Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00002233 (transcript) - C. hemisphaerica

Overview
NameTCONS_00002233
Unique NameTCONS_00002233
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1980

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00002233 ID=TCONS_00002233|Name=TCONS_00002233|organism=Clytia hemisphaerica|type=transcript|length=1980bp
aattatcaaaatgatGTGGAAAATGTTGTTTCAATAATAGCACCATTATT
TTTTTATGTCAGTCTCATTGAACTGGGTTCAAAGATCATAAAGTTGGTTT
CGTACTCACCTTTTTTCTATCTTTATTTCGGGAAATCTTGTCAGACGCTC
CACTTCAACTCTACACTGCCGACTGCTCACCTGCTCTGTTGACAGGAACT
TGGTTTATACTGTTATTTATACCCAACACGACAAAAAGCCAACCTATCAA
TAGCTGGAAGATGAAACTAAGAAGATTTTTATTGCGCTATTATCCTCCAG
GTATCATATTGGAATATGAACAATCAAAATCGATGAAAACAAAGTCTATT
GACTTACTAGAGCTCAAACCAGAGTCAGATGTAGATGCAATTCTTGAAGA
ACTGACTGTTAGAGAACCTCTCATAACAAGTTCAAGAGCTAAACAAGTCA
GAAATCTTATTATAAAGCTGCAAGAAAAACTTGCTTCAACTTCAACCTCC
ACGTTCTACCTGTTCAAGGTTTTACGAGCTCACATTTTGCCCTTGACCAA
TGTGGCCTTTAACAAAAATGGATCAAGTTTTATAACCGGAAGTTATGACC
GAACATGCAAAGTATGGGACACATCTTCGGGTGAAGAGTTGTATACACTT
GAAGGTCACCGTAATGTTGTGTATGCTGTAGCTTTCAATAATCCATATGG
AGATAAAGTTGCTACTGGATCATTTGATAAAACATGCAAGCTTTGGAGTG
CAGAAACTGGAAAATGTTATCACACATTCAAAGGACATTTAGCAGAAATT
GTTTGTGTCACATTCAATCCTCAAAGCACAATAGTAGCCACTGGTAGCAT
GGACAATACAGCTAAACTGTGGGATGTTCAAAAAGGAAATGAAATTGCAA
CGTTAAATGGACATTCAGCAGAGATTATTTGCTTGACTTTCAACACAACA
GGCGAACAATTGCTAACTGGTTCCTTTGATCATACTTGCAATGTTTGGGA
TGTTCAAGCAGGAAGGCGTTTGCATACGTTGATCGGGCATCGtggagaaa
tttcaaattgtacTTTCAATTTTGATGGCTCACTTATCGTCTCTGCCTCA
ATGGATCAAACGTGTCGCATTTGGGATGCAGACAATGGCAAATGTATCGG
TACTTTGAGGGGACACGGTGAAGAAGTATTAGACGTCACTTTCGATGCGA
CAGGTCAATACATCGTGGCTTGTTCAGCTGATGGTATAGGACGTGTTTAC
AATAGCACCACGCAACAATGTATCTGTAAACTGGAAGGACATGAAGGTGA
AATCTCAAAGGTGGTCTTCAACCCACAAGGAACTCGTGTCTTGACAGCAA
GCAGCGACCACACAGCTCGTCTATGGGACCCCATCACTGGAGAGTGTTTA
CAGGTATTAGAAGGTCACACGGAGGAGATTTTCAGCTGTGCTTTCAACTA
CGAGGGAAATATCATATTGACAGGTAGCAAGGATAATACGTGCAGACTAT
GGAGATAACAGCGTCATCACCAATCAGGTCAAAGATATTTAAAGGGGAAG
AGGTATCAACCATCCATGGTACAGGTATTCGGGATTCgctttttgatgga
ttttttgtgAATCAGACAGGCAAGAGTGCATTATTGGAACCTTTAAATGT
GACTCATTCTGAATGTATGTAGACAATTTCACTGACATTTTAAGTCCAGC
GAAATAAGCAGTACTGATCCATACTCTTACGCCAGACTCGCGTATACCAG
CTTTGGGAACAATGATggtttcatttttaaaagaatttttgttttttcga
gtttgtttacattctaACATAGATTTATCGAGATTTTTAATTTATCAACA
GTAGCTTAACTAAAGATGTTCtgaaaaattatgtaaattttgtataaaaa
accTAAACATTTATGCGatatagtttttttttgcttcctTCATAAATTGA
TAATATAACATTTCTACATTTGAGTTAACT
Run BLAST on NCBI

protein sequence of TCONS_00002233-protein

>TCONS_00002233-protein ID=TCONS_00002233-protein|Name=TCONS_00002233-protein|organism=Clytia hemisphaerica|type=polypeptide|length=415bp
MKLRRFLLRYYPPGIILEYEQSKSMKTKSIDLLELKPESDVDAILEELTV
REPLITSSRAKQVRNLIIKLQEKLASTSTSTFYLFKVLRAHILPLTNVAF
NKNGSSFITGSYDRTCKVWDTSSGEELYTLEGHRNVVYAVAFNNPYGDKV
ATGSFDKTCKLWSAETGKCYHTFKGHLAEIVCVTFNPQSTIVATGSMDNT
AKLWDVQKGNEIATLNGHSAEIICLTFNTTGEQLLTGSFDHTCNVWDVQA
GRRLHTLIGHRGEISNCTFNFDGSLIVSASMDQTCRIWDADNGKCIGTLR
GHGEEVLDVTFDATGQYIVACSADGIGRVYNSTTQQCICKLEGHEGEISK
VVFNPQGTRVLTASSDHTARLWDPITGECLQVLEGHTEEIFSCAFNYEGN
IILTGSKDNTCRLWR
Run BLAST on NCBI

transcript from alignment at sc0000019:215955..262671+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00002233 ID=TCONS_00002233|Name=TCONS_00002233|organism=Clytia hemisphaerica|type=transcript|length=46717bp|location=Sequence derived from alignment at sc0000019:215955..262671+ (Clytia hemisphaerica)
aattatcaaaatgatGTGGAAAATGTTGTTTCAATAATAGCACCATTATT TTTTTATGTCAGTCTCATTGAACTGGGTTCAAAGATCATAAAGTTGGTTT CGTACTCACCTTTTTTCTATCTTTATTTCGGGAAATCTTGTCAGACGCTC CACTTCAACTCTACACTGCCGACTGCTCACCTGCTCTGTTGACAGGAACT TGGTTTATACTGTTATTTATACCCAACACGACAAAAAGCCAACCTATCAA TAGCTGGAAGATGAAACTAAGAAGATTTTTATTGCGCTATTATCCTCCAG GTATAAAACTCATTAAAGATTACTTTTTTTGGAACTCAGGGgtctctttt tttattataaaaagcTAAAAGTAGTTGattaagttgaagttggtttgata ttctacgtttgaggtttgtttgatattcgtttgatatttgtttgatattc tcaaatttgcgttttgaagtttttgtgactacttttggaactggaaacta ttggaagccaatagagtttattctcaagggggtgtgcgcaaaatttcagc gctctccgtcgcggcgtgctccctctaaaaattggtaaccgtcaaacctc atttcggccgaaatgacgagttgggctcctgtgggggagagcggttatct ttggaattggaaactattggaagccaatagagtttattctcaagggggtg tgcgcaaaatttcagcgctctccgtcgcggcgtgctccctctaaaaattg gtaaccgtcaaacctcatttcggccgaaatgacgagttgggctcctgtgg gggagagcggttatctttggaattggaaactattggaagccaatagagtt tattctcaagggggtgtgcgcaaaatttcagcgctctccgtcgcggcgtg ctccctctaaaaattggtaaccgtcaaacctcatttcggccgaaatgacg agttgggctcctgtgggggagagcggttatctttggaattggaaactatt ggaagccaatagagtttattctcaagggggtgtgcgcaaaatttcagcgc tctccgtcgcggcgtgctccctctaaaaattggtaaccgtcaaacctcat ttcggccgaaatgacgagttgggctcctgtgggggagagcggttatcttt ggaattggaaactattggaagccaatagagtttattctcaagggggtgtg cgcaaaatttcagcgctctccgtcgcggcgtgctccctctaaaaattggt aaccgtcaaacctcatttcggccgaaatgacgagttgggctcctgtgggg gagagcggttatctttggaattggaaactattggaagccaatagagttta ttctcaagggggtgtgcgcaaaatttcagcgctctccgtcgcggcgtgct ccctctaaaaattggtaaccgtcaaacctcatttcggccgaaatgacgag ttgggctcctgtgggggagagcggttatctttggaattggaaactattgg aagccaatagagtttattctcaagggggtgtgcgcaaaatttcagcgctc tccgtcgcggcgtgctccctctaaaaattggtaaccgtcaaacctcattt cggccgaaatgacgagttgggctcctgtgggggagagcggttatctttgg aattggaaactattggaagccaatagagtttattctcaagggggtgtgcg caaaatttcagcgctctccgtcgcggcgtgctccctctaaaaattggtaa ccgtcaaacctcatttcggccgaaatgacgagttgggctcctgtggggga gagcggttatctttggaattggaaactattggaagccaatagagtttatt ctcaagggggtgtgcgcaaaatttcagcgctctccgtcgcggcgtgctcc ctctaaaaattggtaaccgtcaaacctcatttcggccgaaatgacgagtt gggctcctgtgggggagagcggttatctttggaattggaaactattggaa gccaatagagtttattctcaagggggtgtgcgcaaaatttcagcgctctc cgtcgcggcgtgctccctctaaaaattggtaaccgtcaaacctcatttcg gccgaaatgacgagttgggctcctgtgggggagagcggttatctttggaa ttggaaactattggaagccaatagagtttattctcaagggggtgtgcgca aaatttcagcgctctccgtcgcagcgtgctccctctaaaaattggtaacc gtcaaacctcatttcggccgaaatgacaagttgggctcctgtgggggatg acaatttctttgaataatttttttttgaaaagttcttcctgttacaccAA CCACCCGCCCCTCCCTCCCCgggaaaacacactaagttCACGCACACACA TTCACACagaaacacacacacacacacaaacaTTATTCAtcttcagcttt gtatttgtctaaatagaattttgtagctaaaaattttagttcatcagtat caaggttgtgaatatcagtgtcaggatgatttattagtaaCTCAGTTTTG ACGAAAGACGAGAGAAAGAGTTAAGTCAAAATTAGTGGTTTTGACCGTTG AAAGTTTTGATAGTTTGATAGCTTTGCCCCTGCCAGTTTGTGagcaattt catcaaaattaagagTGTTGATAGGATATCAGATGGAAGATTGCTCTCga ggtatttttgaataaataagatattcattactttcacctgatcaaagatt ttgagtaatttaagcTCAGCAAACAGGGGAGTGTCGGAAGTTCTTGGCTC ACTAAAGGTTATAAATCTTAGTGCAGTGTTTTGAAGAGTAAGAATTCTAT GTGTGACAGTATTGCCACACAGCCCGCCACACAGCCCCCAGAGTTGACTA GCATAGCGAACATTAGAGGCAAAAATAGcatgaaaaatgtttaaaaattt gtGCATTGGAACATAGTGACGAAGTTTGGATATTGCTCCATTTGCCCTTC TCAATTTAGCAGCAACGAAAAAAGTATGAACTNTCAGAACATAGTGACGA AGTTTAGATATTGCTCCATTTGCCCTTCTCAATTTAGCAGCAACGAAAGA AGTATGAACCTTCAATTTAGATGATTGTCAAGGTGAACACCCAAATATTT CACACTCTTACTATTGGTATTAGGATTTTCCCGCAAAGTTTAATTCTTGG AATACAGTCCATCTGTCTCCAAGGggaatgaaaattaacaaacTAGCATT CAAGGAAATTTTGTTGGCATTATGCCAACTGACTAAGACtccatacagtt tttgaaaagtttagttaatgagtatcatcagcaaaattaTATGTTTCAGA GGTTCTTATACAGCGGTGAAGATCGTTTATATACAACAAGAACAGCAGAG GCCCAAGACTGAACCCTGAGGACCAAGACTGGACCCTGAGGACCAAGACT GAACCCTGAGGACCTCCATGATTAATAGGTTTTAAAAGGGAATTTAAGCC TGCAAGAGAAACATACTGGGAGCGATTAGTGAGGTAAGATCGGAACCATA GTAGTAGTGATCGAGTTTTTCAAGTAGAATTTTGTGATCAACTTTGTAGA AAGCTCAACAAATACACCACAGGCAAACCCACCATTGTCAAGATAGTTTT GGATACGTTCGACAATATTAATGAGTGTATGCTCAGTAGAGTGAGCctta cgaaaaccaaattgttGAGTTTAGAtttgattattattattattattatt atgatgtATACAAGCTCACAGGCCCGAGGTGGACCTCTACGAACCAATTT CTAATTACAATATTAATATGTCAAGTATCTTAGTTGGTGTTTTTCCCACG CTTTGTTTAGGCTTTCTTTAAACGATTTGATTGAGGTTGACTCGATGACA AATCGCGGTAGTGCATTCCATGTTGGGATCGATCTATAGTAGAAAAATTT CGTCTGAGCCCCACGAAAACCATCATCAGCAAAGTTTGGAACAAATTCAT GATCATGGAATCTGGTTGGACGGgattttttaacaaacttgttCCGAGTT GTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATGTT AAACTGACTGGACGGTAGTTTATGGCTAGGTTGTGAGCACCCTTGTTCTT GTAGATTGGCGTGACATGCGCCATCTTCCAGTCCTCAGGTAATACACTAT CTTCTAATGTTTTGTTCATGATTATCTTCAGCGGTTCTGCAACAAAGTCA ACTAGTTCTTTCATCATCAACGGATGAATCTCATCTGGTCCAAATGATTT GCTGGGGTCAAGCTGCTTGATCTGTCTTATTATTGTTTCTAGAGAAATTT CAGGGATATCGATCATCGTATNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNGTAATTGTCCGTTTGGCTCATTCGTAAATACACCACAAAATTGC TTTTGTAGGATATTTGCCTTTTCTATGTCTTCATGCTTCAATGATTCTTT GTTGTCATCCGACTCCAGAAGAGATGCAACTCGGCTTGTCGACTTCAATT GATTTCTTACATGCGACCAAAATCGCTTCGGGTTGTTCTTTGCCAATCTT CTAATTTCTCGTTCATGGTTTCTACGCGTGCGTCTCATTATACTGTTGAC TCGGTTTCGCGCCGAAACATATTTTGCTCTATTGAACTCCTTGTCAGCAT CCGAACAATTAATCCACTTCCTATGTAGGCGATCTTTTATCCTGATTTCA TTTCGAATATCTTCCCCTATCGgaatatttccttttttcttccagAAGGA ATTTCCAACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCA ATGATGTCAAGAAAGTCAGAGAGACGTGAATACATCACTTtctcaaaaag attttcaatgtTAGATAATAGTGAAATTGGCCTATGATTAGAGACTTCAA GGGGAGAGCCTTTGTGTTTGAAGACAGGTACAACTTTAGATATTTTGAGA GTAGAAAGGAAAAATACCACTGAGAAAGGAGTAGTTTATTAGCGTCGATA TTGGCACAGAAATATCAATTTAAAAGTTTAAGGATTTTTATAGGAATACT TTGAGGACCACTTGCTTTATTGATTGAGAAAGAGCCAATCATCTTTGCGA TTTCTTGATAAAGTGGTTGGTGCTTAGAGGATGGAATGCAGATTTGGATC TTTCATGNCTTGATAAAGTGGTTGGTGCTAAGAGGATGGAATGCAGATTT GGATCTTTCATGAAACTGCTGAAGTGATTGTAAGAAGGTGGCATTTTTTC ACGAATAGAATCAGCAATAGTagtgaaaaaatcattgaaggAATTGGCTA CTTTCTCAGGATCTGATGTCAAAAAGTCACCTGTGATGATTGAAATGGGT GATTCTGAGTTAGCCCTTTTTGAGATTATATCACGAACACCAGACCAGAC TTTTCTAGAGTTTTTAGAATGGAAATCAAAATATCTGATGTAGTGGTTTT TCTTACTACGCCTAGTCAGAGTACTACGATTATACTACCTTAATGCCCTT AATTTTCGCGCACTACCACTGCAAAAATAAGAGTATAGAAAGAAGAAAAT AGGTTTTTTATAGTTAATTTTTCACAGGCTTCTTCAGATAAAATAAAGTG TATGTGATACAATCTATACACAATGTTAATCATCAATAACAATAACATCT TGTGTCCCTTGGACTAATTGAGTGTTTTGACTATTTTGAGTTTCTGGTAA AATTTGGGTCTGTGTATCAGGAACTATAACATCACATTCTTCAATATTCT CATCTTCTCCAATCTCCTCTGCGTCCAGGATCTCAATCTTCATTGTCAga atcttcttcatcttccagATCAACTACATCTGTGATCTGATCTGGTTCTA AGTAGTAACTTTTGACCAAATCCTCCATTTCTTCAAAAACCTCTTCGTCG AGTCTCCTTTAAGGTCAATCAAGAGAATTGGTATCTCTAAACCTCCTGAC AAATAAAGCGACTGATTTCATGTGAGATATGGCCAACAATTTCACTCTCT GTCAGTTTTCCTTTTATCTTAGTTTGCAAGGAAATTGCATAAGGTTCATG AACATTATTTATTTCTTGATCTACTTCAAGTTTTTCTCCTAGCTTTGGTC TCCATATGTCTCGGTAGGCATGAGATCCTTGACTTGCACATGGAATTTCA AACCTTTGTTTTCCAAGATTACACCTGCTTTCAGCCATTTGTTTGTTATT ATTTGCCATATCAGGTGTGCTTCCTTTGGAGTGGTGTTGCAAGTAATATC TTATTTACGAAAGCTTTTATATCTTAATGTTTCTCTCGTTATCTTAACCT CTGCACACACATGAATAACATTTGATTGAAagaatttcgaatttttaacC CCAGCACACACATGGAAAACATTCGAACAAAGGCATTTCGAAtgttattt tttgacatttaacCCCAACACACATGGAAAAAATTCGAATGTCCGTGTTC TTCCAATGTTTAGCGATCAGATCCATTCGTGGACTGAAGATTGATGTGCC GCCATGTCTATGAGGGATTTCTTCACAAGTAACAAGGGCATCGGTAACAA GCCGTCACAGCCGTCCAAAACCTCTGTTCAAATTGCAACTACAGAAGCAA ACATTACTTTtcgagaagaagaagaagaagtgaCAAGTTCTCTTTTGGAG AGTGGTTTGAAATCAAAGTATGAAAGGTAAAAATAATTATGTTTACTGCA ATTGGAATCTATATTAGTTAAGAGGTCAAGGATAGCTAATAAGTTATTTG TTTCATTCTAATCAAAAACTAAATACTTTATTAATCTAACTTGAATGAAG TTACTCCCTCCTTTCATTAAAAATCAGTTTAGAAGTtacaaattgaaaaa tgataagagaatgcaaaaaaatatttcaattttacaatTCTAGGAAACCA ACAAAGTACAAGACGCATTCTCCTGAGTTCCGTTGCACTGTAGCAAATAT GTGATTGATTTTGGCAAACGTCAAGCCACTAGGAAGTATGGGGTATCAGA ATCAACAGTAAGAGGGTTTGTAGACTCTTATAAGAGAACTCGTAAAGAAA ACCCCAACACTGATCTTGTCGTTGTACCTAAAAAGAAAAGAGGTCGCCAG ACACTCCTTCCCAAAGAGCTTGATAGCAAAGTTTTAACAACGATTAAATC TATGAGAACATCAGGAGCTGTGATAAACTACAATATCCGATCGAAGTCAG CCAAAATTTAATTTCCCCAAGGAATTTCATGTCACTCAAACGCCAAATCA TTGGGCTGATGAAGATACCAGCATCGACATGATTCAGAAGATCCTGATCC CTTACAtcaaagaaaaacgaaaagcCCCAAAGAAGCAATGGTTACTGATT TGTGACGTATTCAAAGGGCAGTGGACCGATGCTGTAAAAAAGGTTGTCAA AGCATCCCATGGCAAGATGGTGCCTGTTCCAAATAACTGGACGAATTACT TCCGCCAGCCATTGGACCTATCGGTTAACAAAAGCAGTAAAGATTTTTTT GCGAAATGAAACCCAAAATTGATACTCTCAGAAGATAGCAAAGCAGATGG AGGAAACCaagctataagcaaaaagctcgcaccagaatttttttttaagg ttaaagcataatttaattttttgagttctttttgaagccttcactcttag aaattcaaaatctaCTCAAGATTCCGCTTTCAACGATGTATAACATGATA GGGCTATTCTCAGGCTATGATATCGGTTCTGAAGGATTTTCGCTcaaaaa atggccatttttggCCAAATAATTGATGAAACACTAAAAACCTGAAATGg aaattaacattttattttttgctttctttgaaCATCTACATAATTCATAC ATGAAATTGTCATAAATAAGTTgcagaaatgaaaaaatgaagttaaaaAG CTCCAACTATACTGAATCGGGAAATTTTGCCGATAATATCCCAAAAACGA CAATGAAacattttggtaaaaaaaaggTAATCTCAACTTGAAAGGTCTGt atttatttgaatttaaagacttgaaatctaaaattactattttttcaaag tttcagtTTAGCTAAGTCTAACACAGCAAAAAAACAGACCTATCCGGatc aatttttttgagattACGCATTTTTGGACACTGCTCTAAATTTTCCGTCA CGCCGTAACGAAAACTCAATGACCtcataaaaatttttcttagtgagtat tttcatttattttcaggTATGTGGTTACCACCAATGGGTTGATGTTTCAT TGAGAAAATAAAGACCCAACTTCACTGTGCTCAGTTTTTAGAAGTCATCA TCAAAGATTTTCCGTCACGCCGTAACGAAAACTCCTAATTGTATCTAGAC CGATTTTGATGTAGACGAAGCTTGAAAAAATATGTCTATGctctttgaaa tattattttaacatgtaaatatcaatttaaaatcaaatatctCCTATGTT ATCAACTGGAACGTTCCAAAATGCCACTTTTTTATATACAGGGTATTTCA AGGCGCCAGCCAATATAGCTTAGAATCAAGTTTCTCAAAACATGGTCATG TTACATATCAAATTGTGTAAAATTTAATGCTGAATTCAAAAAACATCACA AGTAGGGGTCAAAAATCAAGCCAATTAGAGATATTACTCAAATCGTATCA ACGATTTTCGAttgaactcaaaattttaacGATAACGGGaatcaaattat tttgaaaatcaaattctatGTCATAgtaatgaaataattttgaaaatatc aacTTCTATGATAAATAgatatgaaataaatttttagaaatttgagcTCT ATGACAAATAatatgaaataaatattttgaagattGAATTATATGATAAA TAAAtgtgaaataaatattttgaaagttgaaatgtgtaatatataaatat gaaatatataaatacttttgaaaattgaattctaTGATGAATATTATTTA TGATCAGATATAGTCTACTTGAAGTTACTTCAGTTCCAGACACTTTTGTG AACCAGGTTCCTAAGGATTGATCTATGAGTNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNAActttaattgcaattttctcaaaa tgacccaaatggacttaggccccttttgaattaaggctcacaggacttag gccccttttgaattaaggtagcgcTTTGTGAGTTCCAGTAGATAGTAGGC ATGATCATCACCCGTTTTTATTACTGCTATATCTCCATTTTCAATATACT TTGATGCCTCTCTTTCAAAAAACTCTTCCTCCCATTCATTCTGCTCTTCC TCATTCAAATCTCCTTCGTCTTCATCATGAATGGTACTTTTTTTCTTAGA TTTAgtgaaaatatgttttgtaaTTTGTGACGGCTTTTGAAAATCgttaa aattttgtagattATCGGAACATGATTTATAATCACCACTCAGACATTGT GAGCATGCACATGAAGCTTGTCGGTATAAGATACTATCATTTTCACCTGG CGTTGTGATGACTTGATGGATTCGTAATGTTCCAGAAATGTATACATATT TGACGGTTGGGAATTCAGCACGATAATTTTCAACTTCCTCTTTCgcaaca tagaaaaaaagtctaTTAAGCATGGGCTTGTCACTGTCAAAGGCATTACG TACAGTCAAATTTGTGTCAAAGAATTCATTCAGCTCCTTAGCATCCCTAA TAATTTCTCGCTCACCAGACACTGCTCTTGAGGCAAAGGATTTTATCACA CCGCCAAGACCATCTGATTTAGATGAACTGGTTTCACAATATAAACGGGT GGTTTTGATCTTCCTTCTGACTAAACTGCTGAATGCTTTAATACATTTGA ACTGCGAAGCGCAACCATCGTTATACTCAATATCGTGAAGTATTTCAAGA CCTTCGTTTTGTGCATAATGATGATGTAACTTTTGGTTACACAATTCAAN ATATCCATAAAAATAGGTTATCAAAAGATTTGAGGACCttcaatttttcc caattttcaaaaattctggtgcgagctttttgcttatagctaGCAAACAT CCAGATCAAATCAAAGTTGATCAAGTATCTTGAcaatcactggtaaagaa tcttacctaagtatcttgacgatcactggtaaagaatcttacctaagtat ctTTAGGGTcgctggtaaagaatcttacctatgTATCTTTAGGATCGCTG GAAAAGAATCTTATCTAAGTATCTTGAcaatcactggtaaagaatactta ggtaagattctttaccagtgatcgtcaagatacttaggtaagattcttta ccagtgatcgTCAAGATACTTAGGTAAGAATGTTTACCAGTGATCGTCAa gatacttaggtaagattctttaccagtgatcgTCAAGATACTtgggtaag attctttaccagtgaaaGGAGATAACCCTTAGGTAACATTCTTTACCAGT AAAATCTGGTCAGTATTTTGAATAAAACCActcttaggtaagattcttta ccagctTTTTTACTGGTAAAGAATGCTACCTTGGGTACCGATAAGTGCAC CTGATCCTTAAATTGTATTTCATGATATACTTTTAAAAAAGATACTCAAG AAAGTCATGAAAGAAGCAATATAACTTGTGCATCGCAATTAatcataatt tttgataataataTGTTATTAATAGTACAGTGGAGCCTCTAATTAGCCGA CACCATTTGGGAAACAgattagtgtccgctaattagagtgTCAGCCTTTT GGAGactttttatgaggatttgagtAGAAAACGGCCacaaaaaaatatgc aaaatatgTAAAGAGAAACGAATNTTATAGTGGGATGTGGGATGTGGGAG AGACTTCAGAAACTGAGATAGGCATTGAAAAGTCATAAACAGCATGCTTC AGTTTAGATCAAGATTATAAAACATCCCAAGAGTGAGAAAAAGGTCTAAA GTCTCAAAATTTTACTATCTGGGTTAAAAAATAGTTTTCGTTACGGCGTG ACGGAAAATATGAGCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNActcttaggtaagattctttaccagctTTTTTACTGGT AAAGAATGCTACCTTGGGTACCGATAAGTGCACCTGATCCTTAAATTGTA TTTCATGATATACTTTTAAAAAAGATACTCAAGAAAGTCATGAAAGAAGC AATATAACTTGTGCATCGCAATTAatcataatttttgataataataTGTT ATTAATAGTACAGTGGAGCCTCTAATTAGCCGACACCATTTGGGAAACAg attagtgtccgctaattagagtgTCAGCCTTTTGGAGactttttatgagg atttgagtAGAAAACGGCCacaaaaaaatatgcaaaatatgTAAAGAGAA ACGAATGTTAGGATGCGcgaaaattgataataatagggGTGCACGAAAAT TAAAGGGTGCGCGAAAGGTTGTTTTTAAGGGGTGTGCGAAAATTANCTAG TTTTTGTCACGGCGTGACGGAAAATATGAGCAACCTGAAAGACTGACGTA TTGGATGAAATCCATTATGAAACTAACAAACTCGTGATAATTTCTACTCT ACAAGCATCCCTCTNAAGGTATCATATTTCGATATCTACGATATGATTCA TAGAGTCGATCTTTAGACTCCTTAGTTTTAGCCTTAGTGTGTTTTGTCTG GTAGTGGTCACGTTTTTTAATTGACTTCAAAATTCCTGGCTTTATccatg gttttgttttttatctaaCTTGACGTAAATTGGTAAGCTTGACTGTGGGT AGATGTCTCTCCACAAGTACTTTCATTTTgtcattaaaaatattgaaaca ggaGTCTGGATTATGaccaaatctcaaaaaaagGGTGTCCCAATCAACTC CAAGAAAATCCAGAAAATGTAAagatattttgtttcaaacaaacacattg aaaattatcaatattttttttaccaaTCATACCATTATCGGAGCCTTGTT TTAACCGGGTCACTGAACAAGGCACTGTGTGTATCCTCAAAAACTATTCT CCTTGTGATATTGAAGCCTATATCTGAGGGGTtttcataaaatctttttg TATTTCTCTTTTCAGGTATCATATTGGAATATGAACAATCAAAATCGATG AAAACAAAGTCTATTGACTTACTAGAGCTCAAACCAGAGtaagtgtaata ttttttttaattcatgatAATCGTAACATaatgttttattgtttaaattc aaaataaatgtttaacACTCAGTCCTTTTGGGTGTTTCCGTACAAAATAT TACATGCAAATCTCCAAGCCATTTCAAGTACATGAGAATTCTTCTGGCTT GATATTGGCAGATCTATCGGTAACACTCATGTTGAGTCCGGCCATCTATC AATTACAAGCTGGCAACAAAGAAGAAAAGTTGGCAAATTGAATTCAACAA AGAAAGAATGGTTCATGTTTTTGCCGGCACTTTTCCACCTTATGTAGCCG CCAATTTGCCAGTTATTGTAATTATATTGCTCGCTACATCAAACAAATAA CCGCCTACTAATTGCCAGCAAAAACAAGCTGGCTTGTTACCGGCAAGAAT TTTATGTCCTTTGAATGGCTTGTATGGTCACAATCATGAATATCACTAAT CAAATTGATGGATTATTCaatatgattgataaaagaaTATTAAGAACAAC GCTAATGAATatgaatcaattttatttttttggaaaatttctagGTCAGA TGTAGATGCAATTCTTGAAGAACTGACTGTTAGAGAACCTCTCATAACAA GTTCAAGAGCTAAACAAGTCAGAAATCTTATTATAAGTATCCTTTTCAAA AACAGATTatttaaatttaatatttgataCTTTTGCCATGTCGAGTTCTG GAAAAAAAGTATCCACACACTGATGATGGTATAAGACAGAAAAGTTTTGg cttcaatttttaaacaaatgttgtctcttttttttaatttaatcttgtat tttgatattttcaaacCTAAATCAAATAACTTTGCagccatagtgtcctc ccccccctttataaaggggggggggggttttgtttttggcccttttttta aagtatgggggaaaatgaaaaatttgaaatttgctgggggaaAATAAANN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNacttcactgatctcaaggtTATCTTATTGCAaaacctgtttaag caataaaatcagcaaacctttttaaataaaccaacttttcaatacaattt cattttccctgcactttcaaggctattttttcaagctttcccaaaatttc aaacttgatttaaggcatttttatgttaaccataatgggggaaccgcaaa atcttcaaatagctgggggaatccaaaaagaggggggaaccgaaaaattt tgaaatatggtgggggaaataaaagaggggggaatggagaaaaattttga tttttagtggggggaaccaacccaggaggacactatggcaGCTAGCTTTG ATagtttttcatgaaatatgtttttgtgtattatccttaaaattttcact ttcaaagAGCTGCAAGAAAAACTTGCTTCAACTTCAACCTCCACGTTCTA CCTGTTCAAGGTAAAAAACGTCCTGTTCtatgttttttaaatattttttc aattattttaatcTAAATGCAAGAGAAACACCTTTCAATTCACATAGCGA ACATAATGCTGACTTTTTTACACCCCTAGCCAGCTCTTGCTCTACCACCT TTAAGCTTGCTTTCCAATTATCCAGTTTAGGTAAATATCAATCACTGGTA TATTTAAACAATAGCTAAGcgattttaaaaacataattttacTGATGTAA TTTACTGATGCCAATAAATATATCAGCCTTTTTCCAGCAACATTCCTGTT CAGTCTGGCAATTAATAAGAAAATGCTTTTAAACAAGCTCAAACACCCAA AGTTTTTAGTTTACACCATTCAGTCCATGATCTTATTTTGTGTTCATCAG GTTTTACGAGCTCACATTTTGCCCTTGACCAATGTGGCCTTTAACAAAAA TGGATCAAGGTAATAAGaataacattttgaatttcataaTCATAGAGTGA gtagttttaaaaataataatttggggTAATTTGAAGGTTATGGTgattcc caaaaagtgacggagcccgattttcgaaaaaaaaaatttaggggcaattt gggccaaaaagtgcccaCAAATGGGGTTTTTCGGACTTtttgtgaaattg cttcattagttttttctgattttatatGCATAAAgattctctaaaaagtg gcttgagcagttttttcagaaaatttcggAGCATTTCttgcaatagacga tatcggcttaacgtgaaaactcagatttgaccccgaGAATTACCCACAAT GCTTAGCGcagaaaaaagttcacggtgaaacTCTTTCCGCACAAAGTATT GTGGGCAATTCtagggggtcaaatctgagttttcatgtgaagccgatatc gtctattggctttatattttttactgattttttgcactttgatgtaaaaa aatggtaatatttaaaaaactgatgaagcccaattttcaaaaatattttt tgggcaaatttgggccaaaaggtgcctaaaaatggggttttctggacttt gtgtgaaaagCTTCATTCACTTACagtatgttcttataatattatagttt gttcttatataaaaagcatGCGTAAAACTTTCTTATTCTATGCTGtaaat gaaagtaattattaccctttattgtttattcagtttttcaaaataattgt tcttATTTGAAATATCATTTACCTTCGAACAGTTACTCAATATTTTCTCA CTTTAATCATTAGTTTTATAACCGGAAGTTATGACCGAACATGCAAAGTA TGGGACACATCTTCGGGTGAAGAGTTGTATACACTTGAAGGTCACCGTAA TGTTGTGTATGCTGTAGCTTTCAATAATCCATATGGGTGAGTATTCATGA AATggaccattgcaatgtcttccacggaacCAAcactgattggttgtaag tgacgtaaaatcagtcaatatgtcactttcatgaattctttttaaaaaat gagatCAATACAagctattttttttataaatatcaaAGTTTAAAGTGGAG CCTGATTTTCCGTTGTTATTACCATTCTTTTTCTATTGAGGTAAAACTGA ATAGAGTAACAGCCTTAATTAAATGTAGTTAGGTTAATAAAAGTTTGATT TAGTATACTAAAATGAGTACTGAAGCAAGATTTGAAGTTGCAAAATTTGC ATTATACTAAAGTGCAATTTCCTTACTGATTTAACTATTCAGCCTGAAAC TGTTTACAATTTTGATTACACTTCTATTTGATTATTTCAGAGATAAAGTT GCTACTGGATCATTTGATAAAACATGCAAGGTATAAACATTTAGTAAACT TGTAGTGTATGTATTTATTTATGATTTGCAAGTGTTCGGAACCTGATTTT CCTGGATTTTCATGCgacaatttcaattttcttaattgTTTCAATTGTAC ATACATTATGTGTCTTTTCCTTCCAAGTTTTCATTTCCTAAAATCTTACT CTTAGGCCATGCATTTCTAAACAAGGAAGATCACGCATACCTTCTGAACT GAATTGATAAATTAGTATTGGCAAGAAGTATTtgttttattaattttatt gtAGCTTTGGAGTGCAGAAACTGGAAAATGTTATCACACATTCAAAGGAC ATTTAGCAGAAATTGTAAGTTCTTACACTgtaaattattcttattttaaa aagttttcaaatgcTTTCTAATGCAGAAAGAAacctttaatatttttttg ataaagaGGCAGACTGCTAAAGATTAATTTGTGTCTATGAACTTTACTAT caattcattttcagatttcaATAAAGATCTTTAtaaactcaagataattc aagAGTTTGCTATTTATTATCTCCAGCTATCATAGGCTTGTTTTTCCTAT TCAGGTTTGTGTCACATTCAATCCTCAAAGCACAATAGTAGCCACTGGTA GCATGGACAATACAGCTAAACTGTGGGATGTTCAAAAAGGAAATGAAATT GCAACGTTAAATGTAagattgaaattcaacaaaaatagGATTTATAATAG TGTAGCATATTTTAGTTTTCGGGATATGCAACCATACAATCGAGCCTTTC TtgatagctgattggttgcaaacAAGTGACATATATTAGGTGGAAAATAC CAGGAGAGCTGCAAAATTTAGTAAAGTCATTGTAGTGACGCATGTCATGA AAATACCTCTGTTTTAAGTGAAAGTATAAGGTTTCTATTTCCATCAATAC TCAACAATATTGGCCTTTAAAGCCCAAGGTTAGTTATGATTCTAGGTATG TTCTGTGATATTTTTATTGTATTATATTGTTTTAGGTCATCGAGACTAAT CGAGGCCTATTTAgtgcttttgttaattttgtttatcaCAGTCCTCTAAA GAAAGTCATTGAGACAAGAcgtaaaatatttcatgatCCACACGTGCCGC ATattaaaaagagaagaaaaaagttaaagtGTGTGAgtgttgagaaaaaa aattgtaagaaagaagagaaacataaaaattaaaaagtcgNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNGATATCTatgtgacgtgaccattaaacaatcattcagaaca caaatagtgacgatctattaaaattagtcgtttgtttcttataaaaaaga cgtttagaaacaaaaatttcatgctcttgaaatattctttcatattcaag acttcgtgagcaaaaacaaacatctatctcattaaaaaaaatgagtaatt tgactaagaacattgatgtatgcttattaatagtgattcttatagataaa catgcgttttttgaaccaacaaaacttttttgaaaaatctgcttgagcca tcttttacctatgatggtacctgtgatatttttattgtaatatATTGTTT TAGGTCATCGAGACTAATCGAGGCCTATTTAgtgcttttgttaattttgt ttatcaCAGTCCTCTAAAGAAAGTCATTGAGACAAGACGTAAAATATCTC ATGTTCTTGCACATCTATAATGACGTCTAGCAATTATGTCAAACGGTATT TTTGTTATAACTCGATTGCAGTTTTGTTACAGCCTGTTTTCTCCAAGAAA GTTTTGACTTGATATAAGAAAAACTTACACTTAAATCTTGTGACATGATA TGAAGATTAAGACTTTCAAATAATCTTCTTTACTGATATCAATGTCATTT ACCGTCTTTCAAGGCGAAGAAACGCCATGAGCTACAAATGATAAAATACG TTCAGAATATTTTTTCCAATTCAGGGACATTCAGCAGAGATTATTTGCTT GACTTTCAACACAACAGGCGAACAATTGCTAACTGGTTCCTTTGATCATA CTTGCAATGTTTGGGATGTTCAAGCAGGAAGGTATAAAGAAATTCTTGTC TTTAAGGAAGAACTAAGACCTTAAGTTTTTTTCTGTAGAGGATCTGATGT CATTGTCAGAGATCAGTTTGAGGTTTTTGAACACCTAAATATACTATACT GGCATACGTTAGTACACCTGTCAGAGAGGAGGTAATTTCAGGCTTTTTCT AGGATATTGAAAGCTTGGAAACTTAAAATGAACCCTTCATCCTTTTTAAC CTTGAATATAATCATTTAGATggggaaaaaccttgaaaacatGGAGATTT CCATGATTATGTATTTGtcttatgtttttttgctttgaGTTGTTGTTGCA GTTTAAAACtgtgtttttatttacaaatgATAAAACGTTCATCTTTCTGC ATCtttagttttcaaaatatttgaaaattatttttcttggaACAATACTG GACAAAAATGGACACCAACAATACTAAGTAAATAAACATTTTGACAATGG TTGAATAATGGGGAGCAATCACAAGAAAAACTATCTCCTAATAGCGAATG AAATTAGataaattgttttatttatctCACTTTTACTAACAAATTACAAT TATAATCGCtaggataaaaaaattcacgaCGGCTTCTCATGTGTTAGTCC GCTCTCACTGTATGTTGTTATTTCCATATTTTAAAAGCATGTTAATTAAT GTATACAAGCCGGAAACGTACCTGCTTATCCTAGCTTACCGTAACGGGAT GTTTCCGGTCTGTTTTTGAAAGTGGATTACTGCAAGTCATTAAGTCTGAT TAATTACTCATTATCAAGTGGCTTATTAGCAAGTTTCTTCTATGAAGTTT ATCTGccaattttttctaatttttgtctAAAGTTGTTTTTGTTGACTGAT ATTCTCGTCGTAATTGTTTACTACTTGTCAAGTTTCCTCGGTGCTTTCTC AAAATTCCTAGCCAGCTCTCTCTCAGATATGCTCGTTACCTGGTTAGCTC ATTGGCCTTCCGAATACATGTTCGCAAGTCATTTCATAGagaaacaaaac ttttataACGGTTCCTCCAGCCGacttaaaaaatcttcaaaattttgaag caacGAGAGAAAGCCATTGTCAGAACTGTCACTCTTCTTTGACATATTAT TGCGACCCTGAAAAAGTTAATAGATCCATactgtattttatatttttcat ttactttTGAATTACTCTATGTTAGAATCCAGCTTCAAGTATTAAATGGT TAAGAACATGGCTTAGTTTGTACGATCGTGACATAAATTTTAATAGTTAT GTTTTATTTGGAAATTAGgcttttaaattaattttattttcttcatgTAA AAAGTGTTTACATAGCACGCACGTTAGACAAAAACAAATCACCAATCAAG CAAATATTTGTCTTCTAAAAAAGCATTAAGTTCAGGAATAGAATGATTAA GTCTAGATTATCCCCTCTAAATTTAGTAATGATTAGAGGGCAGATAATTA AGAAACCATGCTCTGCTCTCGTTAACAACGAACTCTTTCATTGGATCCCC CTAAAAACATTACTACAAATCTACATACCAGAAATTTTCAACTTCCTAcc ctgagaacttttaaaactgGTTTATTCAAGAAGTTCCTAGACGTGTGACT GAGTCATCGTTCATTAGGGACTTTTTTTGAGATATATGCTATGATTAAAa gcctttttttttaatagaatAAAAATTTCTGTGATTAAAAAGTTCGAATC TAGTTACCTTGTTGACGTAATTTCAAAAGGCGTAAAAGGAACCAGCGTTA AATTTAAAAAGGCCCGGTTAGTAAGTCTCGAACAGACATATACATTATCT CAAATAACAACTTCATTCTGTGTTGTTCTTTTAACTCAATTTTAATATTA TATTCGCAAAATTTGACAACTTTTCCATGTATCTTTCGTTGCAGGCGTTT GCATACGTTGATCGGGCATCGtggagaaatttcaaattgtacTTTCAATT TTGATGGCTCACTTATCGTCTCTGCCTCAATGGTAAGCTACCTAAAATCG TAATCCAAAGATAAAGATCACAGAGGGGTGGGTTACTATAGGTTGTCGTC TGATTCTTGAAGATTAGAAATCTTTCAGTCAAATATTGAGAAAGAAAGCC TTTCTTCTTCAAATTCAGCCTTTTGATGGGgctggtttgccgtcacccgt ccctagattttggaggtcggtcggtcgaaaaaaaattttgttttggtcat tcatggaatttttgtctacattttgtcatttttgaagaaaaaaattctct tcaTCGAAAGAACAATAAAAGTTTGTAGGTCGGCAAGTTTAGAGAGAAGA TTCGgtcggctgacggcaaaccaacatttttttaagtCCATCCTGGGCAA ACTCGAGTTTTTTTCTCTTGTCGTTTTTTACAATCTGCGTGAgcactgaa attagattttttgcGACCTAAAGATGAATTTAAAAGGTCCAAAAAGATCA TATTCAAGATCAGCACGCACATGTCCTCTCCCTTTGCCCATACCCCTCCC TGGTAGTATTCTGCAATGGTGCGCAAAGTTATAGGATCAATTTCTTGGTA AATAATATACCTCTAAGAAAAAAGATGGTAAATATTACCTCTTAGCATCA GAGAAAGGGGGGATGTCAAAGTTGATCTAAGTAAAATTCACAATGGTCAA AAATCATTATATTGCTCGCCTGTCAGATGATCGATTTCGTAGTTTTTGTT GGAAGGGTACCCCAAAAGGAATCATgtttttctgaaaatatcatGCTCTC TCCGGAAAACACAAAACCTTTCACATGACCTTACCTTAGAAATATACCTG CTCGCATAagttttttatgtaaaaaaccTTATCAGATTCATTTAAACTCG GCTTAAACCAAAGTTATAGAACATGTTAAAGCTGCTTAGCGTTTTCCCCG CCCATCTGGCGTCAAAACAGACCAAATGGTAATCCGATATTACCTTCTCA ATATTACCTTACAAACACATCGTTTCTCAGACAGTACCATGAGTTACCAT TCTATTGCCTTCACAATCAATACCTAGAAAAAGCTATAAAATCGTATCGT TCACATTATAAGATATCCTATGTATCGAAGTCAAGAAATAGTGCCTGATT AGTCCGCCCCGTTTATAAATAAAGTTGGGGAGCTTTTTGTATTATGCAGC ACCCTAACTTCTGCTACTATTTCTTGAAAGAATGAAAAACATTTATAATC CGTACTATTATCCCTCGCATTGTTTTATATCCTAATATAAACTTTGGTTT GCCAGAAATAGTACCTATCCGGTCATTCCAATTTTTATTcctaaaggggg gggggggggacgaaCATTTCCNCAATTTCTTGGTAAATAATATACCTCTA AGAAAAAAGATGGTAAATATTACCTCTTAGCATCAGAGAAAGGGGGGATG TCAAAGTTGATCTAAGTAAAATTCACAATGGTCAAAAACCATTATATTGC TCGCCTGTCAGATGATCGATTTCGTAGTTTTTGTTGGAAGGGTACCCCAA AAGGAATCATgtttttctgaaaatatcatGCTCTCTCCGGAAAACACAAA ACCTTTCACATGACCTTAACTTAGAAATATACCTACTCGCTAagtttttt atgtaaaaaaccTTATCAGATTCATTTAAACTCGGCTTAAACCAAAGTTA TAGAACATGTTAAAGCTGCTTAGCGTTTTCCCCGCCCATCTGGCGTCAAA ACAGACCAAATGGTAATCCGATATTACCTTCTCAATATTACCTTACAAAC ACATCGTTTCTCAGACAGTACCATGAGTTACCATTCTATTGCCTTCACAA TCAATACCTAGAAAAAGCTATAAAATCGTATCGTTCACATTATAAGATAT CCTATGTATCGAAGTCAAGAAATAGTGCCTGATTAGTCCGCCCCGTTTAT AAATAAAGTTGGGGAGCTTTTTGTATTATGCAGCACCCTAACTTCTGCTA CTATTTCTTGAAAGAATGAAAAACATTTATAATCCGTACTATTATCCCTC GCATTGTTTTATATCCTAATATAAACTTTGGTTTGCCAGAAATAGTACCT ATCCGGTCATTCCAATTTTTATTcctaaaggggggggggggggacgaaCA TTTCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTC CTACCCCTGCATGGAAATTAATTGGAACTGCCcatttggtaaaaaaaatt cggTTTCAAGCGATTTTTTATCGCTTTTGAGAAATAAGGTGTGTGAAGAA TttcgttaaaaaaaaacaactgaaaTTTGTAAAGAAAACTTATTACTAAC GAGTCCTGCACAGAAATTGACCATACCATTTAAAGTTGGACTGACTTCCT CCGATTCTAAAACAATGCGAGTTTTTATTTCGCGCAGCTTTTAACAGAAA AGACGTCTTTACTGTGGCACTAGCCGGTGGCTCAATACTGAACGAAGGCT GTGTATAGTTCATACAGGATAGCACATAGATATTTCGTTTTTTGTTTTAG GATCAAACGTGTCGCATTTGGGATGCAGACAATGGCAAATGTATCGGTAC TTTGAGGTAAGCACCTCTATTTAGCATAATGATCGATTATCTTGACTTTA GACAGGCtaaagcagaaaaaaaaatctgaaaaggtgCATCTTCTTTAAGA TTTAAGTCCtggatggcatgaaactttgagtatgaaattaaactaaatcg ttttctttactcaaactagtaaGATTTAAGTCATGCAAGAAAAATAACAC AAATGATCCTAAAAGTCATGTCAAATCTTAAGTCAAAGAAGATGCATATT TTCGGCATTTATTTTCTGCTttatatttttgaatgtttcgGCTGGTAAAG GATTTTGGTAGTCAATGATGGGGAAAAGATTCCTCCTAGCTAATTACGTG ATAAGGCAAACATCTCAGCCAACTTAGTTTATATGCTGACTTCAGCCAAT TTTCAGTTTGTGCAAGTTTATCACGGAGGTCTTATTATTTTCTTCCAATT CTCTGTAGTTACAATCGCGCCGTTTTGcgcaaaaaattaattagagACAT TTATTGTGATAGACATTTTCTTTGATAAAGATTCAGGCCTATTTACTAAC CACACTTATCATCGATCGGCGCGTGAACATATCTTTGTTATCAGCCTCTT ATCATCATGCGCTTATTCCACGATGGTAAAAGTTTCGAAATCtaccaaaa tattttgcacgCTTTCTTATGGCAATCGCTGGAATCCCTTTATACATGAA TTTCAGTTTGGTGTCATTCGTGACAGTGATAACCTTGATAAAATGACAGC CAAATGTCATCcctgctggcacacaacgttgtttcaacgtttatctaacg ttatatggacgttgtgaatgttagaaaaacgttcaaacaacgttgtatgc caAATGTCATCTATTACTCAAGGTCCTCTTACTCTTACTCTTATgctaat tttttaaattctcctTTTGATTGCAATACCAGATCAGCGTCCAAATTCTT GGCGTGCTTGAGCACAGTTTCCAAATCAGggaccttaaaatgttcttaaa agcAATTCTTATGAATGCCGTTAAGGTCGTAAAAAATTTCTCCCAGCtgg taaaaaaaacatttatgttTATCGACATAATCCGCGTATGTTATGGACTG GCATTGCTATCGTTATAGGGCTGGCATACAACTTCAGTATGAGTAATAAA ACAATATACAGACACATAGACGcactctaattcgattttcaaggggtatt ggattttcatcgaatagggAGTACCGAATAATGAGTTTAaagggctagag aggaatctttaaCATTtcttaagcaagaaaaagtgaatccTTAAGACTTG CGCCGCATTTAGAATGGTGGATTGAATCTagctctttctttgtttttaag ttaaaaaaaagttatttctttctttcttttgggtTTTACTTAATCTATCT GGCTTTTGTGTCCAAATCACGCGGTTCAAGtattttggatgggaaataag tagcttcattaCATTCACTACACTCTagacaatcccacaatgcatcgctt ttttagaaaaatcaaaaactccgaatTGTAGAACGTGGAGTAAGAGAGAG TCAAATTATATTCACTTCggacaaaaatgattttaaaatcaaaacataaa tccaTTCGGAAAACTGTATACTGTTAAGAAAAACCTATTTGATTAATTGT GTAATAGTCTACAAAGATAATCACTTCAAATTCGATGTAATCTCAAATTT ACGTGTAGGAGAGAAACTTGTTACGTtaccatttttttctttattttgat ctAATCTGATCCAGTTATTATATGGTGATTAGCCTATCCCCCTGAAatgt atatttcaaaatgactAATTGTTGTTTAACAAACAGGTTAAACGAGTTTG ACAACCTGAATTCCGACTCTTTTTTATGACATTAAATATTCAAAGTTGCC CCCAAAGACTATTGTCGAAGGTATTTTTCGGGCCTACATGGGGttgttcc attaaaaatccatgtagggggggggggagactaaccttttcaagtcaaaa tttagattcCCCTTGGAAATGGATTTGGGAAGAAACCCTTgggaaaatca ttttcatactTTAAAGTGACGGTGGACGAACTTTACCACCTGGATCTTGT AATATCTTTATACCcactaaaaaaatgaaaaaaaaaacctacccaccccc tgtatggatatagaATAGAATGGCCCGTTATAGGTCGTAAAAAAAAgtct tggaaattttgaaaaatgtcttttttaaaTGTCAAAACTCGACCCGACat acaacgtcgtttcaacgtttttctaatattcatAACAGCCATATAACATT AGATGGACgctaaaacaacgttgtgtgtcagctgagCGAGATTTCCGCGA CCCTACGAGACAGGAACTGAAAGAAATTGCTTGTCCCTTTTAGCACCCCC TAAAATCTAATTGCTCTGTCATTTCACCGTAAACCGGGGGTCTTGTATAA ACTCGTGCGTCACGCCCAGTAAGGGAAACATTCCATTTTATTCCTGCCGA CTACTTATATCAAGAACACCGATGTAAAACTTCGTGTGTCTCACAACATA GTACTGTGCTTGTAATGAAAATCTTTATTTCGAAATCTACTTTCCGTTAT CTATTATGCAGTGCCATTTTAATCTCTGTTCATTCGTGGGTCGCGTGTTT TTATTGCTAATTAAAAGTTCTCAGTTTGTGTTGAGAAATAAGTGCCTAGA AAGCACGCTGTGTTTGATGCGGATTTCataaattgtttgaatacaccATG TTTTTACTTAAGTTTCTTAGGTAATccattattttgatattttgtgacCC GTATCCTTAAAAATGACATACATGATCTATATGAAAAATCATTCGACTAA CACCTTGGACTTCAGTATACCGGTACCTACGATAATcttaacttttcatt ttttcattcaaaagcgAACTAGCAGATGTTATATTCATTTTTTGTCTCCC TTGCTTCCCGGTCAGTCATTAAGCTGGCCTATCCAttgaaactttaaccc ttctcaggcaagagaaattgcgTAGTTTTTGCACAAACACCGGATTGaaa aagtggtttcatttcccatccatgagtctcgcctctagcccttcgggctt gaaactcaatgggccTATCCATTGTCGCGATCTGGGAAGTTTGATGAATT CTGTTTAAAGGTTGGTCTAAACTGATCTCACTGATTCGATACGACAGCGA AAAGTTTGGTTGCCTTtgtattttcctttaaaataaCTAACAACCACTTA TTTCATTTAGAAAAAGGACATTTATTACAGTACTTTAGGCAAGGTTTGAA GATTAGGGCTGCGTAGTCTTCGAAATTTCTTCAGAAAGTGGGTCTGTTAG AAAATACTCGTGTGACTTTTACGTCCGGTCTCTTTTCATGAGAGGCTTAC AAACGATCATCAAGCTGTTCTACTTTCAATATAAAGCAAGGGACGtagaa gaaatttttctttctattttctGCTATACCTACTTAACAGTATTCATCAT GATCGGATTTAAGAGTGATTACTATGCTTGTCTTACTCCCCTATTTTCAT CTCTCATCTCTCTCCTTTCCCTTTCGAGATCATCAATCATCCAGAACTCT AATCTCTTTGTCTGCCATTATTGATTGACATCTCCTATAGTGTTGTCCTT GGTTACAGACTTTGGTTATAAAAAGTGGAACAGTCGCTTTGAAATCAGTC AATCAATCAGTTTTCTCTCTACACTCTAGTCAGCGTTATTGATCGAAAGA CTTGCTCTAAGAAAGCTCGAAATACTGTTCTCAAAGAACTTGAAAAGTAT AAGAAAGTCAACATAAAAACAATACAATATACTCACAGACGGAAGAAgaa atttacaaactttttcgTTGTTGTTTTAATTGAATGGCTGTAAGCGGAAA AATCAATTCATGGgaaacaatttatcaaaaacacaaagaaaagcaACTAA TCAATCCATTTTCCAAGTGGGAAGGCGCATCCCATCGAGAGGCTCTCTCT AAAAGTCATGAAGAGTATGGAAACCCTATCTACGGCACTGATACGGAAGT GCGCGGTCGCGCGGCCGGTCATCTTATGATGCACGAGATGAAACTACTTG TCTTTATGATCAAAGAACATGGCAAGAAGATTGGAAACAATAGTATTGGA ATCACCTTTGGCGAGCTCTTTCGTTTGTACACTCAAGTGTCCAATAAGTT GGTCGGAGCTTTGCTGCGTGCCAGGAAATATGGCTTACTTGATTTTAAAG GAGAAATGCTCTTCCAACGCCGGGATGAAGATACAATGATATCTTTAAAC CTTGCTAAGGTTTCGGaagaaaattgtttcaaaactcGTCCAAAACCTGT TGATTATGACATGCTACTCACTGATCTCAAATGGGAGATTAAATATGGTG ATGAAAAGGCCGAGCGAAAGGATCGATTGTCGCGCGGGCGCGCAGGTCGA AATTGAACTTTTGAATTCAAACTTAAACCTTCGCTTCATTCTATATTTCA TCGTATTATAAATGACAGAAAGACAATTTTGAGAACAGCTCTCTCTATCT CTCGTTCTCTgtttatttgagaaaaaatgatGCTGTTCTTAATATATTGA TAAGTATTTAAACTGTAACTAGACGACAAACTTTAAATTATATTTTCCTA GTCctataatattttatttttccgcGATTTTTCGGACCCTACTAGATACA GTATTATAAATCATGAAATAGCGAGCGAAGCgtttataaacattttttta attgtacAGTGTTTAGTTAAGAATAGggtgccaaaaaaaaattgtcattt ttttttcatgtagacaattaaaaatatttggtcacaatttttttttggaa tttataTTAAGAAGAATAAGATTAAAATACTTTAAGtgattttgttttta ctttttaacgGCTTTCAAATCTAGAGTCTGTCtcaacataaacataaaca caAAATTATGTAATGTTTTTACTTTGTTCTCTACATATTTGACCTAGACT AAAAATTGTTGTATCGTTCGCTTTCGAATTTGATAAGTGGCACTATGAAA ACTGAACCTGGGTAGCTCAGTCAGTAAgacattcgccttacaatccaaAG GTTGTAggttcgaaccccggtctccgcCGACTCAACAAATGAGTCTCTTA Gactgggtaatctgatctaggcggcaagttactgggagctgagagtaggt gtggagCTCCACCTCATTATTCGATCTCCCGGGACTAGCGCAAATAGCAA AGGGATTGTCTCCCTCAttcccggctccgccgacagccaccagatgaata tacttacctACTATGGGTATCATAAGACCTATTTCTATGGTCAATGGGAG TAAAGTTAAACCCCTTATTCGTAAAAATTTATATCTTGGCTGAAGAACAT TATTTTGGCCTATATTTATTGACTGGATAACTGTAGCATTGCCTGAACAT AATTTGTACTGATGCACagtttgcaaagtttcaaagtatTATTCCGAGAG ATTTCAGCAAAGAGTTCATTTCTTTGGAATAGTATaggttttttttgttt gaatattGACCAAGCATAAACGAGGCTAGCCAAAGGcttcaaacaaaaaa tctttgtaaGTGAAATTATTAGATTCCGACCTGTTCTTGGATTGAGAGGT TGACAGTTTTAACAATTAGTTAGGGCCTTAACTAGGAGTGTTGCAGTGAT CCGTGCTGTTGAGACTGGTTGAGATCAAAAGTGAGAAAATATTCTTGGGT CTACACTGAGCTTCAAAAGTTCATTTATTAAGCTTTCTCAGTCAGAAGAG CAgtatagaaaaatcaaaattatataaCTCATTTGAGTTTTGTACTTGTG GCTTATTTTATCTGGCTTATCTTGAGATTGTGACACATTCTTTACGAGAT AATGAGACACAATTTCTAATATCAAAACAATTTCCAATCTTAATTCTCAA TCTGTCCTTTCCTGATGaaagttatttcaatttttattcctTTGTAAGTG CATTTGACTAGTAATCATAAAGATACTAACTTACCCTCATCAATATTACA TTTATGACATTCTTTGTACAGTAATAATGGAGTGACTCGAACCTCCATGA CTTGGATATCATCTCCTTAATTGTTCAAGTCAATCGTAAGTTCTCTggtt ccttcagttaacaatgccctaTAATAACTGCACCACTCGAACTTCCATAA AAAAGTAATAATCTTGCGGACAGTCCCGCCGCTTTTCCGAATAGATTCTT CcaatttgggaaaaacttcccGAACGGACAGAAAAATAGTTCATGAACAG GAAGATCGTCCCGATTTAGGGTTTTGTacaattttaagtatttttccGCT GCTACTCGGGCTTGAATTTTCTTGTTCGGTCAGTTTTCGAAAAGAGATTT GTTAATTCAGTTAAATTTTCCAGGtgaatctttttatttttctctggTGA AAAGTCCTTGAATTCATGGATGTTTAAGTTTTCGCTCGTCGCTCTCATGA CAATCAATATTTATTAAAGCGGTcaacgttttcaaaaaattcgaaAGGGT TTTGATTACTAAGTGTAATATATGTTGAGCCAAAAATTTGCATTTGACAT TCATCAAAAACTGTTGGTGGTCAATCAAACATGCgcctgatctttatttt gacctAGTAGTGGCGTGGTCCTTAATAAGCCCCAGTTCGAAAATGTGTCT GTGTGGCATATTCGTTGGGAATCTCTAATTGTAACAACAAATGCAAAATC TAGCTCTTTATCAATAAGTGCATCAACTATATAGCGATTTCAGCCCTACT TTAGCGAATTTCAGGTTTCCACAAGTCGCACCTTCTTGACCACACGAAAT TGCCTCAAGTGTTAACATtagaaattctaattttttttccttgaGTTCAT CCTTGCCCGCTGTGTAACTAAACAGCTTATTTTTAAACGCTTTGTAGATT TAGACCGTAGTgaagtggtagagcatccggctacggtgcgcaaggttgtg ggttcaaccccccagccgggtcataccaaagatttccaaaatggtgtTTG ATGCttagcaattaagagaaggatcaagggtaggTGGAGCAATCCGGGAA GAATGAGTTGCGCCATCCCCTACCTccaggtagatagctatcgacaGAGG AGCATTTGACGGGTGGCCtctgactgcggtcgcagacttacttacttaga tTTAGAGCAATGTCAGTCagaaaaaaattctgttttgttctaaaaaaaaa aatatattcattaGCTGCAATTATCTGGCGTCATCTTAAGGCATAACAGA TCATTCATAATCATAAAATGCCTACAAACTTTTGAATCCAATCCAAGAGA TTTAGGTTATTTGTTTGTATCGTAACCCAATTAATGGAGTTTAAgtagta gaaaaaaaaaacgattattAAGTAGAAAGTTTACGAAATATTTTAAGCAT ATCCAATTAATTTTCTTGAGATCTAGTTAACTAGCTTAGAATCTGTCTTT AAGGATAAGTATTAGATTTTGTCGACTGCTATCCTTGAATTTAATCCACT ggataaaaaaaaacttcgacCTGGTCATCGCTGAATTTTTTTGCACTGAT CCTATGAGTGAAGAGGATTCGTTTTTGTCAtctgaaattgaattttttcc cCGGCCGTTATTTAACGGTTCGTTTGCTTTCATAGGCTGGTAGAAGATGA ACCCTTAAAACATTGAGTGCCACCCGCATCTATAAGATCGCCCAATTTTT CGGTCCTGCACAAGCTGGTCTGAGACCTAGGAGTCCAACAACCCATGCTG TCCTGTTTTTACCCCGCAAGAATAAAAAAACTAGGTTGAGACTgacattt ttttcattgaataaaGGAGTGTATCAAATAGTAGACAGTCATTTATGTGT GTTTCTTATTGACGTTAACTTTCAGTATCATCGATTAATGGAGCGTGtgg aatagtagaacgtcgaatcaGAGAGCGTGAACTGTATTCGAAAGTGAAAT GTACTTTGAAAATCGGACGACAAAGTTTGCTTAGCACCTCTTCAGAGAAG GACAGCCCCCTTTGTTTGACCAGATGCTTATTTGTTGAACGCGAAAATCA TCTACTGTTTGTTTGCTCTGCACTGACACTGTAGTGAGATTTCGTAatgc acattttttataagaacatactatataagaacataaggcttcgatggtca aaatattaagagcatgtttaaggctttgcagactcgaaaactcccgattt cttaggaaaattgacaaaaatgctcacaaaatggtgaaattaagaacatt aaaAGCTTCAGTCTCCGTTCCTTCCAATGTTTCGTTCGTTCATTTTAGAA TATTCGAAGGCTTAACAATTTTAggaagtttttataaaaaaaacgtgtac tcttaggtgccaaataaacgccccccccccgcttgttaatttttcgatta ttttccaaccccccggacgtTATAaggacccccccccgtttattaatttt tgaagaaattcccagctcccaaaaggaaagtttcttgttttactctaaaa agcctaaatttagtctattctgaccctttttagggtttttaaaaggcccc tttccaaccccccccccggtaattaggtcccccccgtttatatgatttga aaaatttttccaccccccccccccgtttattaatttttgaagaaattccc agctcccaaaaggaaagtttcttgttttactctaaaaagcctaaatttag tctattctgaccctttttagggtttttaaaaggcccctttccaacccccc ccccggtaattaggtcccccccgtttatatgatttgaaaaatttttccac cccccccccccgtttatttggcacctaagagtacatggTGAAAAGAGCGA GGAAacactacaatacaatacattAGACGTGTTTCAAGGAACAACCGATC TTTGATTCTTCCCGGTTCATTCTTTCCGAGAAATACATAACTACACGCTT CTTTATGTCGACATACCACTTTTGTTAAATTTCGCACTTTTCCGTTCCCA TGAAAAtagtgaaaaaataataaacagccgccattttcttttctttaggg GGCAGGAAAGTTTTAGGACAACGATAGTACGGTAGATCCATTTCCGTCTC CGTTTCTGTAGGTGGGGCTGAGATTTGTATTGTTTGTTTATAACAATGAT TTGAAGAAAGCTTGTGAAACGCTTGTCAATCCAGTGGGGATCGTTTTGTA GTGTAATTGGTTTTGAAGTGTAATTATGTACATTAGATTTCAAATGAGAT GAAATGAAAGTCGATTTCCAAGtgggggctgaaattctagtgGGGCAGGG TCTATGGCACAGTGGTGTAAAAACGAAAAGTGTGTTTTGTTCAGATTACA TAgctgtatttttcttttttaatatttgtaatgagaaaaaaatgataaag taATCAAGAACTCCCTCTTTCCGAAATTTAATGATTTCTTTCTgcacaaa ctatataagaacattaatgaTTCGCTGGCCAAactattaagaacaagtta agaacattttaaggctttgttgactctgaaaacacccgatttctaaggaa aatggacaaaagtacTAAAAAAAAGGCGAAAGTAAGAACATGTCAAGAAC AGCTTTAgacttaaaacccaaaaattaAGAAGACCTCAaggtttcaaaac ttttggatgttcttaaaaaaaactgtaTCCCAGCAAGTTTTAGCGGTTGA CTTGATCGCATTCAGCCTCGCTCCTGTTCTTAATTCTATTATGCGCATAA TGTTCAATTAGTCTACGGATCAGTATTTGGACAGTCTAGCCCACACTACA cgctttcttataagaacaaactatacaagaacattaAGACTTCGATaccc aaaatcttaagaacaagttaagaacattttaaggatttgcTGCAACTCTA AAACACGGactttcttaggaaaatggacagaaatactcaaaaatgttgaa aattagaACATCATTtcagaacaaaaaaaaaacaaagaccaaAACTCAAA AGCTCaagagcatccgaaggcttcaagttttcaaaattaatgaCGGGAGA ATACATTTATTCCGGACCTCAGAGTAAGTCATCACCGATTTCTCTCTTCA TTCACAGGGGAGACAGAGTAAAAGTATTCATTTGAGATGATATTAAATAT AATACGAAGTGGTCTTTTAGCTTTGGCAAGGCTTTGCAGTTAAACCACTT TCATGGAAGACGAAAATTATATGACCCATCCAAAGCTGAAAAGCTTTTGA GTAATGAAACCGACCGGTCTTCTTTCTTCACAGGGGACACGGTGAAGAAG TATTAGACGTCACTTTCGATGCGACAGGTCAATACATCGTGGCTTGTTCA GCTGATGGTATAGGACGTGTTTACAATAGCACCACGCAACAATGTATCTG TAAACTGGAAGGACATGAAGGTGAAATCTCAAAGGTATGGATCGCGGATA TCTCATATAAAacaacactagatagagctactctgtataTTTCCTAAGCA ATGGTAgatgaagcaaaataatccgccatcttgGCTGAAAGTAGGTCGGA GTAGGTCAcagcagaggaatgtaaagagatggaaaaacagcttttctgat tactcaaagttcaacgatcacttctattgaaaattctattgtaaaaacgt taaatgaaagtccagaaaagacgggtCGCCATACAAAttggacggtttct acatgatttgacgataaaaatggaaatttgtttttccttttttgccgatt actagttcaattcttaagaataaggagcaatatttttaccaacaAGCTAA ATTGTGACGTTACTTCGTTcaagatggcgcattattttgcttcttCTAGG GatggagtagctctatctagtgctCCATATATAAAATATCTGTGATAagg atgttttgaattttcaggAAATAGTATGGTAACACAGTAGCGTAGACCAG AGGGGCGAAAAATTCGTGTAGGAGatcagatttttatgacactataatta tctattcataatataaaaactCTACTCTCCTACATAAATTTTGCGCCtcc cttgtctacgctactggtaGCATGGCTTTTCCGCGTAAGAATTTagcaaa attcatcaaaatattaaaagtttGGGCTCATTTGTAATTTTGAGTCGATT TTCCGTTTCATAGGAAAACCTTGCTATGACCACTGTTGGTCACGGGCAAT TTGAGAAAAGTTGAAACGGTTGCATTGATTCAAAAAACATAAGAACTAAG GATTTCTATGACCCTGCTGACGGTTGAACCCGTAATCTTGCGCATCGTAG CCGAATGCTCTAACTTTGTGCCACTTTTAAACCCCGATAAACGACTGTCT AAACTGCTCGAGctctaaaaaaaattcaaataaaatgtaCTTTTCAGCTT TGCACTCGGGGAcctggaattcccgagttatttttttccgagttattttg caTGCGACGTCATTATGACGTCGTCACAAAAACGATAACtcgagtttttt tgtttttttagcttttaacttttcgagCTTTTATTTTTTCGAGCCGTTTC GTTTCGTAACTTGGGAAAataataactcgggaattccaggcCCCTAGCAC TCGAGTAATAGCAAAGAGGAACTGGCCTGTTTAAGGAAAAACAGAAACAG AAACATAAATAAGGGGAGGGAACTGTAATTCAAGTATCTATCTATCTTTT CTACTCAGGTGGTCTTCAACCCACAAGGAACTCGTGTCTTGACAGCAAGC AGCGACCACACAGCTCGTCTATGGGACCCCATCACTGGAGAGTGTTTACA GGTACATAACCTATTTATTTGCCCTTTATTCCATATTCAATTACTAATTA TCGAGAACTTTTTTTCTAGGTCTCCCCACTTTTTTTCTAGATACTCCACT TTTTTAACCCCTCGACTGGTGACAATCTCTATTTTCATTTAAAGGTATTA GAAGGTCACACGGAGGAGATTTTCAGCTGTGCTTTCAACTACGAGGGAAA TATCATATTGACAGGTGAGAATACTTTGTTGCNCATTTTCCCTTTATTCC ATATTCAATTACTAATTATCGAGAACTTTTTTTCTAGGTATCCCCACTTT TTTTCTAGATACCCCACTTTTTTAACCCCTCGACTGGTGACAATCTCTAT TTTCATTTAAAGGTATTAGAAGGTCACACGGAGGAGATTTTCAGCTGTGC GTTCAACTACGAGGGAAATATCATATTGACAGGTAAGAATACTATGtcgt tttttctttatttttaaagtttttactttttgtGGGAAAATTCATACCTT CAtatttgtaaaaagtaatttaaaGTCATTTGGGTTTTCAGTCTTTAGGG CACCGTCTGAAAAAGTTTATAATCGATTTTAACcccgtttaaaaaaaaat attctgagCTCGAAATGGCTCGGTTTTCGAGCTTTGAAagaattatttaa taaacggcGTAATCGTCACAAACCAGGAAGGGGTTGATTGGTCGAGAGTC CTGCTTCTTCTATGTCTCGTTTGATACAAAGAAAACAAATCAGCAAGTCG TGGACTAAGTAAAATAAGACTCTCCTAGATCACTGGACGAAAGGAATTCA TATAGAGAATATGTTACCGTTTTTCAAGTCTCAATATCCTCCATTATCTT CATAATATAGGTAGCAAGGATAATACGTGCAGACTATGGAGATAACAGCG TCATCACCAATCAGGTCAAAGATATTTAAAGGGGAAGAGGTATCAACCAT CCATGGTACAGGTATTCGGGATTCgctttttgatggattttttgtgAATC AGACAGGCAAGAGTGCATTATTGGAACCTTTAAATGTGACTCATTCTGAA TGTATGTAGACAATTTCACTGACATTTTAAGTCCAGCGAAATAAGCAGTA CTGATCCATACTCTTACGCCAGACTCGCGTATACCAGCTTTGGGAACAAT GATggtttcatttttaaaagaatttttgttttttcgagtttgtttacatt ctaACATAGATTTATCGAGATTTTTAATTTATCAACAGTAGCTTAACTAA AGATGTTCtgaaaaattatgtaaattttgtataaaaaaccTAAACATTTA TGCGatatagtttttttttgcttcctTCATAAATTGATAATATAACATTT CTACATTTGAGTTAACT

Coding sequence (CDS) from alignment at sc0000019:215955..262671+

>TCONS_00002233 ID=TCONS_00002233|Name=TCONS_00002233|organism=Clytia hemisphaerica|type=CDS|length=19968bp|location=Sequence derived from alignment at sc0000019:215955..262671+ (Clytia hemisphaerica)
ATGAAACTAAGAAGATTTTTATTGCGCTATTATCCTCCAGGTATCATATT
GGAATATGAACAATCAAAATCGATGAAAACAAAGTCTATTGACTTACTAG
AGCTCAAACCAGAGTCAGATGTAGATGCAATTCTTGAAGAACTGACTGTT
AGAGAACCTCTCATAACAAGTTCAAGAGCTAAACAAGTCAGAAATCTTAT
TATAAAGCTGCAAGAAAAACTTGCTTCAACTTCAACCTCCACGTTCTACC
TGTTCAAGGTTTTACGAGCTCACATTTTGCCCTTGACCAATGTGGCCTTT
AACAAAAATGGATCAAGTTTTATAACCGGAAGTTATGACCGAACATGCAA
AGTATGGGACACATCTTCGGGTGAAGAGTTGTATACACTTGAAGGTCACC
GTAATGTTGTGTATGCTGTAGCTTTCAATAATCCATATGGAGATAAAGTT
GCTACTGGATCATTTGATAAAACATGCAAGCTTTGGAGTGCAGAAACTGG
AAAATGTTATCACACATTCAAAGGACATTTAGCAGAAATTGTTTGTGTCA
CATTCAATCCTCAAAGCACAATAGTAGCCACTGGTAGCATGGACAATACA
GCTAAACTGTGGGATGTTCAAAAAGGAAATGAAATTGCAACGTTAAATGG
ACATTCAGCAGAGATTATTTGCTTGACTTTCAACACAACAGGCGAACAAT
TGCTAACTGGTTCCTTTGATCATACTTGCAATGTTTGGGATGTTCAAGCA
GGAAGGCGTTTGCATACGTTGATCGGGCATCGtggagaaatttcaaattg
tacTTTCAATTTTGATGGCTCACTTATCGTCTCTGCCTCAATGGATCAAA
CGTGTCGCATTTGGGATGCAGACAATGGCAAATGTATCGGTACTTTGAGG
GGACACGGTGAAGAAGTATTAGACGTCACTTTCGATGCGACAGGTCAATA
CATCGTGGCTTGTTCAGCTGATGGTATAGGACGTGTTTACAATAGCACCA
CGCAACAATGTATCTGTAAACTGGAAGGACATGAAGGTGAAATCTCAAAG
GTGGTCTTCAACCCACAAGGAACTCGTGTCTTGACAGCAAGCAGCGACCA
CACAGCTCGTCTATGGGACCCCATCACTGGAGAGTGTTTACAGGTATTAG
AAGGTCACACGGAGGAGATTTTCAGCTGTGCTTTCAACTACGAGGGAAAT
ATCATATTGACAGGTAGCAAGGATAATACGTGCAGACTATGGAGATAAAT
GAAACTAAGAAGATTTTTATTGCGCTATTATCCTCCAGGTATCATATTGG
AATATGAACAATCAAAATCGATGAAAACAAAGTCTATTGACTTACTAGAG
CTCAAACCAGAGTCAGATGTAGATGCAATTCTTGAAGAACTGACTGTTAG
AGAACCTCTCATAACAAGTTCAAGAGCTAAACAAGTCAGAAATCTTATTA
TAAAGCTGCAAGAAAAACTTGCTTCAACTTCAACCTCCACGTTCTACCTG
TTCAAGGTTTTACGAGCTCACATTTTGCCCTTGACCAATGTGGCCTTTAA
CAAAAATGGATCAAGTTTTATAACCGGAAGTTATGACCGAACATGCAAAG
TATGGGACACATCTTCGGGTGAAGAGTTGTATACACTTGAAGGTCACCGT
AATGTTGTGTATGCTGTAGCTTTCAATAATCCATATGGAGATAAAGTTGC
TACTGGATCATTTGATAAAACATGCAAGCTTTGGAGTGCAGAAACTGGAA
AATGTTATCACACATTCAAAGGACATTTAGCAGAAATTGTTTGTGTCACA
TTCAATCCTCAAAGCACAATAGTAGCCACTGGTAGCATGGACAATACAGC
TAAACTGTGGGATGTTCAAAAAGGAAATGAAATTGCAACGTTAAATGGAC
ATTCAGCAGAGATTATTTGCTTGACTTTCAACACAACAGGCGAACAATTG
CTAACTGGTTCCTTTGATCATACTTGCAATGTTTGGGATGTTCAAGCAGG
AAGGCGTTTGCATACGTTGATCGGGCATCGtggagaaatttcaaattgta
cTTTCAATTTTGATGGCTCACTTATCGTCTCTGCCTCAATGGATCAAACG
TGTCGCATTTGGGATGCAGACAATGGCAAATGTATCGGTACTTTGAGGGG
ACACGGTGAAGAAGTATTAGACGTCACTTTCGATGCGACAGGTCAATACA
TCGTGGCTTGTTCAGCTGATGGTATAGGACGTGTTTACAATAGCACCACG
CAACAATGTATCTGTAAACTGGAAGGACATGAAGGTGAAATCTCAAAGGT
GGTCTTCAACCCACAAGGAACTCGTGTCTTGACAGCAAGCAGCGACCACA
CAGCTCGTCTATGGGACCCCATCACTGGAGAGTGTTTACAGGTATTAGAA
GGTCACACGGAGGAGATTTTCAGCTGTGCTTTCAACTACGAGGGAAATAT
CATATTGACAGGTAGCAAGGATAATACGTGCAGACTATGGAGATAAATGA
AACTAAGAAGATTTTTATTGCGCTATTATCCTCCAGGTATCATATTGGAA
TATGAACAATCAAAATCGATGAAAACAAAGTCTATTGACTTACTAGAGCT
CAAACCAGAGTCAGATGTAGATGCAATTCTTGAAGAACTGACTGTTAGAG
AACCTCTCATAACAAGTTCAAGAGCTAAACAAGTCAGAAATCTTATTATA
AAGCTGCAAGAAAAACTTGCTTCAACTTCAACCTCCACGTTCTACCTGTT
CAAGGTTTTACGAGCTCACATTTTGCCCTTGACCAATGTGGCCTTTAACA
AAAATGGATCAAGTTTTATAACCGGAAGTTATGACCGAACATGCAAAGTA
TGGGACACATCTTCGGGTGAAGAGTTGTATACACTTGAAGGTCACCGTAA
TGTTGTGTATGCTGTAGCTTTCAATAATCCATATGGAGATAAAGTTGCTA
CTGGATCATTTGATAAAACATGCAAGCTTTGGAGTGCAGAAACTGGAAAA
TGTTATCACACATTCAAAGGACATTTAGCAGAAATTGTTTGTGTCACATT
CAATCCTCAAAGCACAATAGTAGCCACTGGTAGCATGGACAATACAGCTA
AACTGTGGGATGTTCAAAAAGGAAATGAAATTGCAACGTTAAATGGACAT
TCAGCAGAGATTATTTGCTTGACTTTCAACACAACAGGCGAACAATTGCT
AACTGGTTCCTTTGATCATACTTGCAATGTTTGGGATGTTCAAGCAGGAA
GGCGTTTGCATACGTTGATCGGGCATCGtggagaaatttcaaattgtacT
TTCAATTTTGATGGCTCACTTATCGTCTCTGCCTCAATGGATCAAACGTG
TCGCATTTGGGATGCAGACAATGGCAAATGTATCGGTACTTTGAGGGGAC
ACGGTGAAGAAGTATTAGACGTCACTTTCGATGCGACAGGTCAATACATC
GTGGCTTGTTCAGCTGATGGTATAGGACGTGTTTACAATAGCACCACGCA
ACAATGTATCTGTAAACTGGAAGGACATGAAGGTGAAATCTCAAAGGTGG
TCTTCAACCCACAAGGAACTCGTGTCTTGACAGCAAGCAGCGACCACACA
GCTCGTCTATGGGACCCCATCACTGGAGAGTGTTTACAGGTATTAGAAGG
TCACACGGAGGAGATTTTCAGCTGTGCTTTCAACTACGAGGGAAATATCA
TATTGACAGGTAGCAAGGATAATACGTGCAGACTATGGAGATAAATGAAA
CTAAGAAGATTTTTATTGCGCTATTATCCTCCAGGTATCATATTGGAATA
TGAACAATCAAAATCGATGAAAACAAAGTCTATTGACTTACTAGAGCTCA
AACCAGAGTCAGATGTAGATGCAATTCTTGAAGAACTGACTGTTAGAGAA
CCTCTCATAACAAGTTCAAGAGCTAAACAAGTCAGAAATCTTATTATAAA
GCTGCAAGAAAAACTTGCTTCAACTTCAACCTCCACGTTCTACCTGTTCA
AGGTTTTACGAGCTCACATTTTGCCCTTGACCAATGTGGCCTTTAACAAA
AATGGATCAAGTTTTATAACCGGAAGTTATGACCGAACATGCAAAGTATG
GGACACATCTTCGGGTGAAGAGTTGTATACACTTGAAGGTCACCGTAATG
TTGTGTATGCTGTAGCTTTCAATAATCCATATGGAGATAAAGTTGCTACT
GGATCATTTGATAAAACATGCAAGCTTTGGAGTGCAGAAACTGGAAAATG
TTATCACACATTCAAAGGACATTTAGCAGAAATTGTTTGTGTCACATTCA
ATCCTCAAAGCACAATAGTAGCCACTGGTAGCATGGACAATACAGCTAAA
CTGTGGGATGTTCAAAAAGGAAATGAAATTGCAACGTTAAATGGACATTC
AGCAGAGATTATTTGCTTGACTTTCAACACAACAGGCGAACAATTGCTAA
CTGGTTCCTTTGATCATACTTGCAATGTTTGGGATGTTCAAGCAGGAAGG
CGTTTGCATACGTTGATCGGGCATCGtggagaaatttcaaattgtacTTT
CAATTTTGATGGCTCACTTATCGTCTCTGCCTCAATGGATCAAACGTGTC
GCATTTGGGATGCAGACAATGGCAAATGTATCGGTACTTTGAGGGGACAC
GGTGAAGAAGTATTAGACGTCACTTTCGATGCGACAGGTCAATACATCGT
GGCTTGTTCAGCTGATGGTATAGGACGTGTTTACAATAGCACCACGCAAC
AATGTATCTGTAAACTGGAAGGACATGAAGGTGAAATCTCAAAGGTGGTC
TTCAACCCACAAGGAACTCGTGTCTTGACAGCAAGCAGCGACCACACAGC
TCGTCTATGGGACCCCATCACTGGAGAGTGTTTACAGGTATTAGAAGGTC
ACACGGAGGAGATTTTCAGCTGTGCTTTCAACTACGAGGGAAATATCATA
TTGACAGGTAGCAAGGATAATACGTGCAGACTATGGAGATAAATGAAACT
AAGAAGATTTTTATTGCGCTATTATCCTCCAGGTATCATATTGGAATATG
AACAATCAAAATCGATGAAAACAAAGTCTATTGACTTACTAGAGCTCAAA
CCAGAGTCAGATGTAGATGCAATTCTTGAAGAACTGACTGTTAGAGAACC
TCTCATAACAAGTTCAAGAGCTAAACAAGTCAGAAATCTTATTATAAAGC
TGCAAGAAAAACTTGCTTCAACTTCAACCTCCACGTTCTACCTGTTCAAG
GTTTTACGAGCTCACATTTTGCCCTTGACCAATGTGGCCTTTAACAAAAA
TGGATCAAGTTTTATAACCGGAAGTTATGACCGAACATGCAAAGTATGGG
ACACATCTTCGGGTGAAGAGTTGTATACACTTGAAGGTCACCGTAATGTT
GTGTATGCTGTAGCTTTCAATAATCCATATGGAGATAAAGTTGCTACTGG
ATCATTTGATAAAACATGCAAGCTTTGGAGTGCAGAAACTGGAAAATGTT
ATCACACATTCAAAGGACATTTAGCAGAAATTGTTTGTGTCACATTCAAT
CCTCAAAGCACAATAGTAGCCACTGGTAGCATGGACAATACAGCTAAACT
GTGGGATGTTCAAAAAGGAAATGAAATTGCAACGTTAAATGGACATTCAG
CAGAGATTATTTGCTTGACTTTCAACACAACAGGCGAACAATTGCTAACT
GGTTCCTTTGATCATACTTGCAATGTTTGGGATGTTCAAGCAGGAAGGCG
TTTGCATACGTTGATCGGGCATCGtggagaaatttcaaattgtacTTTCA
ATTTTGATGGCTCACTTATCGTCTCTGCCTCAATGGATCAAACGTGTCGC
ATTTGGGATGCAGACAATGGCAAATGTATCGGTACTTTGAGGGGACACGG
TGAAGAAGTATTAGACGTCACTTTCGATGCGACAGGTCAATACATCGTGG
CTTGTTCAGCTGATGGTATAGGACGTGTTTACAATAGCACCACGCAACAA
TGTATCTGTAAACTGGAAGGACATGAAGGTGAAATCTCAAAGGTGGTCTT
CAACCCACAAGGAACTCGTGTCTTGACAGCAAGCAGCGACCACACAGCTC
GTCTATGGGACCCCATCACTGGAGAGTGTTTACAGGTATTAGAAGGTCAC
ACGGAGGAGATTTTCAGCTGTGCTTTCAACTACGAGGGAAATATCATATT
GACAGGTAGCAAGGATAATACGTGCAGACTATGGAGATAAATGAAACTAA
GAAGATTTTTATTGCGCTATTATCCTCCAGGTATCATATTGGAATATGAA
CAATCAAAATCGATGAAAACAAAGTCTATTGACTTACTAGAGCTCAAACC
AGAGTCAGATGTAGATGCAATTCTTGAAGAACTGACTGTTAGAGAACCTC
TCATAACAAGTTCAAGAGCTAAACAAGTCAGAAATCTTATTATAAAGCTG
CAAGAAAAACTTGCTTCAACTTCAACCTCCACGTTCTACCTGTTCAAGGT
TTTACGAGCTCACATTTTGCCCTTGACCAATGTGGCCTTTAACAAAAATG
GATCAAGTTTTATAACCGGAAGTTATGACCGAACATGCAAAGTATGGGAC
ACATCTTCGGGTGAAGAGTTGTATACACTTGAAGGTCACCGTAATGTTGT
GTATGCTGTAGCTTTCAATAATCCATATGGAGATAAAGTTGCTACTGGAT
CATTTGATAAAACATGCAAGCTTTGGAGTGCAGAAACTGGAAAATGTTAT
CACACATTCAAAGGACATTTAGCAGAAATTGTTTGTGTCACATTCAATCC
TCAAAGCACAATAGTAGCCACTGGTAGCATGGACAATACAGCTAAACTGT
GGGATGTTCAAAAAGGAAATGAAATTGCAACGTTAAATGGACATTCAGCA
GAGATTATTTGCTTGACTTTCAACACAACAGGCGAACAATTGCTAACTGG
TTCCTTTGATCATACTTGCAATGTTTGGGATGTTCAAGCAGGAAGGCGTT
TGCATACGTTGATCGGGCATCGtggagaaatttcaaattgtacTTTCAAT
TTTGATGGCTCACTTATCGTCTCTGCCTCAATGGATCAAACGTGTCGCAT
TTGGGATGCAGACAATGGCAAATGTATCGGTACTTTGAGGGGACACGGTG
AAGAAGTATTAGACGTCACTTTCGATGCGACAGGTCAATACATCGTGGCT
TGTTCAGCTGATGGTATAGGACGTGTTTACAATAGCACCACGCAACAATG
TATCTGTAAACTGGAAGGACATGAAGGTGAAATCTCAAAGGTGGTCTTCA
ACCCACAAGGAACTCGTGTCTTGACAGCAAGCAGCGACCACACAGCTCGT
CTATGGGACCCCATCACTGGAGAGTGTTTACAGGTATTAGAAGGTCACAC
GGAGGAGATTTTCAGCTGTGCTTTCAACTACGAGGGAAATATCATATTGA
CAGGTAGCAAGGATAATACGTGCAGACTATGGAGATAAATGAAACTAAGA
AGATTTTTATTGCGCTATTATCCTCCAGGTATCATATTGGAATATGAACA
ATCAAAATCGATGAAAACAAAGTCTATTGACTTACTAGAGCTCAAACCAG
AGTCAGATGTAGATGCAATTCTTGAAGAACTGACTGTTAGAGAACCTCTC
ATAACAAGTTCAAGAGCTAAACAAGTCAGAAATCTTATTATAAAGCTGCA
AGAAAAACTTGCTTCAACTTCAACCTCCACGTTCTACCTGTTCAAGGTTT
TACGAGCTCACATTTTGCCCTTGACCAATGTGGCCTTTAACAAAAATGGA
TCAAGTTTTATAACCGGAAGTTATGACCGAACATGCAAAGTATGGGACAC
ATCTTCGGGTGAAGAGTTGTATACACTTGAAGGTCACCGTAATGTTGTGT
ATGCTGTAGCTTTCAATAATCCATATGGAGATAAAGTTGCTACTGGATCA
TTTGATAAAACATGCAAGCTTTGGAGTGCAGAAACTGGAAAATGTTATCA
CACATTCAAAGGACATTTAGCAGAAATTGTTTGTGTCACATTCAATCCTC
AAAGCACAATAGTAGCCACTGGTAGCATGGACAATACAGCTAAACTGTGG
GATGTTCAAAAAGGAAATGAAATTGCAACGTTAAATGGACATTCAGCAGA
GATTATTTGCTTGACTTTCAACACAACAGGCGAACAATTGCTAACTGGTT
CCTTTGATCATACTTGCAATGTTTGGGATGTTCAAGCAGGAAGGCGTTTG
CATACGTTGATCGGGCATCGtggagaaatttcaaattgtacTTTCAATTT
TGATGGCTCACTTATCGTCTCTGCCTCAATGGATCAAACGTGTCGCATTT
GGGATGCAGACAATGGCAAATGTATCGGTACTTTGAGGGGACACGGTGAA
GAAGTATTAGACGTCACTTTCGATGCGACAGGTCAATACATCGTGGCTTG
TTCAGCTGATGGTATAGGACGTGTTTACAATAGCACCACGCAACAATGTA
TCTGTAAACTGGAAGGACATGAAGGTGAAATCTCAAAGGTGGTCTTCAAC
CCACAAGGAACTCGTGTCTTGACAGCAAGCAGCGACCACACAGCTCGTCT
ATGGGACCCCATCACTGGAGAGTGTTTACAGGTATTAGAAGGTCACACGG
AGGAGATTTTCAGCTGTGCTTTCAACTACGAGGGAAATATCATATTGACA
GGTAGCAAGGATAATACGTGCAGACTATGGAGATAAATGAAACTAAGAAG
ATTTTTATTGCGCTATTATCCTCCAGGTATCATATTGGAATATGAACAAT
CAAAATCGATGAAAACAAAGTCTATTGACTTACTAGAGCTCAAACCAGAG
TCAGATGTAGATGCAATTCTTGAAGAACTGACTGTTAGAGAACCTCTCAT
AACAAGTTCAAGAGCTAAACAAGTCAGAAATCTTATTATAAAGCTGCAAG
AAAAACTTGCTTCAACTTCAACCTCCACGTTCTACCTGTTCAAGGTTTTA
CGAGCTCACATTTTGCCCTTGACCAATGTGGCCTTTAACAAAAATGGATC
AAGTTTTATAACCGGAAGTTATGACCGAACATGCAAAGTATGGGACACAT
CTTCGGGTGAAGAGTTGTATACACTTGAAGGTCACCGTAATGTTGTGTAT
GCTGTAGCTTTCAATAATCCATATGGAGATAAAGTTGCTACTGGATCATT
TGATAAAACATGCAAGCTTTGGAGTGCAGAAACTGGAAAATGTTATCACA
CATTCAAAGGACATTTAGCAGAAATTGTTTGTGTCACATTCAATCCTCAA
AGCACAATAGTAGCCACTGGTAGCATGGACAATACAGCTAAACTGTGGGA
TGTTCAAAAAGGAAATGAAATTGCAACGTTAAATGGACATTCAGCAGAGA
TTATTTGCTTGACTTTCAACACAACAGGCGAACAATTGCTAACTGGTTCC
TTTGATCATACTTGCAATGTTTGGGATGTTCAAGCAGGAAGGCGTTTGCA
TACGTTGATCGGGCATCGtggagaaatttcaaattgtacTTTCAATTTTG
ATGGCTCACTTATCGTCTCTGCCTCAATGGATCAAACGTGTCGCATTTGG
GATGCAGACAATGGCAAATGTATCGGTACTTTGAGGGGACACGGTGAAGA
AGTATTAGACGTCACTTTCGATGCGACAGGTCAATACATCGTGGCTTGTT
CAGCTGATGGTATAGGACGTGTTTACAATAGCACCACGCAACAATGTATC
TGTAAACTGGAAGGACATGAAGGTGAAATCTCAAAGGTGGTCTTCAACCC
ACAAGGAACTCGTGTCTTGACAGCAAGCAGCGACCACACAGCTCGTCTAT
GGGACCCCATCACTGGAGAGTGTTTACAGGTATTAGAAGGTCACACGGAG
GAGATTTTCAGCTGTGCTTTCAACTACGAGGGAAATATCATATTGACAGG
TAGCAAGGATAATACGTGCAGACTATGGAGATAAATGAAACTAAGAAGAT
TTTTATTGCGCTATTATCCTCCAGGTATCATATTGGAATATGAACAATCA
AAATCGATGAAAACAAAGTCTATTGACTTACTAGAGCTCAAACCAGAGTC
AGATGTAGATGCAATTCTTGAAGAACTGACTGTTAGAGAACCTCTCATAA
CAAGTTCAAGAGCTAAACAAGTCAGAAATCTTATTATAAAGCTGCAAGAA
AAACTTGCTTCAACTTCAACCTCCACGTTCTACCTGTTCAAGGTTTTACG
AGCTCACATTTTGCCCTTGACCAATGTGGCCTTTAACAAAAATGGATCAA
GTTTTATAACCGGAAGTTATGACCGAACATGCAAAGTATGGGACACATCT
TCGGGTGAAGAGTTGTATACACTTGAAGGTCACCGTAATGTTGTGTATGC
TGTAGCTTTCAATAATCCATATGGAGATAAAGTTGCTACTGGATCATTTG
ATAAAACATGCAAGCTTTGGAGTGCAGAAACTGGAAAATGTTATCACACA
TTCAAAGGACATTTAGCAGAAATTGTTTGTGTCACATTCAATCCTCAAAG
CACAATAGTAGCCACTGGTAGCATGGACAATACAGCTAAACTGTGGGATG
TTCAAAAAGGAAATGAAATTGCAACGTTAAATGGACATTCAGCAGAGATT
ATTTGCTTGACTTTCAACACAACAGGCGAACAATTGCTAACTGGTTCCTT
TGATCATACTTGCAATGTTTGGGATGTTCAAGCAGGAAGGCGTTTGCATA
CGTTGATCGGGCATCGtggagaaatttcaaattgtacTTTCAATTTTGAT
GGCTCACTTATCGTCTCTGCCTCAATGGATCAAACGTGTCGCATTTGGGA
TGCAGACAATGGCAAATGTATCGGTACTTTGAGGGGACACGGTGAAGAAG
TATTAGACGTCACTTTCGATGCGACAGGTCAATACATCGTGGCTTGTTCA
GCTGATGGTATAGGACGTGTTTACAATAGCACCACGCAACAATGTATCTG
TAAACTGGAAGGACATGAAGGTGAAATCTCAAAGGTGGTCTTCAACCCAC
AAGGAACTCGTGTCTTGACAGCAAGCAGCGACCACACAGCTCGTCTATGG
GACCCCATCACTGGAGAGTGTTTACAGGTATTAGAAGGTCACACGGAGGA
GATTTTCAGCTGTGCTTTCAACTACGAGGGAAATATCATATTGACAGGTA
GCAAGGATAATACGTGCAGACTATGGAGATAAATGAAACTAAGAAGATTT
TTATTGCGCTATTATCCTCCAGGTATCATATTGGAATATGAACAATCAAA
ATCGATGAAAACAAAGTCTATTGACTTACTAGAGCTCAAACCAGAGTCAG
ATGTAGATGCAATTCTTGAAGAACTGACTGTTAGAGAACCTCTCATAACA
AGTTCAAGAGCTAAACAAGTCAGAAATCTTATTATAAAGCTGCAAGAAAA
ACTTGCTTCAACTTCAACCTCCACGTTCTACCTGTTCAAGGTTTTACGAG
CTCACATTTTGCCCTTGACCAATGTGGCCTTTAACAAAAATGGATCAAGT
TTTATAACCGGAAGTTATGACCGAACATGCAAAGTATGGGACACATCTTC
GGGTGAAGAGTTGTATACACTTGAAGGTCACCGTAATGTTGTGTATGCTG
TAGCTTTCAATAATCCATATGGAGATAAAGTTGCTACTGGATCATTTGAT
AAAACATGCAAGCTTTGGAGTGCAGAAACTGGAAAATGTTATCACACATT
CAAAGGACATTTAGCAGAAATTGTTTGTGTCACATTCAATCCTCAAAGCA
CAATAGTAGCCACTGGTAGCATGGACAATACAGCTAAACTGTGGGATGTT
CAAAAAGGAAATGAAATTGCAACGTTAAATGGACATTCAGCAGAGATTAT
TTGCTTGACTTTCAACACAACAGGCGAACAATTGCTAACTGGTTCCTTTG
ATCATACTTGCAATGTTTGGGATGTTCAAGCAGGAAGGCGTTTGCATACG
TTGATCGGGCATCGtggagaaatttcaaattgtacTTTCAATTTTGATGG
CTCACTTATCGTCTCTGCCTCAATGGATCAAACGTGTCGCATTTGGGATG
CAGACAATGGCAAATGTATCGGTACTTTGAGGGGACACGGTGAAGAAGTA
TTAGACGTCACTTTCGATGCGACAGGTCAATACATCGTGGCTTGTTCAGC
TGATGGTATAGGACGTGTTTACAATAGCACCACGCAACAATGTATCTGTA
AACTGGAAGGACATGAAGGTGAAATCTCAAAGGTGGTCTTCAACCCACAA
GGAACTCGTGTCTTGACAGCAAGCAGCGACCACACAGCTCGTCTATGGGA
CCCCATCACTGGAGAGTGTTTACAGGTATTAGAAGGTCACACGGAGGAGA
TTTTCAGCTGTGCTTTCAACTACGAGGGAAATATCATATTGACAGGTAGC
AAGGATAATACGTGCAGACTATGGAGATAAATGAAACTAAGAAGATTTTT
ATTGCGCTATTATCCTCCAGGTATCATATTGGAATATGAACAATCAAAAT
CGATGAAAACAAAGTCTATTGACTTACTAGAGCTCAAACCAGAGTCAGAT
GTAGATGCAATTCTTGAAGAACTGACTGTTAGAGAACCTCTCATAACAAG
TTCAAGAGCTAAACAAGTCAGAAATCTTATTATAAAGCTGCAAGAAAAAC
TTGCTTCAACTTCAACCTCCACGTTCTACCTGTTCAAGGTTTTACGAGCT
CACATTTTGCCCTTGACCAATGTGGCCTTTAACAAAAATGGATCAAGTTT
TATAACCGGAAGTTATGACCGAACATGCAAAGTATGGGACACATCTTCGG
GTGAAGAGTTGTATACACTTGAAGGTCACCGTAATGTTGTGTATGCTGTA
GCTTTCAATAATCCATATGGAGATAAAGTTGCTACTGGATCATTTGATAA
AACATGCAAGCTTTGGAGTGCAGAAACTGGAAAATGTTATCACACATTCA
AAGGACATTTAGCAGAAATTGTTTGTGTCACATTCAATCCTCAAAGCACA
ATAGTAGCCACTGGTAGCATGGACAATACAGCTAAACTGTGGGATGTTCA
AAAAGGAAATGAAATTGCAACGTTAAATGGACATTCAGCAGAGATTATTT
GCTTGACTTTCAACACAACAGGCGAACAATTGCTAACTGGTTCCTTTGAT
CATACTTGCAATGTTTGGGATGTTCAAGCAGGAAGGCGTTTGCATACGTT
GATCGGGCATCGtggagaaatttcaaattgtacTTTCAATTTTGATGGCT
CACTTATCGTCTCTGCCTCAATGGATCAAACGTGTCGCATTTGGGATGCA
GACAATGGCAAATGTATCGGTACTTTGAGGGGACACGGTGAAGAAGTATT
AGACGTCACTTTCGATGCGACAGGTCAATACATCGTGGCTTGTTCAGCTG
ATGGTATAGGACGTGTTTACAATAGCACCACGCAACAATGTATCTGTAAA
CTGGAAGGACATGAAGGTGAAATCTCAAAGGTGGTCTTCAACCCACAAGG
AACTCGTGTCTTGACAGCAAGCAGCGACCACACAGCTCGTCTATGGGACC
CCATCACTGGAGAGTGTTTACAGGTATTAGAAGGTCACACGGAGGAGATT
TTCAGCTGTGCTTTCAACTACGAGGGAAATATCATATTGACAGGTAGCAA
GGATAATACGTGCAGACTATGGAGATAAATGAAACTAAGAAGATTTTTAT
TGCGCTATTATCCTCCAGGTATCATATTGGAATATGAACAATCAAAATCG
ATGAAAACAAAGTCTATTGACTTACTAGAGCTCAAACCAGAGTCAGATGT
AGATGCAATTCTTGAAGAACTGACTGTTAGAGAACCTCTCATAACAAGTT
CAAGAGCTAAACAAGTCAGAAATCTTATTATAAAGCTGCAAGAAAAACTT
GCTTCAACTTCAACCTCCACGTTCTACCTGTTCAAGGTTTTACGAGCTCA
CATTTTGCCCTTGACCAATGTGGCCTTTAACAAAAATGGATCAAGTTTTA
TAACCGGAAGTTATGACCGAACATGCAAAGTATGGGACACATCTTCGGGT
GAAGAGTTGTATACACTTGAAGGTCACCGTAATGTTGTGTATGCTGTAGC
TTTCAATAATCCATATGGAGATAAAGTTGCTACTGGATCATTTGATAAAA
CATGCAAGCTTTGGAGTGCAGAAACTGGAAAATGTTATCACACATTCAAA
GGACATTTAGCAGAAATTGTTTGTGTCACATTCAATCCTCAAAGCACAAT
AGTAGCCACTGGTAGCATGGACAATACAGCTAAACTGTGGGATGTTCAAA
AAGGAAATGAAATTGCAACGTTAAATGGACATTCAGCAGAGATTATTTGC
TTGACTTTCAACACAACAGGCGAACAATTGCTAACTGGTTCCTTTGATCA
TACTTGCAATGTTTGGGATGTTCAAGCAGGAAGGCGTTTGCATACGTTGA
TCGGGCATCGtggagaaatttcaaattgtacTTTCAATTTTGATGGCTCA
CTTATCGTCTCTGCCTCAATGGATCAAACGTGTCGCATTTGGGATGCAGA
CAATGGCAAATGTATCGGTACTTTGAGGGGACACGGTGAAGAAGTATTAG
ACGTCACTTTCGATGCGACAGGTCAATACATCGTGGCTTGTTCAGCTGAT
GGTATAGGACGTGTTTACAATAGCACCACGCAACAATGTATCTGTAAACT
GGAAGGACATGAAGGTGAAATCTCAAAGGTGGTCTTCAACCCACAAGGAA
CTCGTGTCTTGACAGCAAGCAGCGACCACACAGCTCGTCTATGGGACCCC
ATCACTGGAGAGTGTTTACAGGTATTAGAAGGTCACACGGAGGAGATTTT
CAGCTGTGCTTTCAACTACGAGGGAAATATCATATTGACAGGTAGCAAGG
ATAATACGTGCAGACTATGGAGATAAATGAAACTAAGAAGATTTTTATTG
CGCTATTATCCTCCAGGTATCATATTGGAATATGAACAATCAAAATCGAT
GAAAACAAAGTCTATTGACTTACTAGAGCTCAAACCAGAGTCAGATGTAG
ATGCAATTCTTGAAGAACTGACTGTTAGAGAACCTCTCATAACAAGTTCA
AGAGCTAAACAAGTCAGAAATCTTATTATAAAGCTGCAAGAAAAACTTGC
TTCAACTTCAACCTCCACGTTCTACCTGTTCAAGGTTTTACGAGCTCACA
TTTTGCCCTTGACCAATGTGGCCTTTAACAAAAATGGATCAAGTTTTATA
ACCGGAAGTTATGACCGAACATGCAAAGTATGGGACACATCTTCGGGTGA
AGAGTTGTATACACTTGAAGGTCACCGTAATGTTGTGTATGCTGTAGCTT
TCAATAATCCATATGGAGATAAAGTTGCTACTGGATCATTTGATAAAACA
TGCAAGCTTTGGAGTGCAGAAACTGGAAAATGTTATCACACATTCAAAGG
ACATTTAGCAGAAATTGTTTGTGTCACATTCAATCCTCAAAGCACAATAG
TAGCCACTGGTAGCATGGACAATACAGCTAAACTGTGGGATGTTCAAAAA
GGAAATGAAATTGCAACGTTAAATGGACATTCAGCAGAGATTATTTGCTT
GACTTTCAACACAACAGGCGAACAATTGCTAACTGGTTCCTTTGATCATA
CTTGCAATGTTTGGGATGTTCAAGCAGGAAGGCGTTTGCATACGTTGATC
GGGCATCGtggagaaatttcaaattgtacTTTCAATTTTGATGGCTCACT
TATCGTCTCTGCCTCAATGGATCAAACGTGTCGCATTTGGGATGCAGACA
ATGGCAAATGTATCGGTACTTTGAGGGGACACGGTGAAGAAGTATTAGAC
GTCACTTTCGATGCGACAGGTCAATACATCGTGGCTTGTTCAGCTGATGG
TATAGGACGTGTTTACAATAGCACCACGCAACAATGTATCTGTAAACTGG
AAGGACATGAAGGTGAAATCTCAAAGGTGGTCTTCAACCCACAAGGAACT
CGTGTCTTGACAGCAAGCAGCGACCACACAGCTCGTCTATGGGACCCCAT
CACTGGAGAGTGTTTACAGGTATTAGAAGGTCACACGGAGGAGATTTTCA
GCTGTGCTTTCAACTACGAGGGAAATATCATATTGACAGGTAGCAAGGAT
AATACGTGCAGACTATGGAGATAAATGAAACTAAGAAGATTTTTATTGCG
CTATTATCCTCCAGGTATCATATTGGAATATGAACAATCAAAATCGATGA
AAACAAAGTCTATTGACTTACTAGAGCTCAAACCAGAGTCAGATGTAGAT
GCAATTCTTGAAGAACTGACTGTTAGAGAACCTCTCATAACAAGTTCAAG
AGCTAAACAAGTCAGAAATCTTATTATAAAGCTGCAAGAAAAACTTGCTT
CAACTTCAACCTCCACGTTCTACCTGTTCAAGGTTTTACGAGCTCACATT
TTGCCCTTGACCAATGTGGCCTTTAACAAAAATGGATCAAGTTTTATAAC
CGGAAGTTATGACCGAACATGCAAAGTATGGGACACATCTTCGGGTGAAG
AGTTGTATACACTTGAAGGTCACCGTAATGTTGTGTATGCTGTAGCTTTC
AATAATCCATATGGAGATAAAGTTGCTACTGGATCATTTGATAAAACATG
CAAGCTTTGGAGTGCAGAAACTGGAAAATGTTATCACACATTCAAAGGAC
ATTTAGCAGAAATTGTTTGTGTCACATTCAATCCTCAAAGCACAATAGTA
GCCACTGGTAGCATGGACAATACAGCTAAACTGTGGGATGTTCAAAAAGG
AAATGAAATTGCAACGTTAAATGGACATTCAGCAGAGATTATTTGCTTGA
CTTTCAACACAACAGGCGAACAATTGCTAACTGGTTCCTTTGATCATACT
TGCAATGTTTGGGATGTTCAAGCAGGAAGGCGTTTGCATACGTTGATCGG
GCATCGtggagaaatttcaaattgtacTTTCAATTTTGATGGCTCACTTA
TCGTCTCTGCCTCAATGGATCAAACGTGTCGCATTTGGGATGCAGACAAT
GGCAAATGTATCGGTACTTTGAGGGGACACGGTGAAGAAGTATTAGACGT
CACTTTCGATGCGACAGGTCAATACATCGTGGCTTGTTCAGCTGATGGTA
TAGGACGTGTTTACAATAGCACCACGCAACAATGTATCTGTAAACTGGAA
GGACATGAAGGTGAAATCTCAAAGGTGGTCTTCAACCCACAAGGAACTCG
TGTCTTGACAGCAAGCAGCGACCACACAGCTCGTCTATGGGACCCCATCA
CTGGAGAGTGTTTACAGGTATTAGAAGGTCACACGGAGGAGATTTTCAGC
TGTGCTTTCAACTACGAGGGAAATATCATATTGACAGGTAGCAAGGATAA
TACGTGCAGACTATGGAGATAAATGAAACTAAGAAGATTTTTATTGCGCT
ATTATCCTCCAGGTATCATATTGGAATATGAACAATCAAAATCGATGAAA
ACAAAGTCTATTGACTTACTAGAGCTCAAACCAGAGTCAGATGTAGATGC
AATTCTTGAAGAACTGACTGTTAGAGAACCTCTCATAACAAGTTCAAGAG
CTAAACAAGTCAGAAATCTTATTATAAAGCTGCAAGAAAAACTTGCTTCA
ACTTCAACCTCCACGTTCTACCTGTTCAAGGTTTTACGAGCTCACATTTT
GCCCTTGACCAATGTGGCCTTTAACAAAAATGGATCAAGTTTTATAACCG
GAAGTTATGACCGAACATGCAAAGTATGGGACACATCTTCGGGTGAAGAG
TTGTATACACTTGAAGGTCACCGTAATGTTGTGTATGCTGTAGCTTTCAA
TAATCCATATGGAGATAAAGTTGCTACTGGATCATTTGATAAAACATGCA
AGCTTTGGAGTGCAGAAACTGGAAAATGTTATCACACATTCAAAGGACAT
TTAGCAGAAATTGTTTGTGTCACATTCAATCCTCAAAGCACAATAGTAGC
CACTGGTAGCATGGACAATACAGCTAAACTGTGGGATGTTCAAAAAGGAA
ATGAAATTGCAACGTTAAATGGACATTCAGCAGAGATTATTTGCTTGACT
TTCAACACAACAGGCGAACAATTGCTAACTGGTTCCTTTGATCATACTTG
CAATGTTTGGGATGTTCAAGCAGGAAGGCGTTTGCATACGTTGATCGGGC
ATCGtggagaaatttcaaattgtacTTTCAATTTTGATGGCTCACTTATC
GTCTCTGCCTCAATGGATCAAACGTGTCGCATTTGGGATGCAGACAATGG
CAAATGTATCGGTACTTTGAGGGGACACGGTGAAGAAGTATTAGACGTCA
CTTTCGATGCGACAGGTCAATACATCGTGGCTTGTTCAGCTGATGGTATA
GGACGTGTTTACAATAGCACCACGCAACAATGTATCTGTAAACTGGAAGG
ACATGAAGGTGAAATCTCAAAGGTGGTCTTCAACCCACAAGGAACTCGTG
TCTTGACAGCAAGCAGCGACCACACAGCTCGTCTATGGGACCCCATCACT
GGAGAGTGTTTACAGGTATTAGAAGGTCACACGGAGGAGATTTTCAGCTG
TGCTTTCAACTACGAGGGAAATATCATATTGACAGGTAGCAAGGATAATA
CGTGCAGACTATGGAGATAAATGAAACTAAGAAGATTTTTATTGCGCTAT
TATCCTCCAGGTATCATATTGGAATATGAACAATCAAAATCGATGAAAAC
AAAGTCTATTGACTTACTAGAGCTCAAACCAGAGTCAGATGTAGATGCAA
TTCTTGAAGAACTGACTGTTAGAGAACCTCTCATAACAAGTTCAAGAGCT
AAACAAGTCAGAAATCTTATTATAAAGCTGCAAGAAAAACTTGCTTCAAC
TTCAACCTCCACGTTCTACCTGTTCAAGGTTTTACGAGCTCACATTTTGC
CCTTGACCAATGTGGCCTTTAACAAAAATGGATCAAGTTTTATAACCGGA
AGTTATGACCGAACATGCAAAGTATGGGACACATCTTCGGGTGAAGAGTT
GTATACACTTGAAGGTCACCGTAATGTTGTGTATGCTGTAGCTTTCAATA
ATCCATATGGAGATAAAGTTGCTACTGGATCATTTGATAAAACATGCAAG
CTTTGGAGTGCAGAAACTGGAAAATGTTATCACACATTCAAAGGACATTT
AGCAGAAATTGTTTGTGTCACATTCAATCCTCAAAGCACAATAGTAGCCA
CTGGTAGCATGGACAATACAGCTAAACTGTGGGATGTTCAAAAAGGAAAT
GAAATTGCAACGTTAAATGGACATTCAGCAGAGATTATTTGCTTGACTTT
CAACACAACAGGCGAACAATTGCTAACTGGTTCCTTTGATCATACTTGCA
ATGTTTGGGATGTTCAAGCAGGAAGGCGTTTGCATACGTTGATCGGGCAT
CGtggagaaatttcaaattgtacTTTCAATTTTGATGGCTCACTTATCGT
CTCTGCCTCAATGGATCAAACGTGTCGCATTTGGGATGCAGACAATGGCA
AATGTATCGGTACTTTGAGGGGACACGGTGAAGAAGTATTAGACGTCACT
TTCGATGCGACAGGTCAATACATCGTGGCTTGTTCAGCTGATGGTATAGG
ACGTGTTTACAATAGCACCACGCAACAATGTATCTGTAAACTGGAAGGAC
ATGAAGGTGAAATCTCAAAGGTGGTCTTCAACCCACAAGGAACTCGTGTC
TTGACAGCAAGCAGCGACCACACAGCTCGTCTATGGGACCCCATCACTGG
AGAGTGTTTACAGGTATTAGAAGGTCACACGGAGGAGATTTTCAGCTGTG
CTTTCAACTACGAGGGAAATATCATATTGACAGGTAGCAAGGATAATACG
TGCAGACTATGGAGATAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_001182XLOC_001182Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00002233-exon-sc0000019-1491911889:215955..216254TCONS_00002233-exon-sc0000019-1491911889:215955..216254Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1510915933:215955..216254TCONS_00002233-exon-sc0000019-1510915933:215955..216254Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1575043694:215955..216254TCONS_00002233-exon-sc0000019-1575043694:215955..216254Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1491911889:233220..233292TCONS_00002233-exon-sc0000019-1491911889:233220..233292Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1510915933:233220..233292TCONS_00002233-exon-sc0000019-1510915933:233220..233292Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1575043694:233220..233292TCONS_00002233-exon-sc0000019-1575043694:233220..233292Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1491911889:233849..233940TCONS_00002233-exon-sc0000019-1491911889:233849..233940Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1510915933:233849..233940TCONS_00002233-exon-sc0000019-1510915933:233849..233940Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1575043694:233849..233940TCONS_00002233-exon-sc0000019-1575043694:233849..233940Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1491911889:234812..234864TCONS_00002233-exon-sc0000019-1491911889:234812..234864Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1510915933:234812..234864TCONS_00002233-exon-sc0000019-1510915933:234812..234864Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1575043694:234812..234864TCONS_00002233-exon-sc0000019-1575043694:234812..234864Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1491911889:235255..235313TCONS_00002233-exon-sc0000019-1491911889:235255..235313Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1510915933:235255..235313TCONS_00002233-exon-sc0000019-1510915933:235255..235313Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1575043694:235255..235313TCONS_00002233-exon-sc0000019-1575043694:235255..235313Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1491911889:236118..236240TCONS_00002233-exon-sc0000019-1491911889:236118..236240Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1510915933:236118..236240TCONS_00002233-exon-sc0000019-1510915933:236118..236240Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1575043694:236118..236240TCONS_00002233-exon-sc0000019-1575043694:236118..236240Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1491911889:236645..236684TCONS_00002233-exon-sc0000019-1491911889:236645..236684Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1510915933:236645..236684TCONS_00002233-exon-sc0000019-1510915933:236645..236684Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1575043694:236645..236684TCONS_00002233-exon-sc0000019-1575043694:236645..236684Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1491911889:236959..237018TCONS_00002233-exon-sc0000019-1491911889:236959..237018Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1510915933:236959..237018TCONS_00002233-exon-sc0000019-1510915933:236959..237018Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1575043694:236959..237018TCONS_00002233-exon-sc0000019-1575043694:236959..237018Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1491911889:237259..237366TCONS_00002233-exon-sc0000019-1491911889:237259..237366Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1510915933:237259..237366TCONS_00002233-exon-sc0000019-1510915933:237259..237366Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1575043694:237259..237366TCONS_00002233-exon-sc0000019-1575043694:237259..237366Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1491911889:242629..242735TCONS_00002233-exon-sc0000019-1491911889:242629..242735Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1510915933:242629..242735TCONS_00002233-exon-sc0000019-1510915933:242629..242735Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1575043694:242629..242735TCONS_00002233-exon-sc0000019-1575043694:242629..242735Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1491911889:244649..244736TCONS_00002233-exon-sc0000019-1491911889:244649..244736Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1510915933:244649..244736TCONS_00002233-exon-sc0000019-1510915933:244649..244736Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1575043694:244649..244736TCONS_00002233-exon-sc0000019-1575043694:244649..244736Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1491911889:249405..249460TCONS_00002233-exon-sc0000019-1491911889:249405..249460Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1510915933:249405..249460TCONS_00002233-exon-sc0000019-1510915933:249405..249460Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1575043694:249405..249460TCONS_00002233-exon-sc0000019-1575043694:249405..249460Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1491911889:259788..259938TCONS_00002233-exon-sc0000019-1491911889:259788..259938Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1510915933:259788..259938TCONS_00002233-exon-sc0000019-1510915933:259788..259938Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1575043694:259788..259938TCONS_00002233-exon-sc0000019-1575043694:259788..259938Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1491911889:261213..261305TCONS_00002233-exon-sc0000019-1491911889:261213..261305Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1510915933:261213..261305TCONS_00002233-exon-sc0000019-1510915933:261213..261305Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1575043694:261213..261305TCONS_00002233-exon-sc0000019-1575043694:261213..261305Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1491911889:261449..261518TCONS_00002233-exon-sc0000019-1491911889:261449..261518Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1510915933:261449..261518TCONS_00002233-exon-sc0000019-1510915933:261449..261518Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1575043694:261449..261518TCONS_00002233-exon-sc0000019-1575043694:261449..261518Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1491911889:262165..262671TCONS_00002233-exon-sc0000019-1491911889:262165..262671Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1510915933:262165..262671TCONS_00002233-exon-sc0000019-1510915933:262165..262671Clytia hemisphaericaexon
TCONS_00002233-exon-sc0000019-1575043694:262165..262671TCONS_00002233-exon-sc0000019-1575043694:262165..262671Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00002233-proteinTCONS_00002233-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000019supercontigsc0000019:215955..262671 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 0 0 16.6953 13.9825 5.88074 7.65784 8.20382 11.6647 10.0324 3.55045 4.78216 4.00325 0 0 0 0 0 0 0 0 0 0 42.7779 40.4644 0 0 0 0.67453
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR020472G-protein_beta_WD-40_rep
IPR001680WD40_repeat
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005515 protein binding
Blast
BLAST of TCONS_00002233 vs. Swiss-Prot (Human)
Match: DAW1 (Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1)

HSP 1 Score: 638.647 bits (1646), Expect = 0.000e+0
Identity = 290/415 (69.88%), Postives = 352/415 (84.82%), Query Frame = 3
Query:  261 MKLRRFLLRYYPPGIILEYEQSKSMKTKSIDLLELKPESDVDAILEELTVREPLITSSRAKQVRNLIIKLQEKLASTSTSTFYLFKVLRAHILPLTNVAFNKNGSSFITGSYDRTCKVWDTSSGEELYTLEGHRNVVYAVAFNNPYGDKVATGSFDKTCKLWSAETGKCYHTFKGHLAEIVCVTFNPQSTIVATGSMDNTAKLWDVQKGNEIATLNGHSAEIICLTFNTTGEQLLTGSFDHTCNVWDVQAGRRLHTLIGHRGEISNCTFNFDGSLIVSASMDQTCRIWDADNGKCIGTLRGHGEEVLDVTFDATGQYIVACSADGIGRVYNSTTQQCICKLEGHEGEISKVVFNPQGTRVLTASSDHTARLWDPITGECLQVLEGHTEEIFSCAFNYEGNIILTGSKDNTCRLWR 1505
            MKL+  LLRYYPPGI+LEYE+   +KTKSIDLL+L P +DV A++EE+   EPL+T+SR +QV+ LI +LQEKL   S  TFYLFKVL+AHILPLTNVA NK+GS FITGSYDRTCK+WDT+SGEEL TLEGHRNVVYA+AFNNPYGDK+ATGSFDKTCKLWS ETGKCYHTF+GH AEIVC++FNPQST+VATGSMD TAKLWD+Q G E+ TL GHSAEII L+FNT+G++++TGSFDHT  VWD   GR+++ LIGH  EIS+ +FN+D SLI++ SMD+TC++WDA NGKC+ TL GH +E+LD  FD TG+ I   SADG  R++++ T++CI KLEGHEGEISK+ FNPQG  +LT SSD TAR+WD  TG+CLQVLEGHT+EIFSCAFNY+GNI++TGSKDNTCR+WR
Sbjct:    1 MKLKSLLLRYYPPGIMLEYEKHGELKTKSIDLLDLGPSTDVSALVEEIQKAEPLLTASRTEQVKLLIQRLQEKLGQNSNHTFYLFKVLKAHILPLTNVALNKSGSCFITGSYDRTCKLWDTASGEELNTLEGHRNVVYAIAFNNPYGDKIATGSFDKTCKLWSVETGKCYHTFRGHTAEIVCLSFNPQSTLVATGSMDTTAKLWDIQNGEEVYTLRGHSAEIISLSFNTSGDRIITGSFDHTVVVWDADTGRKVNILIGHCAEISSASFNWDCSLILTGSMDKTCKLWDATNGKCVATLTGHDDEILDSCFDYTGKLIATASADGTARIFSAATRKCIAKLEGHEGEISKISFNPQGNHLLTGSSDKTARIWDAQTGQCLQVLEGHTDEIFSCAFNYKGNIVITGSKDNTCRIWR 415          
The following BLAST results are available for this feature:
BLAST of TCONS_00002233 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
DAW10.000e+069.88Dynein assembly factor with WDR repeat domains 1 O... [more]
back to top