTAGCTTATGC AACTGAGGTAAAATTACAATTGCtgctatctttttttaaacactaATAAA AAGCCAGTACACTGTTAAAAAAGGCAGGAAAGAAGTCTCACCTTGATGAT TGAAAAAGTGTACAAATTCTCATTTCATCGAAGCCAGCCAAATCtcgttt ttaattttcacaactGTAGTGGCAACTTATTGGGAAGCTAATACATTTAG CAGAAAAATCATGCTATCATGAATACAGAGATAGCGCNAAGAAGCTGATG CAATAATCCCAATGGCTGATGCAATCGCGCGCGTTTTTTATCCCGGTGTT TACTCGAAAAGAAATCCGTGCAAATATNNgtggaaaattttacctatttg aatgctcagcttaggctgaccaattataTAAAGTACGTTTCCCAGCTGTT GTCTAACGCATCTCCGAAACAATGTAAAATTATTTGCTCCCCGTTCTGTT TGCTAAGTTTTTTTCCTACCTCAGAATATAGTGCCCAAGCCCTGATTTTT TGGTAACTTTCATGGTTAGAAAGTGGACAAATCATAATAACACATAAAGC TTTCAtggcaaaaatatcaataacaagttaagaatattttaagactttgt tGACTCtgaaatatcaaatatcttCGCAAagtgcacaaaaatactcacaa atggttaaaataagaacattttaggcttaaaactcattaagataagaaca tccgaaaggaaaattttagattttcttataaaaaaaccgtgTACATACAA TATTTTGAGCTAACCAGtcattgaaaaataaatctCCTACACAAACTTTT AATTTTACTGTATATGCTTCttgaatttttcttgaaaattcgTCCTGATT CTGTGGGCTAAACTTAGTAAGTCTTAGCTTATAGCTTTATCAAAACTTAA TTCAATAAAAAGCTTGTTACACTATCAAAACATGTTTTAGTGTTTATAGA AAACTTTTGCTTAATTTATGTGAACgcgatttttataagaacgtcgaaAC TCTTTAAAGGCTTTTAAgggttttaagtctaaaaatgtttttaaaatgga attattttgaaaatgttttttcctaagcaattcttatatattttgttctt ataagtaCTATGTAAGTACAGTAAGTTCAAGATTAATTGCTCTGTCAAAA CAAAGCTAAAGATCTCAGTTTTGATAGACGGTCTCTTGTCACTCTTAATC TAATTGGCTGATTGACAACcgttatgacgtaatcttttacaCAACAAACt ttattaaacaaaaaatagAGAGAAGAGCGCTGTATAAATCATATCTCCTC TATTGAGACTCGCATCAAACTAGCAGTTGGTTTTGATCTAGCAACATCAC GAATACTGAGATCTTATACTTAGAATCTTGACTTAACAACAAATCGACAA CCAGTAATCATGTATACAAATTCTCCATTTGTAGCTATCACGCCATTCGA AGCTTTATGTGGATTCCGACCAGCTTCGGAGATTTTGAGTTATTTTCACG AAGTCGAAGAATTACTGTTTGTGGTTGGACAAAAAGCTGTCGATGAATTG ATCAATGCTGAAATGGCTACTGGTAAGTCTGAATAATTTGAAAGCTAGGG TTTGAAATAACGGTCAAACATCGGACACCCGTGCCAAATAGCTCCTTGTT CGACCTAGAAATCATAACCATCAAGCGATCGGACATATACTGCCCAACCC ATTTGAAATTGTTAATTCGAGCCATTAAAGCCATTTTAGCTTTAGAGGAA ACGGCGTGTTGGTTTGCCCGTACGTTGGTATTAGCCCTTTTTTGTTTGAC AGACTTTACAAATGACTCGCAATTTTAAAGCTGGTCCCAATGACAAATTT CTGCGCTAAATGTTAAAATCTTTTAGGACTGgcagtttgtttttgttgga tTAGTAACCTTGATAAACGTAGCTaaacaaagttttcaaatttgaatata aGAAAAATCTGACCTTAAAGTAATCATTTGTTCAGTAAAAAATGCAGAAT AGcaagaaaaaataaagataaaatcttACTTTAGTTAgtaaatcattttt atttaatGGCTTTTACGAAATGAAAACCGCAAAACAGTGCTTGAAAtaag tcaatttttgaaatacacGACATAGATCCAATTTTGTTGGATGGTCAGCA TAATTCAACTCCAACGGAGAAAAAGAGTCCAATAATTCAACAGTTTTTTG AGTCGTGCTGATTATCACGCACTAGAAACGTGATCTTTACTTTAATGTTT GCTAGAAAGTCAGAGTAGTTTTTTCAATTTGTCAATTTCAATTAAGCTAG AATCTGAGCAAACGTCTGTATATCTAGGTGGCTGTCCCCTTCAATACTCT TAGGATTTTCCAGAAATCTCCGCTTTGCTTTGCACtcccttttttttctt taggaGTAATTTTGATATACcttattacttcgaataaacgctccGGGTGT TTATTAAATTGTTTGGAAGAGTACAGTTATTGTTGTTTATCTAAATTTTC CTTCTTAGTTACTTCCTTACAGCTACTTGTTTCTCCTAGCTCATTAAGCC TCCTTAATTATTAAGCTTCTTTAATTAAAGGTTTGGCAAGATTTGAGTAC TACTTAGCTTCCTTAATTAAACCGCTAAATGGCATATAAATGCTCAGTGA ATTAAACAAGAGAAGCCCTGTTCTTTAATGCGACAACAAAATGAAACAAT TTCGGACATGCCGGATGGTCTTGATTTTTGATCAGCAGAGGTTTGGCAAG ATTTGGGTACTATTTAGCACGGGTCCCGGCGTGACGTTTCAAGTCAGGTG gttataattttgaaaacaaatgtcACCTACTGGTGATAATATCACTTTTT GTACCTTCTAAACACCATAAAACGCTCTTTAATTGGataaaaacaggttt tcgaCTTAAAGACTTAGTCGGCCGCATCATTCCATTTGACGGAACCTATA TTTAGAAATGCTCTGGCTTTGCTCCTTTGCCGTTGAAGGGAATCTCGTTG TAGATTCTCTCCAAGGGCCTTTATTTAATTAACTTGTaccaaattttatt attttgatttaaaggttttacttttacataagtgttcctgtttcatatca gacacatatttcataccaggacagtgtttgcctattgttatattgtgctg atataagcaaaaaaactgtttttcttttcccttttccgactaatatttct ccACGTCTGTGCCAATTCAATGTGAGAAAGCTTCTGAAttaaaaattgat gagtaagcaaacgatatcactcttattcaaaaacaaaacctttaagcatA CGCGATATTAGAGTTTGTAAATTGCTTCACTGTGGAGACTTTGTTTAGAA GTTATTAAAGAACTTACGGATAAAAACAAACTCGTAATAAGGTGGTTTGC AAGGAAATTACCCTGCCGCATATGCGTCGTCAATTATGAAAGTCCCTGTG ACCAAAGATAAGTTTAAGTTTCCTTGAATATTGATGAGTTATGCTTACGG TTATGGTTAATCATAAGATTAACTTCCTATTCGGTTCGTctaattctaaa aaaattagGGAATTACACCAATGCTGAAGCTAGCAACTTTAACATCATGA TTTTGTTCATTAATGAGTATTTCCTTTGACTCATATTACCATTTATTAAC CTATGTGCtttctaaagaaaataaaatctttgaaatgaaTTTGTTAGACT TTGTAAAGTATTCATGAGTCAGTCTATATTTGAGGCACtgtataagtttt ttttttgcattgttcAACGAATCAAATTAGAGTTTCACTATCATTCATCA ATATGCCTTGGAAAATATTTAGGGCTTTCAGACAGTCTTTCGGCTGTTTT TATTTCAGAATCCACGGTCTGTCGGCTCGGCTAATTaagaactgaacgga acatcgAAAGGAGAGTGGATTCGaatagacgatcctatcgtctagacaca agatcactaaaagaGGGAATACAATTTTTAGGaagcgggataaatttgaa aatggtggTTAGCCCGGAGCGGAGTAAGCAGTGATGTGAGagaggtgttt acagtgttaACGTTTGTTGCAAACTCTACCGTCGCTTTTTTCCCCCATAA ACCGCCCTGACTCTGCGTATATATaatttcccgcgtttactgaccctcta aacggatgatagcatcgtctaggaCTCGAATCGATTCTTTTACTCACATA TGCTAACataggaaaagaaaaaagagaaagaaattgGATATGACATACAG AAGGATTATTTGAAAGGTTGCATAAGTTTAAAAGTAACAACTTAATCCAC AACTGTTTTATACGAGGGCTTTATGTATGTAGATTTAGAGATTACATAAT TCGGATCTcggattttgtttattttagcaACAAATAAATGTTGTGTCAAT CTACAGTGTCATACGGTTAAAATTTCCTCATATTTTCCTGGCTTTCTAGT TTTGATGTCTTAGAACTGGAAAAACCTGTTTTACAAGGTCTGAGTGTTGT GTAAAGTTTAATTGGGCATAAATGAAGTGCCGATATTTGATTTAAGCAAT GCGAAGTCTCACATTTCAAGCTAGAGGCATTTTGCACTCTACAGTATAAA GCTTATCAAATTTCATATTCCATCAGCTTGTTTATAAGATATCCGAGATG GCGGTATGCAGAGCTGGGTGACCtcttcgaaaactttttacgcCTCTTAT ACGCGATCTGTCAAAGTCATTAATTAAGTTGACTGATAGACCTGGTCTTA AATTGCAAGTTTACTTCAAGGgactaaatctttttttgaattacagaaag attcgaaatatAGAAGTTCCAGTTTTCTATAAGGTAAACTGTTTTTTCGA ATCCagattattatccatatagcggtcattaagtaagccattaaagattc gaacggcgggcggtattgagatattctatgactcaaatagtcatacccgc gctgagaaaactaagacgtcgcgcttcagagggctgaaacataattaacc gccctggttatagggcgataacgtcatttgcggcccgctcggaactttat tgaagtcgttgcattgaagcgaaaagactaaactgacgtcagaaaaaaac actttttggtcatttgcggcccgctcggaactttattgaagtcgttgcat tgaagcgaaaagactaaactgacgtcagaaaaaaacactttttggtcatt tgcggcccgctcgcaagggtactcaaaacttgttAAAGCCATTGCAAACC ATTgcttcgcgtcgggcccaaatgacactctcgggctaataatcaaactg cgcgggcagaaaataacaacaacgacctcaaactgaacgctattgttata ttaaatTTTATAGAACGGATATTTTCGAATATTCAAAACTCAAATTACCA TTTTCAGTCGTGACCTTGCAAAAACTAATTGTTCTTGATGACAGTATTGA TTACTTGATTACTTGATATCGATTAGTATCTGCCTCGGTGATGAAAGTAA AGATGATTGATTGATGTACACGTGATGGCATTAATATAGTacttttttga tcaaattattGGAATCAGTTCTATTCCAGTGTGGTTTGCCTCACTGATGG AAGGCCAATCAGTGAAGATGATTGGTTTATATGCCTTTGGTATTAATATA GTGATTTTTGATCAAGTTAGAATCAATTCTTTTCATGTGTGGTCTACAAC ATGTTTACGTAATGACTATGTAATTGTAAGGCTGGCTGAACGATTATGTA ACTGTATGATTGAAACTATTTTACAGGCAAAGCTATTAAAATAATCTGTA TTAACCTCTTAAACCAAGCTTATAAATTCAGTAAGTTTTGCATCTAAAGT CAAGGATGAACTTTCTTTACATACCTTTTGATCCTTTGCTTTGATTTTTG AGCATTATTAAGCAGGCGCCTTATACCATTCCTCAGCTTCTTGGTTAGAC CCGGCCTCTAAAGGTCGAATCTACTAACCACTGCACCATAACCGTTGCGC TGATCTATGACCATTCAGTGATATCTATTAAAACAGTTTCGCTGCTCCTT TGAACTGACTTAGTTTTACTAGACTGAAACTATGATCTATGTCAAGTATC ATTCTCATGTTACATGAGCACACTGTAGGGTAGTTAGAAAGATTCCGGCT AATTTGATCATGTGTATAttgatatattttgattttgaagattttttctt tggCTGGATTCCAAATTGAGTCAAATGGTCTTATAGAACTTATAACTTAT TAACTAACTGATGCAtgattaccgagtttatgtatgtgtgttttccagcg acggagacggtaaggttctaatttgactagatcctgaccagctgaggacg acggtaaatcagcacttttaccgtcctcgattttgcNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNttttaccgtcctcgat tttgcggggcagaattgcgggtttttccaaatcgcttcagtcactctacc gtcctcaaaagtgcaaatacataaactcggtattgtcGTCCATACGGGCG GCATGAAATTTAAAGTTCTAAACAATAAATcaaagtctctttcttttaat tcGAACAGGCTCTGATATCATCGAGCACTCTCGGCAGATAGAAGAAAATA GACTTGTATAACTTATTAACTAATAAAAAGATTATGCACTACTTACTCCA AATATCTTTTAACAGATAAAAAGGCGAAGGATGAAGCTGTACGCCGTGCT ATTAAGGGCTGCCTCTCGCAACTCATGGCGTGTGATCCAAACACCATCAA AGAGCAACTAGCAAAGCTGATCACGCGGTTGAACGAATGTCATAAGAAAC ACGAGGATACTAGTCTATATCTTGGTAGGCTCTTACTGAGAGTCCATTCA CAATACCCAGGCGATGTTGGATGTTTTGTCATCtattttttgaattatat aCAATTGGAACCGTTTGAATCGATCTTCCTTGGACCTGATGTCCCACACG CTTATATCTACGGAGGTATGTATGTTTACCAAGTAATGAAAACTTATGGG GTGTgatcctacacgttttttttataagaacatccaaaatttttgaagcc ttgggatgttcttaactttttgaattttaagcctaaagttcttattttta ctgttttttgagcattttacccattttcctaaaaaatcggaTGTTTTCGA GTCCGAGAagccttacaatgttcttaacttgttcttaacattttggccat cgaagccctatgtttttatatagtttgttcttataaaaaaaaacatgtac tttaAAAGTTCCGGAAAAGGTTGTACTGTATCCAGAAAGTCTGATTAACG TTCAATGTTCTTCTGGCTCCAATAGATTGTTGTTTCAGCAATGCAATAAG ATACAAACCagatattctggtctgtaaaattcaTAGTAGAGATGCGTGGT CGaaccaaaattttacaaatcatCTCCAACTATCCATTGATGTACCTTTG gtcgaaatttcaaatcatAGCACTTGTCATtcaatattgatatttttaaa ggttttgctttttaataacatggtttcagcccacttttcaggtgccccca ttgagcatggtgcccccagcaatttaggttcccttgagaaattgctttga gttaggtacccccattcagccaaaaaattttttttggaattgacactttt tgttcttttgtcattcgtaaaatcttaatgatttttggggtggtttagta aaaaaattcaataatttgaaatattttgaaatattcgaNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNtcctccatcaagacagctaggtacccttaatg aataggtaaccccaaagaattgcaaggcattagcccccctctactaacct ggcctaNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNaaggttttgcttttaaataagagtggtaTTGCtttcttactcat caattttaattcataagctttttcacattggattgacacggatgtggagc aagattggtcagaaagaggaaaagaaaaacattttgttgcttatatcagc ataatataacaataggcaaactgtcctggtatgaaatatgtgtctgatat gtaACGGGAACACTTACAtagaaataaaacctttaaggggACCTTGAATT TTTCGCCTCACAATTCAGCAACATCTTGTTTTCTCCTCCCCAGATATTAT TGAGTGTATGGCGAACAGTGACAATGTGGTGCGTGCTGGCTTCACACCTA AATTCAAAGATGTCGATACTTTAATTGAGATGTTAGACTACAAACCACAG ACGGTAGAAGAAACGAAATTNCAAATTCAAAGATGTCGACACTTTAATTG AGATGTTAGACTACAAACCACAGACGGTAGAAGAAACGAAATTCAAACCC ACCTCTTGTTCAGATGATCCACATGTCTCGATTTATAATCCACCCATTGA TGATTTCTCTGTTAAAAAGATCCAGGTAAGTgagacaaaatttcttccac tgacctttatttatccctggaccaagctatatccgccatctttgatcgga gtttttttgtaatggtacccgagaagaagccattgcaatgttaaaaatta acatctaaCGGCGCtatatcatcaaaagtattcaaggaaaagtagatcta gcgctctcgatgcttTTTCACCGCCATTAGGGtacagatttcaaaaaaaa ctccaatcaaagattatTGGTTGGCCGGGATTGATTAACCACGCTTAATC GAATCTGTTTGAGATAAAATGCCCGTGTGCcaagattttgtttttgagta tttttgtttttgttttactgACCTGAATTTGACTTTGTAATTTGATTTCT ATATTTCATATCATTTAGATTCCAGCTGGAAACGCGTCCGAATATGACGT CCAATCCGTTAAGGGGCCAAGTATCCTACTCACATTATCCGGACATGCTG ATGTTCAGTATGAAACCGAGGCTGGTTGCCTAGCAACATCACGTGGATCA GTATTTTTCGTTGGCAATGGTGAGAAAGTGAAATTAACAAATATTTCTTC GAATgaagaattattgatttttcaagcttATTGTGATTTGGTATGAGATG ATTTTGACTTGATCGTTTTATGATCGAAGATTGGACGGATTTTTATCGAT CCTATGTTGTACAGGTAAAGACTGTATCAAGATTCGTCCTAAATTATTGT TGGTCTCATTCCGCTCGGGGaatcttaaaattcaaaatcatttttggtgA TGCTAAACAATTTATAAAGTGGACTCTCTGTGGAGAAGGCTATGTTTACA CTTTGTTGTTGACTTTAGGCTAAATATACATGTGTTTGTTTGAGGGAAGT CAACGAACCATAGATTTCTTATATAAATAGATAAAGAGCTTTTTTATCTA TTCCAAGCCAAGgtaaagcaaaataatgcgccatctttgctgatAGTAGA CCACAGTATAAACCTTGTTTTTCacttttgaagtattttgacactgcaat gacttcaaaatttcaaggaacTAAAGCTCAATTGTGACGTTACTTCATTA TTTTGCTCCAAATAGGGAAgaaaagctctatctagtgttttgtTTAAGAT ATCTGTGCAACGAACTCGTATTTGTAACATTCTTAGGCCAGGGGCTGTTC TTGGGTCGTCTCTTTTACAGGCCAGGTATAGTATTCTTTGCTATTATGTG ATATGCTCcctcaaccaataagatttcgTCATTTTGAGGGGAAGATTTCG TCATTTTGAGGGGAAAACAAagacttttttgtttactgATTACACCAGAG ATTACACACACCTGgattttagtgagttaaacctaGCAATGTTCTGCTTT CATCCAGAGTTTCTGTCGTCGatggaaaattattttatagTGATAACTTT AAGAACCGGTATGTTCGGTTCTATCAATCCACAAAATATACATTGTTCAT TTTAATCACTATATAATTGAaggaatatatatttttgtacgttattttca ttttcaagatttgtatatattatttttatcGTTATTTGTAAGTTGGTAGC AACaagtaattatttaaaaaaactgcttaagaattttgttgaagaaaata ttttttaaatggattttttttgtgtgtaaaaaaagattatttcgaattta ttcgcgctgtgatactcacggtaatgaAAG

Coding sequence (CDS) from alignment at sc0000019:286712..316441+

>TCONS_00002240 ID=TCONS_00002240|Name=TCONS_00002240|organism=Clytia hemisphaerica|type=CDS|length=6120bp|location=Sequence derived from alignment at sc0000019:286712..316441+ (Clytia hemisphaerica)
ATGTCAACTACCaacaaaaaatTCTTCTCACTTGAATGTGCAGTTCAGAA
TTACCATTGGGGAAAGTTTGGAGAGCAATCAACAGTAGCATCATTGGGAA
GAATGcaaaagaatttcaattttgacgctGAGAAGCATTATGCAGAGCTT
TGGATGGGTGATCACCACAGAGGACCAAGCATCGTTCAAAACATGTCAGA
ACCAACAACCCTCACTCAACTTCTTCAAAACAACCCATCTTTAGTCGGTG
AAAACATTATCAAGAGATTTGGCAAAGCtaatctaccatttttgtttaaa
gTGTTATCAGTTGAAACGGCTCTGTCCATCCAAGCTCATCCCAATAAAGA
ACACGCGGAGATCTTGAATCGCACGAGACCAGACGTCTACCAGGATGATA
ACCATAAACCAGAGATTGCCATAGCTATCACGCCATTCGAAGCTTTATGT
GGATTCCGACCAGCTTCGGAGATTTTGAGTTATTTTCACGAAGTCGAAGA
ATTACTGTTTGTGGTTGGACAAAAAGCTGTCGATGAATTGATCAATGCTG
AAATGGCTACTGATAAAAAGGCGAAGGATGAAGCTGTACGCCGTGCTATT
AAGGGCTGCCTCTCGCAACTCATGGCGTGTGATCCAAACACCATCAAAGA
GCAACTAGCAAAGCTGATCACGCGGTTGAACGAATGTCATAAGAAACACG
AGGATACTAGTCTATATCTTGGTAGGCTCTTACTGAGAGTCCATTCACAA
TACCCAGGCGATGTTGGATGTTTTGTCATCtattttttgaattatataCA
ATTGGAACCGTTTGAATCGATCTTCCTTGGACCTGATGTCCCACACGCTT
ATATCTACGGAGATATTATTGAGTGTATGGCGAACAGTGACAATGTGGTG
CGTGCTGGCTTCACACCTAAATTCAAAGATGTCGATACTTTAATTGAGAT
GTTAGACTACAAACCACAGACGGTAGAAGAAACGAAATTNCAAATTCAAA
GATGTCGACACTTTAATTGAATGTCAACTACCaacaaaaaatTCTTCTCA
CTTGAATGTGCAGTTCAGAATTACCATTGGGGAAAGTTTGGAGAGCAATC
AACAGTAGCATCATTGGGAAGAATGcaaaagaatttcaattttgacgctG
AGAAGCATTATGCAGAGCTTTGGATGGGTGATCACCACAGAGGACCAAGC
ATCGTTCAAAACATGTCAGAACCAACAACCCTCACTCAACTTCTTCAAAA
CAACCCATCTTTAGTCGGTGAAAACATTATCAAGAGATTTGGCAAAGCta
atctaccatttttgtttaaagTGTTATCAGTTGAAACGGCTCTGTCCATC
CAAGCTCATCCCAATAAAGAACACGCGGAGATCTTGAATCGCACGAGACC
AGACGTCTACCAGGATGATAACCATAAACCAGAGATTGCCATAGCTATCA
CGCCATTCGAAGCTTTATGTGGATTCCGACCAGCTTCGGAGATTTTGAGT
TATTTTCACGAAGTCGAAGAATTACTGTTTGTGGTTGGACAAAAAGCTGT
CGATGAATTGATCAATGCTGAAATGGCTACTGATAAAAAGGCGAAGGATG
AAGCTGTACGCCGTGCTATTAAGGGCTGCCTCTCGCAACTCATGGCGTGT
GATCCAAACACCATCAAAGAGCAACTAGCAAAGCTGATCACGCGGTTGAA
CGAATGTCATAAGAAACACGAGGATACTAGTCTATATCTTGGTAGGCTCT
TACTGAGAGTCCATTCACAATACCCAGGCGATGTTGGATGTTTTGTCATC
tattttttgaattatataCAATTGGAACCGTTTGAATCGATCTTCCTTGG
ACCTGATGTCCCACACGCTTATATCTACGGAGATATTATTGAGTGTATGG
CGAACAGTGACAATGTGGTGCGTGCTGGCTTCACACCTAAATTCAAAGAT
GTCGATACTTTAATTGAGATGTTAGACTACAAACCACAGACGGTAGAAGA
AACGAAATTNCAAATTCAAAGATGTCGACACTTTAATTGAATGTCAACTA
CCaacaaaaaatTCTTCTCACTTGAATGTGCAGTTCAGAATTACCATTGG
GGAAAGTTTGGAGAGCAATCAACAGTAGCATCATTGGGAAGAATGcaaaa
gaatttcaattttgacgctGAGAAGCATTATGCAGAGCTTTGGATGGGTG
ATCACCACAGAGGACCAAGCATCGTTCAAAACATGTCAGAACCAACAACC
CTCACTCAACTTCTTCAAAACAACCCATCTTTAGTCGGTGAAAACATTAT
CAAGAGATTTGGCAAAGCtaatctaccatttttgtttaaagTGTTATCAG
TTGAAACGGCTCTGTCCATCCAAGCTCATCCCAATAAAGAACACGCGGAG
ATCTTGAATCGCACGAGACCAGACGTCTACCAGGATGATAACCATAAACC
AGAGATTGCCATAGCTATCACGCCATTCGAAGCTTTATGTGGATTCCGAC
CAGCTTCGGAGATTTTGAGTTATTTTCACGAAGTCGAAGAATTACTGTTT
GTGGTTGGACAAAAAGCTGTCGATGAATTGATCAATGCTGAAATGGCTAC
TGATAAAAAGGCGAAGGATGAAGCTGTACGCCGTGCTATTAAGGGCTGCC
TCTCGCAACTCATGGCGTGTGATCCAAACACCATCAAAGAGCAACTAGCA
AAGCTGATCACGCGGTTGAACGAATGTCATAAGAAACACGAGGATACTAG
TCTATATCTTGGTAGGCTCTTACTGAGAGTCCATTCACAATACCCAGGCG
ATGTTGGATGTTTTGTCATCtattttttgaattatataCAATTGGAACCG
TTTGAATCGATCTTCCTTGGACCTGATGTCCCACACGCTTATATCTACGG
AGATATTATTGAGTGTATGGCGAACAGTGACAATGTGGTGCGTGCTGGCT
TCACACCTAAATTCAAAGATGTCGATACTTTAATTGAGATGTTAGACTAC
AAACCACAGACGGTAGAAGAAACGAAATTNCAAATTCAAAGATGTCGACA
CTTTAATTGAATGTCAACTACCaacaaaaaatTCTTCTCACTTGAATGTG
CAGTTCAGAATTACCATTGGGGAAAGTTTGGAGAGCAATCAACAGTAGCA
TCATTGGGAAGAATGcaaaagaatttcaattttgacgctGAGAAGCATTA
TGCAGAGCTTTGGATGGGTGATCACCACAGAGGACCAAGCATCGTTCAAA
ACATGTCAGAACCAACAACCCTCACTCAACTTCTTCAAAACAACCCATCT
TTAGTCGGTGAAAACATTATCAAGAGATTTGGCAAAGCtaatctaccatt
tttgtttaaagTGTTATCAGTTGAAACGGCTCTGTCCATCCAAGCTCATC
CCAATAAAGAACACGCGGAGATCTTGAATCGCACGAGACCAGACGTCTAC
CAGGATGATAACCATAAACCAGAGATTGCCATAGCTATCACGCCATTCGA
AGCTTTATGTGGATTCCGACCAGCTTCGGAGATTTTGAGTTATTTTCACG
AAGTCGAAGAATTACTGTTTGTGGTTGGACAAAAAGCTGTCGATGAATTG
ATCAATGCTGAAATGGCTACTGATAAAAAGGCGAAGGATGAAGCTGTACG
CCGTGCTATTAAGGGCTGCCTCTCGCAACTCATGGCGTGTGATCCAAACA
CCATCAAAGAGCAACTAGCAAAGCTGATCACGCGGTTGAACGAATGTCAT
AAGAAACACGAGGATACTAGTCTATATCTTGGTAGGCTCTTACTGAGAGT
CCATTCACAATACCCAGGCGATGTTGGATGTTTTGTCATCtattttttga
attatataCAATTGGAACCGTTTGAATCGATCTTCCTTGGACCTGATGTC
CCACACGCTTATATCTACGGAGATATTATTGAGTGTATGGCGAACAGTGA
CAATGTGGTGCGTGCTGGCTTCACACCTAAATTCAAAGATGTCGATACTT
TAATTGAGATGTTAGACTACAAACCACAGACGGTAGAAGAAACGAAATTN
CAAATTCAAAGATGTCGACACTTTAATTGAATGTCAACTACCaacaaaaa
atTCTTCTCACTTGAATGTGCAGTTCAGAATTACCATTGGGGAAAGTTTG
GAGAGCAATCAACAGTAGCATCATTGGGAAGAATGcaaaagaatttcaat
tttgacgctGAGAAGCATTATGCAGAGCTTTGGATGGGTGATCACCACAG
AGGACCAAGCATCGTTCAAAACATGTCAGAACCAACAACCCTCACTCAAC
TTCTTCAAAACAACCCATCTTTAGTCGGTGAAAACATTATCAAGAGATTT
GGCAAAGCtaatctaccatttttgtttaaagTGTTATCAGTTGAAACGGC
TCTGTCCATCCAAGCTCATCCCAATAAAGAACACGCGGAGATCTTGAATC
GCACGAGACCAGACGTCTACCAGGATGATAACCATAAACCAGAGATTGCC
ATAGCTATCACGCCATTCGAAGCTTTATGTGGATTCCGACCAGCTTCGGA
GATTTTGAGTTATTTTCACGAAGTCGAAGAATTACTGTTTGTGGTTGGAC
AAAAAGCTGTCGATGAATTGATCAATGCTGAAATGGCTACTGATAAAAAG
GCGAAGGATGAAGCTGTACGCCGTGCTATTAAGGGCTGCCTCTCGCAACT
CATGGCGTGTGATCCAAACACCATCAAAGAGCAACTAGCAAAGCTGATCA
CGCGGTTGAACGAATGTCATAAGAAACACGAGGATACTAGTCTATATCTT
GGTAGGCTCTTACTGAGAGTCCATTCACAATACCCAGGCGATGTTGGATG
TTTTGTCATCtattttttgaattatataCAATTGGAACCGTTTGAATCGA
TCTTCCTTGGACCTGATGTCCCACACGCTTATATCTACGGAGATATTATT
GAGTGTATGGCGAACAGTGACAATGTGGTGCGTGCTGGCTTCACACCTAA
ATTCAAAGATGTCGATACTTTAATTGAGATGTTAGACTACAAACCACAGA
CGGTAGAAGAAACGAAATTNCAAATTCAAAGATGTCGACACTTTAATTGA
ATGTCAACTACCaacaaaaaatTCTTCTCACTTGAATGTGCAGTTCAGAA
TTACCATTGGGGAAAGTTTGGAGAGCAATCAACAGTAGCATCATTGGGAA
GAATGcaaaagaatttcaattttgacgctGAGAAGCATTATGCAGAGCTT
TGGATGGGTGATCACCACAGAGGACCAAGCATCGTTCAAAACATGTCAGA
ACCAACAACCCTCACTCAACTTCTTCAAAACAACCCATCTTTAGTCGGTG
AAAACATTATCAAGAGATTTGGCAAAGCtaatctaccatttttgtttaaa
gTGTTATCAGTTGAAACGGCTCTGTCCATCCAAGCTCATCCCAATAAAGA
ACACGCGGAGATCTTGAATCGCACGAGACCAGACGTCTACCAGGATGATA
ACCATAAACCAGAGATTGCCATAGCTATCACGCCATTCGAAGCTTTATGT
GGATTCCGACCAGCTTCGGAGATTTTGAGTTATTTTCACGAAGTCGAAGA
ATTACTGTTTGTGGTTGGACAAAAAGCTGTCGATGAATTGATCAATGCTG
AAATGGCTACTGATAAAAAGGCGAAGGATGAAGCTGTACGCCGTGCTATT
AAGGGCTGCCTCTCGCAACTCATGGCGTGTGATCCAAACACCATCAAAGA
GCAACTAGCAAAGCTGATCACGCGGTTGAACGAATGTCATAAGAAACACG
AGGATACTAGTCTATATCTTGGTAGGCTCTTACTGAGAGTCCATTCACAA
TACCCAGGCGATGTTGGATGTTTTGTCATCtattttttgaattatataCA
ATTGGAACCGTTTGAATCGATCTTCCTTGGACCTGATGTCCCACACGCTT
ATATCTACGGAGATATTATTGAGTGTATGGCGAACAGTGACAATGTGGTG
CGTGCTGGCTTCACACCTAAATTCAAAGATGTCGATACTTTAATTGAGAT
GTTAGACTACAAACCACAGACGGTAGAAGAAACGAAATTNCAAATTCAAA
GATGTCGACACTTTAATTGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_001185XLOC_001185Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00002240-proteinTCONS_00002240-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00002240-exon-sc0000019-1491911889:286712..286837TCONS_00002240-exon-sc0000019-1491911889:286712..286837Clytia hemisphaericaexon
TCONS_00002240-exon-sc0000019-1510915933:286712..286837TCONS_00002240-exon-sc0000019-1510915933:286712..286837Clytia hemisphaericaexon
TCONS_00002240-exon-sc0000019-1575043694:286712..286837TCONS_00002240-exon-sc0000019-1575043694:286712..286837Clytia hemisphaericaexon
TCONS_00002240-exon-sc0000019-1491911889:290953..291000TCONS_00002240-exon-sc0000019-1491911889:290953..291000Clytia hemisphaericaexon
TCONS_00002240-exon-sc0000019-1510915933:290953..291000TCONS_00002240-exon-sc0000019-1510915933:290953..291000Clytia hemisphaericaexon
TCONS_00002240-exon-sc0000019-1575043694:290953..291000TCONS_00002240-exon-sc0000019-1575043694:290953..291000Clytia hemisphaericaexon
TCONS_00002240-exon-sc0000019-1491911889:291345..291469TCONS_00002240-exon-sc0000019-1491911889:291345..291469Clytia hemisphaericaexon
TCONS_00002240-exon-sc0000019-1510915933:291345..291469TCONS_00002240-exon-sc0000019-1510915933:291345..291469Clytia hemisphaericaexon
TCONS_00002240-exon-sc0000019-1575043694:291345..291469TCONS_00002240-exon-sc0000019-1575043694:291345..291469Clytia hemisphaericaexon
TCONS_00002240-exon-sc0000019-1491911889:293590..293866TCONS_00002240-exon-sc0000019-1491911889:293590..293866Clytia hemisphaericaexon
TCONS_00002240-exon-sc0000019-1510915933:293590..293866TCONS_00002240-exon-sc0000019-1510915933:293590..293866Clytia hemisphaericaexon
TCONS_00002240-exon-sc0000019-1575043694:293590..293866TCONS_00002240-exon-sc0000019-1575043694:293590..293866Clytia hemisphaericaexon
TCONS_00002240-exon-sc0000019-1491911889:307596..307733TCONS_00002240-exon-sc0000019-1491911889:307596..307733Clytia hemisphaericaexon
TCONS_00002240-exon-sc0000019-1510915933:307596..307733TCONS_00002240-exon-sc0000019-1510915933:307596..307733Clytia hemisphaericaexon
TCONS_00002240-exon-sc0000019-1575043694:307596..307733TCONS_00002240-exon-sc0000019-1575043694:307596..307733Clytia hemisphaericaexon
TCONS_00002240-exon-sc0000019-1491911889:312877..313176TCONS_00002240-exon-sc0000019-1491911889:312877..313176Clytia hemisphaericaexon
TCONS_00002240-exon-sc0000019-1510915933:312877..313176TCONS_00002240-exon-sc0000019-1510915933:312877..313176Clytia hemisphaericaexon
TCONS_00002240-exon-sc0000019-1575043694:312877..313176TCONS_00002240-exon-sc0000019-1575043694:312877..313176Clytia hemisphaericaexon
TCONS_00002240-exon-sc0000019-1491911889:314455..314736TCONS_00002240-exon-sc0000019-1491911889:314455..314736Clytia hemisphaericaexon
TCONS_00002240-exon-sc0000019-1510915933:314455..314736TCONS_00002240-exon-sc0000019-1510915933:314455..314736Clytia hemisphaericaexon
TCONS_00002240-exon-sc0000019-1575043694:314455..314736TCONS_00002240-exon-sc0000019-1575043694:314455..314736Clytia hemisphaericaexon
TCONS_00002240-exon-sc0000019-1491911889:315130..315280TCONS_00002240-exon-sc0000019-1491911889:315130..315280Clytia hemisphaericaexon
TCONS_00002240-exon-sc0000019-1510915933:315130..315280TCONS_00002240-exon-sc0000019-1510915933:315130..315280Clytia hemisphaericaexon
TCONS_00002240-exon-sc0000019-1575043694:315130..315280TCONS_00002240-exon-sc0000019-1575043694:315130..315280Clytia hemisphaericaexon
TCONS_00002240-exon-sc0000019-1491911889:315779..316441TCONS_00002240-exon-sc0000019-1491911889:315779..316441Clytia hemisphaericaexon
TCONS_00002240-exon-sc0000019-1510915933:315779..316441TCONS_00002240-exon-sc0000019-1510915933:315779..316441Clytia hemisphaericaexon
TCONS_00002240-exon-sc0000019-1575043694:315779..316441TCONS_00002240-exon-sc0000019-1575043694:315779..316441Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000019supercontigsc0000019:286712..316441 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
4.25659 4.29517 7.45343 7.6572 4.43059 5.53681 6.5656 7.2408 13.8922 13.5267 10.677 21.91 17.0346 18.9306 9.7809 12.2854 15.3536 15.2998 10.0212 12.1293 2.41597 3.19412 2.88248 1.85353 17.8398 6.25211 0.627916 0.335372 1.35544 1.89624
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR016305Mannose-6-P_Isomerase
IPR001250Man6P_Isoase-1
IPR014710RmlC-like_jellyroll
IPR018050Pmannose_isomerase-type1_CS
IPR011051RmlC_Cupin
Vocabulary: Biological Process
TermDefinition
GO:0009298GDP-mannose biosynthetic process
GO:0005975carbohydrate metabolic process
Vocabulary: Molecular Function
TermDefinition
GO:0004476mannose-6-phosphate isomerase activity
GO:0008270zinc ion binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0005975 carbohydrate metabolic process
biological_process GO:0009298 GDP-mannose biosynthetic process
molecular_function GO:0004476 mannose-6-phosphate isomerase activity
molecular_function GO:0008270 zinc ion binding
Blast
BLAST of TCONS_00002240 vs. Swiss-Prot (Human)
Match: MPI (Mannose-6-phosphate isomerase OS=Homo sapiens GN=MPI PE=1 SV=2)

HSP 1 Score: 298.516 bits (763), Expect = 7.375e-93
Identity = 157/323 (48.61%), Postives = 200/323 (61.92%), Query Frame = 3
Query:  171 KFFSLECAVQNYHWGKFGEQSTVASLGRMQKNFNFDAE-KHYAELWMGDHHRGPS-IVQNMSEPTTLTQLLQNNPSLVGENIIKRFGKANLPFLFKVLSVETALSIQAHPNKEHAEILNRTRPDVYQDDNHKPEIAIAITPFEALCGFRPASEILSYFHEVEELLFVVGQKAVDELINAEMATDKKAKDEAVRRAIKGCLSQLMACDPNTIKEQLAKLITRLNECHKKHEDTSLYLGRLLLRVHSQYPGDVGCFVIYFLNYIQLEPFESIFLGPDVPHAYIYGDIIECMANSDNVVRAGFTPKFKDVDTLIEMLDYKPQTVEE 1133
            + F L CAVQ Y WGK G  S VA L          AE K YAELWMG H RG + I+ N     TL+Q +  N   +G  +   F   NLPFLFKVLSVET LSIQAHPNKE AE L+   P  Y D NHKPE+AIA+TPF+ LCGFRP  EI+++  +V E  F++G +A   L    M+ D     +AV  +++ C S LM  +   + EQL  L+ R+++      +     G LLL++H QYPGD+GCF IYFLN + L+P E++FL  +VPHAY+ GD +ECMA SDN VRAG TPKF DV TL EML Y P + ++
Sbjct:    5 RVFPLSCAVQQYAWGKMGSNSEVARLLASSDPLAQIAEDKPYAELWMGTHPRGDAKILDNRISQKTLSQWIAENQDSLGSKVKDTFN-GNLPFLFKVLSVETPLSIQAHPNKELAEKLHLQAPQHYPDANHKPEMAIALTPFQGLCGFRPVEEIVTFLKKVPEFQFLIGDEAATHL-KQTMSHD----SQAVASSLQSCFSHLMKSEKKVVVEQLNLLVKRISQQAAAGNNMEDIFGELLLQLHQQYPGDIGCFAIYFLNLLTLKPGEAMFLEANVPHAYLKGDCVECMACSDNTVRAGLTPKFIDVPTLCEMLSYTPSSSKD 321          
The following BLAST results are available for this feature:
BLAST of TCONS_00002240 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
MPI7.375e-9348.61Mannose-6-phosphate isomerase OS=Homo sapiens GN=M... [more]
back to top