Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00002157 (transcript) - C. hemisphaerica

Overview
NameTCONS_00002157
Unique NameTCONS_00002157
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length6685

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00002157 ID=TCONS_00002157|Name=TCONS_00002157|organism=Clytia hemisphaerica|type=transcript|length=6685bp
cctttattgaattctcatagtgatatgtttgtaaaaaatctgtgtcgggt
ttgaaaaatcaaaatgaacggtcgccagccgatgATGAATGCAAcaataa
caaagtccaaaacaggatcattttcagccatacataacaccacaaaaact
actcagattgttttcaaatttacactgtAATTTTaatttagtattctctt
ttgaatttcaatggctgcgtgtttgaaagtttcattgtcaagtttgaaaa
tccaaaagagACGACCACCAAtatatcatcatgaaaaatgacattttgaa
aTTCCTTTCTCTGAAAAGTACTTTTACCTCATCAAACTCTGCCCCGTGAT
TGGTTTgtaaatttttcactgagatttgccagaatttgctacacagtcag
ctagtccactttcagcagccatctttttctaaatactttctgccaatcaa
atcacagtattatcggaatcagataatccgtttttattaaatcggaatag
atcatcggataaggtaaacaaacaaaaaatgtaatGACCAtcgtcggacg
agagagaatttaaggctcctaggccggagcaataagctcttgtctttttt
atcaaaaatgtaaaaaaaatgaggggAGAGCATGGCATACTTGGAAAACC
AAGTGCTATAATATGACCTGAAGTAATAATTTTAGTTTAGCATAATTATT
GAAgtatgaaaacaatgaaaagaaaaagtggTTCTGATGGAGCTGCTAAA
GTCAAGTTTAAGAAGAAAAAACCTCCAACTGATGAAACaaagGTCGCAAG
TTTGGAAGAAAGAGAACATCAAAAGACGTCCATCTACAGAGCACCAACAA
ACGATGAATTAACTCAGTTGAAAGAGAATGAAGATCTGTACAAGAACAAC
ATATTTCGCTTACAAATTCAATACCTGCTGGAGGAAGTTCGTTTACAAGA
AAACAAACTAGATCAAATCAACACTGTTTTGCACTCCATAAACAGCTTTT
TGAAGCAATTACCATCACAAACCCAAGAGTATGAGCTTTCATCCAGTGAT
GCTTCACCACAAGGAGTTCATGTTCCCTTCCCAGATATCATCAGTCAATC
CAAAatgaaaggaaaattttgttttcacaCTCCCTCTGAAATCAAAGTTG
TTGGTNTATCATCAGTCAATCCAAAatgaaaggaaaattttgttttcaca
CTCCCTCTGAAATAAAAGTTGTTGGTagctttttattgaaaactatGATC
AAAGCGAATCATTCAATTGACATTGCTGTACAAATGCCACAGGCTGTGTT
ACATGGAAAAGATTATCTGAACTATCGTTATTACTACAAACGAGCTATAT
ATCTTTCATGGTTGGCTTATTACTTGAAAGATTGGGAACACACAGAAGAT
CTCTCCTTTACCTGTGGAACAAATATCTTCAAACcaactttgaaaattaa
tttgaaaggGAAAGTTGGGAAAAAATTTAACGTTGTGCTTCACCTAGCTA
CACCCGAAGGGCATTTCAAGTTGTCACGGTTTTTACCGCTGAAAAATAAC
ATAAGACATAATTGGTATCACGGCTATGAACAGGATACAACAGAAGAAAT
TGAGTTTCCAACAGCAGATTACAACAATGGAGTTCTGGAGGACATGTTAT
ACGAAGATCACTTACGATTGTTGTACTCTACTCTCAAAGAATGTCCTGGT
ATGAGTGAAGCCATCCTACTCCTCAAAACGTGGCTCAAACAACGAAGTTA
CAAGGGTAATGTACCATTTAATGGGTTTTGTTGTTCAATGTTGCTGGTGT
ATTTGTTGTCAGTACGAAAGATTTCTGCACACATGAGCTCCTATCAAATG
TTTCGACTTACTCTTCACTTCATTGGTACATCTGATTGGTCGAAGGAAGG
AATCACTTTGAATAAAGATACCAATGAAGATGAAAAGCTGCCATCTTTAA
AAGACTTTCACGGTGTATATCCGGTTGTTTTTGTGGACTCAAGTGGTCAC
CTCAACCTTTGCTCGTCACTCGATACCATCTCCTATCAAATGTTGCGATA
TGAAGCTCAGCAATCGTTGGCGTTATTGGACAGTACTGAAGAAGGCTCCT
TTGAATTACTTTTCATCAAAACCAAATCCTTCCTTCAAACCGTCGATCAT
ATGTTCAGAATAAATGACGCCGGCTCCTTTACAACCAAATTGTCAACGGA
GGAAAATAACAAGTTGATAAGCTATGGTGGCAACGCGCGTCCGATTCTGT
TGGAAAAAATGTCCGAAATTTTAAGACGGGGATTGGACGAAAGAATAACG
AGTCTATTTATGAAACCCTCGCCTCTGGTTCAGTGGTCGGTGAACGAGTC
GTGCCCAGACTCTTCAAAAGGACCAATCACAGTGGGAGTCTGCTTGAACG
CGTCCAATTATGACAATGTTTTGATCATGGGCCCTCCTGCTGATCAACCT
CAGGCGAAAGAGTTCCGCGCATTTTGGGGCGAGAAATCAGAATTGAGGCG
TTTTCAAGATGGCAGTATCAACGAGGCGGTAGTTTGGCCATCATCCAATt
ccagccagaaaaaaatggTCTGCAAACAGATCGTACAACATCTTCTTAAA
CTGCATTGTGCAATCTATCCTTCATCCATCGATTACCATGGCAACTCGTT
CGATTTCATTCTCTCTTCGAACACGTCATCGTTCGAGCACGCGTCAGCCA
ATCAGAAGAAAGCCACAATACCACGTGGTTGTGGTGAAGAAGAGAGCact
cacgtgatcaaaacatttgaaGAATTGAGTCGTCAGCTACGTGGTTTGAG
TGAATTACCTTTAGTCGTCAACAATATACATGCAGTGGACCCATTGCTTA
GGATGACAGAGCCATTGACTGCTCGACAATACGAAGTCAAGGAGCAATCA
AAAGGTCAAGATTTTCTGGTACCCAGTAACGCAAAAAGATCACCGCTTTG
GTGTCCTGTAATAAAAGCTTATATCCAGTTTGAAGGGAGCGGTCAATGGC
CTGATAATTTAGAAGCAATCCAACACATACGCGCTGCTTTCCACATCAAA
GTTGCAGAATGCATACGTCAGCAACTTCATTTCCCTGCAAAAGCGACTCC
AAGGTGGATCGATGTGATGAAAaaCGGCTACGTTTTTCGTTTGTCGGTCA
TCCATTACCGAGAAATGGTTTTACATAAAGAAAATGTAGCCTTGGGAAAA
TCAAAAACTTCCCATGACATCCAGGCTAAGAAGTTGGAAATGGAAATTGT
GAAAAAGCCCCTCCATAACTCCCTCATTCACAGTTTGAACGGTCAATTCG
GTGCATTTTCGCTGACGTGTCGCCTGGCGAAGAGGTGGATGAGTAGTCAG
ATGTTGTCCAATCATTTCTATGAAGAGTTGATCGAGTTGTTGGTCGCCTC
CGTCTTTCTCTCACCAAACCCACCTAATTCATCTCTTTGTGGATTTGTTC
GATTCTTGGATCATATAGCGACCTTCGATTGGAATGCAAACCCTTTGATT
GTCAACCTCAATAGCGAAATCAAAAGCGAAAGCATGGAAGCATTGAAAGA
ACGTTTCACAAACTCCAGAGATCATCTTCCACACATGGTTGTCATGACTC
CCTATGATGTAGATGGTACCTTATGGACAAAACAACAACCCTCACCGCAG
GTGGTGAAACGGTTATCGTTGCTCGCTCAAGCGGCTTTGGCACTAGTGGA
AAGCGATGGTTTTGAATTTACACAACAAACTATAATGCAATTATTTCGTC
CTTCCACAAAAGATTATGATATCGTTATTGAGTTGGATAAAAACCATGTG
CCGAAACTACCTTTCATCCAATCTTCAAAAAGTGTCCACAAATCGTCTGA
TGTGAAATTAGCATCAATGGTGTCGAACAATGTATCGAATGAAGTCCTCC
CTGTTGTCGACTTTGACCCTGCTCGCTCGTTCCTCGACCAATTACAGGAA
CTTTTCAATGATACCGCTATGTTCTTTTGCGATCAATACGGGGGAAGTCA
AATTGGTGTGGTGTGGAAACGAAACAAACTCGCTGCTCAACCTTTCAAAA
TAATGAACGCAAAATACAAACATGTCGAAGAAGATGTCgcacaaaagaaa
aagaaaaaacagaaaGCTAAAGATACAAAGATCACAACAAACGAAGAAAC
AATGCTAAAAACGAACACTAAAGCCATCATCCAAGACTTTTCAATCCTGG
GTCAAGGTTTAGTAAAGAATATACAAGTAGTGAATCAAGTGTAAAAATGT
TTTCCTAGTAAACTTTGCAAATCTTTATctcgtttttactttttttaaac
aaatgacAGCGTTATTTACTGccttttttttaaaccttttgtAAATCCTA
AGGATATTTTCTATGTTCATTTTCTTTACAATTTACAAATAGAGTTTTGA
CAAATGTGATGTGATGACATAAACATGAAGAGACAATAGCATGTGCCAAT
AAGTagcaaaattataaaaataaatgaataaatttaaataaaaagaataa
aaggTAATCATAAATTACTGTATTACAATATTTACAACGATTTTAGTTGT
TCACCACAACTTACTGATCATGTGTCGCGTCTTTCACACATGCACTTTCg
tcgaaattaaaaaaaggcaCTAAGTAtcacaaaataagattttttaacgC
GAAGTGGCTTCTTTTTTTCAATGGAAAGGTTTTTCGTCATTTTTGTTATG
GTTCTTCCAACGTCGTTTACATCGCATGTTTAGTTGATGTTTCGGTTCGG
AACTATCGGAGTTGCTGAGTCTGAGGGCTGATTCAAGCTTCTGCGGACTT
GGGCTGAAGCTCAGTTGCGGAGGGTGTAAcctaaaatgaaagtaaaagaa
gaaattatgTAAGGATCTTTTTATGTACTATATTATTCTTTTTCATGCAG
TTTTGTATGTTGATTTCTTTAAAATGACTGCTTTTACGTGGTTGTtttgc
tttttgtgattgatgGTTTTTGATGTTGTTGGTTGTTATCGGTTCCTCGC
CACGCGGTATGAACTAATATGCGAGATGAGCAAAAGGAATCAGAGTTATA
GAGTCTCGAGTATAGTtaccttttgtttctttttgatGACAAAGATGTAA
ACGACGACAACGACCACCACAATGATTGCCAATAGCAACAAAACGATCAA
CAGAATCAACCATGTGGTATCTTCATCTTCTTCAGTGGAGGACCCGCCAC
CGTTCTGTGTGTTGTGGTAATTCGTTGAACCTGAGTAAGGAGTCATTGAC
GTGGTGTCTGTCCCGTCGCCTCGGTACATATAATTTCCGCTGACTGGCTG
CAATGTCTGTGATGTCCCGTTGGATGTGGTGATCGTTATTTGCAGTTGAT
CCGCTTCTGCTTTGGTGTACAGAACATCGAAGGCTGCATCAGTCTCTGAT
GGTGTTAAGAATACCTCAAAAGTGACTTTGATACTACCTTCTGAGACATT
ACAAGCAGTCAACGGGACGCCTATTTGATCTTCTGTTTCATTACAAACAG
CAGTTTTAAGTGCATCGAATCCCATTTCATCGACCCAAGCGTTGTAATTG
GCATCGAGGTATACACTGCCTCTTGATACTTCTTTTGCTGGTTCGGTTGT
TGCGTCTCCATCAGCTTCAGTAAGTTGGGCACTTGTAGATTCAGTGACAG
TAACCTCAGTAGTTATCATCTCCGTTGTATTGAAAGCGCTTCCACTCTGT
GTCGGATCCACATCGCCGCCATTATCCGCCATGGTTGTAGTAGCATTGTC
CCCGCCGCCACTTGTATCGGGGGCCTCAGTAACAGTAGAGTTTGAGTTAC
TTCCGCCAGAGTTATCACCTCCGTCTACTGTTGAATTACCCCCAGTTGGA
TTCTCCGTATAGCCTCCATAATCAGTTGAGTTGGTACCATTGGTAGGAGG
ATTAGTTGAACCCCCTCCATTTGAAGGGTCGGTTGAGTTACTTCCAGAGT
CACCGGAATCAGTGACGCCAGGGTCAGAGGCTTCTGTTGTTGTGGCAACC
GGGACACATCGACTCACTGTGGTATAAGTGACGTTTGATGATGTACCATT
GGAAGAGACAGTATCATTGGAAGAGATAGTATCATTGGAAGAGATAGTAC
CATTGGAAGAGACAGTATCATTGGAAGAGACAGCGATGGTGAAGTTCTGC
CAGACACAGGGTGTTGCGGTGGTTTCTGCGGGTTGTTGTGGAGCTTGTGT
GGTTGTGGAGACAGTGTCATTACCAGTGCTGTTGGTGGCACCCTCAACGC
AACACGTATATAACACCAAACTAAAAGCTATATGAAAAGATAGCAGTCAT
TTAAATTGGCGTTGACGACTAAAAACCTGAATATTATTCCAGTTATGTAT
AAAATTTAACAGGTCCCTACTCCTAAGTTTTCTAAATCAACCTTTATTTC
GCCCGTCTTAAAATCCAAAACTACGTGATACCAACCCagcaggcacacaa
cgttgtttcaacgtttatctaacgttcacaacgtccatatatcgttagat
gaacgttaaaacaacattATGTGCCGCCTGGGAACTTGTGCTTTTAGGTC
GAAAAAATCTGATGCCCGCCCCGGGTATCACTCACACCGGGACAatattt
ttggctgattttccGACTAAGGAGGGACATCTACCGGGACCCTTCATCAG
GCTAATTAAAAATAGAAATGATGAATGAGTTGGAg
Run BLAST on NCBI

protein sequence of TCONS_00002157-protein

>TCONS_00002157-protein ID=TCONS_00002157-protein|Name=TCONS_00002157-protein|organism=Clytia hemisphaerica|type=polypeptide|length=1022bp
MKGKFCFHTPSEIKVVGSFLLKTMIKANHSIDIAVQMPQAVLHGKDYLNY
RYYYKRAIYLSWLAYYLKDWEHTEDLSFTCGTNIFKPTLKINLKGKVGKK
FNVVLHLATPEGHFKLSRFLPLKNNIRHNWYHGYEQDTTEEIEFPTADYN
NGVLEDMLYEDHLRLLYSTLKECPGMSEAILLLKTWLKQRSYKGNVPFNG
FCCSMLLVYLLSVRKISAHMSSYQMFRLTLHFIGTSDWSKEGITLNKDTN
EDEKLPSLKDFHGVYPVVFVDSSGHLNLCSSLDTISYQMLRYEAQQSLAL
LDSTEEGSFELLFIKTKSFLQTVDHMFRINDAGSFTTKLSTEENNKLISY
GGNARPILLEKMSEILRRGLDERITSLFMKPSPLVQWSVNESCPDSSKGP
ITVGVCLNASNYDNVLIMGPPADQPQAKEFRAFWGEKSELRRFQDGSINE
AVVWPSSNSSQKKMVCKQIVQHLLKLHCAIYPSSIDYHGNSFDFILSSNT
SSFEHASANQKKATIPRGCGEEESTHVIKTFEELSRQLRGLSELPLVVNN
IHAVDPLLRMTEPLTARQYEVKEQSKGQDFLVPSNAKRSPLWCPVIKAYI
QFEGSGQWPDNLEAIQHIRAAFHIKVAECIRQQLHFPAKATPRWIDVMKN
GYVFRLSVIHYREMVLHKENVALGKSKTSHDIQAKKLEMEIVKKPLHNSL
IHSLNGQFGAFSLTCRLAKRWMSSQMLSNHFYEELIELLVASVFLSPNPP
NSSLCGFVRFLDHIATFDWNANPLIVNLNSEIKSESMEALKERFTNSRDH
LPHMVVMTPYDVDGTLWTKQQPSPQVVKRLSLLAQAALALVESDGFEFTQ
QTIMQLFRPSTKDYDIVIELDKNHVPKLPFIQSSKSVHKSSDVKLASMVS
NNVSNEVLPVVDFDPARSFLDQLQELFNDTAMFFCDQYGGSQIGVVWKRN
KLAAQPFKIMNAKYKHVEEDVAQKKKKKQKAKDTKITTNEETMLKTNTKA
IIQDFSILGQGLVKNIQVVNQV
Run BLAST on NCBI

transcript from alignment at sc0000018:762016..792515-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00002157 ID=TCONS_00002157|Name=TCONS_00002157|organism=Clytia hemisphaerica|type=transcript|length=30500bp|location=Sequence derived from alignment at sc0000018:762016..792515- (Clytia hemisphaerica)
CCTTTATTGAATTCTCATAGTGATATGTTTGTAAAAAATCTGTGTCGGGT TTGAAAAATCAAAATGAACGGTCGCCAGCCGATGATGAATGCAACAATAA CAAAGTCCAAAACAGGATCATTTTCAGCCATACATAACACCACAAAAACT ACTCAGATTGTTTTCAAATTTACACTGTAATTTTAATTTAGTATTCTCTT TTGAATTTCAATGGCTGCGTGTTTGAAAGTTTCATTGTCAAGTTTGAAAA TCCAAAAGAGACGACCACCAATATATCATCATGAAAAATGACATTTTGAA ATTCCTTTCTCTGAAAAGTACTTTTACCTCATCAAACTCTGCCCCGTGAT TGGTTTGTAAATTTTTCACTGAGATTTGCCAGAATTTGCTACACAGTCAG CTAGTCCACTTTCAGCAGCCATCTTTTTCTAAATACTTTCTGCCAATCAA ATCACAGTATTATCGGAATCAGATAATCCGTTTTTATTAAATCGGAATAG ATCATCGGATAAGGTAAACAAACAAAAAATGTAATGACCATCGTCGGACG AGAGAGAATTTAAGGCTCCTAGGCCGGAGCAATAAGCTCTTGTCTTTTTT ATCAAAAATGTAAAAAAAATGAGGGGAGAGCATGGCATACTTGGAAAACC AAGTGCTATAATATGACCTGAAGTAATAATTTTAGTTTAGCATAATTATT GAAGTATGAAAACAATGAAAAGAAAAAGTGGTTCTGATGGAGCTGCTAAA GTCAAGTTTAAGAAGAAAAAACCTCCAACTGATGAAACAAAGGTTTGTTT TTTATCATAATCTCCTTCAGTTTTCTGCAACAAAGAATTTCCTCCCACCC TAGATTAACTTTCTGGTAAAATATCAGTGTTGTTAAACTGTGATTTTGCA AACAAGGTTATCAAACTGCACACTGAATATGGGAGAAAAACTATGAATGA GAAAGGGTCTTTCATTGCATTGTCAAGATAGTAACGGGAATATTTTAGTT TAATCTTTGTTTATCCTCCCTTCCCTTTAAAGGTCGCAAGTTTGGAAGAA AGAGAACATCAAAAGACGTCCATCTACAGAGCACCAACAAACGATGAATT AACTCAGTTGAAAGAGAATGAAGATCTGTACAAGAACAACATATTTCGCT TACAAGTAAAGCCAAGAAACATTTAACCAACATTATTTCTATTCTTTTTA TCTTTTAAGCGATTTTTTAGCGAGTAGGAAATAATAGCAGTGGAATGATT CTGAAAAATCCATCCTTAGGTCTGTCAATCCTTCAAAACATGATATTTAC AGTTTTTACCAGTTTGAGAAAGGCGATATGCAATGTATTATAATTATATT ATTATCTGCTTTCAGATTCAATACCTGCTGGAGGAAGTTCGTTTACAAGA AAACAAACTAGATCAAATCAACACTGTTTTGCACTCCATAAACAGCTTTT TGAAGCAATTACCATCACAAACCCAAGAGTATGAGGTAAGTAGAAAAACA TATCGTATAAAAAGCAGAGGCTGTAATAATGGGAATATTATCTGCAATTT GTTTGTATCCAAGTAAGGTTTCATTTGGAGAAAATAATTAGTTCGAAAGA AGAAAGGAGCCTTTTCAGAATCATTGAAGATGTCTGATTTGCCCAATAAA TAAATCCTTGATTGATTACTACAGGTATGTAATAACAAACCATTACCCCA AACCGTTACTTTTCAATATAATTTTGTTTTCCCCTTTCAGCTTTCATCCA GTGATGCTTCACCACAAGGAGTTCATGTTCCCTTCCCAGATATCATCAGT CAATCCAAAATGAAAGGAAAATTTTGTTTTCACACTCCCTCTGAAATCAA AGTTGTTGGTNTATCATCAGTCAATCCAAAATGAAAGGAAAATTTTGTTT TCACACTCCCTCTGAAATAAAAGTTGTTGGTAGCTTTTTATTGAAAACTA TGATCAAAGCGAATCATTCAATTGACATTGCTGTACAAATGCCACAGGTT TATATTTCCACTAAACTGTGACTGTTTTTAGAATTTTTGTCAGAAGATTT GTGGAAAACTTGCAAACATTTAGTTTTCCGTAAGGGTAACCCACAAAAAA AACCATTATTGTGCTAATGTTTCGATCTTTGAAAAGTAGGCGTCCCTATT TAAAATTTGAGGTATTATTCTTCAGTTCTTCAGATATATTTGATCTTTTG AAGTCCAAATTCACTGATGATGAAGTTATTCTTCTGTTTTTTTCTTAGGC TGTGTTACATGGAAAAGATTATCTGAACTATCGTTATTACTACAAACGAG CTATATATCTTTCATGGTTGGCTTATTACTTGAAAGATTGGGAACACACA GAAGATCTCTCCTTTACCTGTGGAACAAATATCTTCAAACCAACTTTGAA AATTAATTTGAAAGGTATCTTAACATCTTTTTTTTCAGGATAGACATTGT GATAGAATGTGGCAGCCACTAATTTCAACCTTGCAATCTATTGTGTCATT TGACTAGGTTTAAAGTCGTACAATGACTTTTTAGAGTTGCTCTTCAAAAG TCAATTCTAAAAGCTATGAAGCTATTATCTTATTAATTTAATTTGTTTTC CCTGATGAGTCACTGTTGAGTGTGTTTTCACATGTTTTGATTTTCAGGGA AAGTTGGGAAAAAATTTAACGTTGTGCTTCACCTAGCTACACCCGAAGGG CATTTCAAGTTGTCACGGTTTTTACCGCTGAAAAATAACATAAGACATAA TTGGTATCACGGCTATGAACAGGATACAACAGAAGAAATTGGTACAGAAA TTAATTCCCCATTCGAATTTCATTAGAACTTTTTTCACTTAACTTTCAAG TTTTTTACATAACTTTTTTATTGATATTTTCATGCGTTTCTGGTTATCTT TAAAAGCATTCCAAATACTCCAAATCGACCTCATACGACTTCGAATTTGT TCGAATAACAGGGAACTTCTAACTAACAGTAAAACATATTCCAGGAGAGG GATTTGCCTTGGCAGAGATTTATTTGAACCAATTTTAGTTGTATAAAGCT TAAGTCCCCTGTAATTTGTTCCTTCAAAGCTTGTTGGTAACTCTTGTTTT TATTCAATTTTTTGTTCCAACCTTTTCAAACAGAGTTTCCAACAGCAGAT TACAACAATGGAGTTCTGGAGGACATGTTATACGAAGATCACTTACGATT GTTGTACTCTACTCTCAAAGAATGTCCTGGTATGAGTGAAGCCATCCTAC TCCTCAAAACGTGGCTCAAACAACGAAGTTACAAGGTGATTAACACTTTT TTTATCAAAACATTTTTGGCGTAATGCTAAACCATGTTTTTGTGTTTTTT CTTTAATGAAGTAGTAGTAATTAGATTGGTAATAATGATAAAATGTTATT GACAATCACAGTCGTTTCTTGAAATTTATATCTCACTATACTTTAAAACT ACTATAGATTTTTAAGACTCTTCGCCGGGGGCTAAAATTTCTTAAAATTT TGTTGGTGAATTTCAAGGGAAGAAATATGAAAAAGTCTTGTGCACATTAA CCAGCAAAGACTATAATGTTTATGGAATTCATTCCGTAGCATTTTAAATG TGGTGAAAGCTTTTATCATTTTGATCCATCTTTTAGCAAGCTATGGAGCA GTAATGGGCATCTTTTCTATATCTTTTTAATTTATTTTTGTAGGGTAATG TACCATTTAATGGGTTTTGTTGTTCAATGTTGCTGGTGTATTTGTTGTCA GTACGAAAGATTTCTGCACACATGAGCTCCTATCAAATGTTTCGACTTAC TCTTCACTTCATTGGTAAGTTTCGTTTTCGTTTTATATAAAATAGGAAGA TGCTCAAAGGGTTTAAAGTCAGCCTCCATATAATGATAAAAAATGGTACT TATTCACCAAGAGTATCTACTGTTTTTTGTTTTATCCCTTTTTGGACCTA CCTCCGGGTACCCCGGTGGAGGTTCTATAAATTAACCGTTGTCCGTTCGT TCTTTCGTTCGTTCGTCCGTCCGTTCGTTCGTCCGTTCGTCTGTTACCAT CTTTTCTCGATATTGGCTCATTAGTTTTTTCTGATTTTTGGCACAAAGAT GCAAAATGGCAATGGCCAAAATGTGACGGAGCCCGATTTTCGGAAAAATA AATTTCCGGCCAAAAGTGCCGGAAACATGCCGGAAATCGCCGTTTTCTAG ATTTTCATCGGACTTTTTCCTCATAATTTCATTCAAAAACATTATTATCA GCAATGCCCACCATCAAGCATGTTTCAATTTTCAATAAAATTGAATTTTG ATGCTGGAACTATTTAAAACTCGCCTGAACAACCTATTTTCGCCGGAAAG ACATTATTTCTTGAATTTCTCGAGCTGTACTTTATATTTTTTTATGAAAT TTTGCACACTGATGCAAAATGACAATACCTAAAATGTGACGGAGCCCAAT TTTCGAAAAACATTTTTTTCCGGCCGAAAATGCCAGAAATATGCCGGAAA AACCGGTTTTTCGACATTTTCTCGAATTTTCATCCTTAGTTTTTTCTGAT TTTTTGCAGAAAGATCTGGAAAGATACGTATTCGCAATGCTCAAAACATG GCCGAGTTCGATTTTTGAGAAAAACATTTTTCCGGTACAAAATGCCGGAA ATCGCCGTTTTTGCAGATTTTCATTGGATTTTTTCCTTATATTTCTATGT TTTTTTCANCCCCCCCCAAAGGGAGTCTGCAGCGGCCGACAAACCGTTCC ATGTAGGTCCACCGTGTATTTTTCCATTAATTTGATGCAATACAAGGGGT TTTAACTGTTTTGAGACTACTTATGTCACAGATTTATGTCATTAAAAAAT TTAAGTTAAGTTTTTGTAAGTCGGGGTGCAAATCCCTGCCAGACAGTTAC CNCTGATTTTTGCGACCAGAACTTTCTATTTATTTTTTCCCTACAACCCT TCCCTCTCCCCCCATCAACAATCAATGATGAATTTATTGTGTTATGTATT TTCGTTAAACGCTATATTTTCTGACTATTTTTTTTCATTTTTCTCCTCGC ATTGCTATCTAACTTTCATCATCAGGTAGGTCCATTGAGCATCTAGCTTG TTTGGGAGTGATTTCCATCCATACTCCTCAGCAATCGACCAATTATAACC AGAAAATTTCTTAAAAGTAAACCAGAGGTCTTCCACTGGACCTACTTTCA TATTTCTATTTGGTTCATATTACCGAGACTTGCATTAGAATACTTAACAT CTTTTTGTTCTTTCCTCTTTGGTTCTATGAAATGAATAGTTCTTACTGGT TGGTCACTTGGCATCAGGGGGGTGGGAGGGCAAGCAGTTAATACACAACA CTATGTGTATTAACTGCTTTTTGAAATTTTTCGAAAGGACCACCACCCCT TGACACTTAGTACACTGTGTATTGACTGTTTTTTACCCATTAAATATATC CCCCCCCCCCAAAGGGAGTCTGCAGCGGCCGACAAACCGTTCCATGTAGG TCCACCGTGTATTTTTCCATTAATTTGATGCAATACAAGGGGTTTTAACT GTTTTGAGACTACTTATGTCACAGATTTATGTCATTAAAAAATTTAAGTT AAGTTTTTGTAAGTCGGGGTGCAAATCCCTGCCAGGGGCCTTAGTTACTT AAGCAATGCAACAGTTAAAATTTTTAGATTTTGAGTAAGCAGAAGAAGAT TTTGAGGTTTTCCAGTTGCATGGTTGCTTAGTTTTAAATTCATAGGAAGT GCCAAATAATAATTTTAAAGAACTCTTCATGTAATCAGATGCGAACAGAA TTGACCTCAAACATGTCAAAGTTTTTCTTTCTACCATCTTGCTTTTTGGA CCTACCCCGGTGGGGTGGAGGTCCTATAAATTAACCCGTGTTCGTTAGTT AGTTAGTTACCAACTTTTCTCGAGCTTGGCTCATTCAATTTTTCTGATTT TTCGCACAAAGGTGCATTACTATAAACCCTCGAATGTGACGGAGCCCGAT TTTCGAAAAAAATTTTTTTCCGGCCGGTAGAACCGGAAATGTCCCGAAAA AAGCGGTTTTTTGAGATTTTCTCGAGATTTTATCATTAGTTTTTTGCGAT TTTTTGCACATAGATGCACATTAGTACTGCCGAAAAGGTGTCGAAAACCG TTTGCCGAAAAAAAATTTTTTCCGGCCGGTAGAACCGGAAATGTCCCGAA AAAAGCGGTTTTTTGAGATTTTCTCGAGATTTTATCATTAGTTTTTTGCG ATTTTTTGCACATAGATGCACATTAGTACTGCCGAAAAGGTGTCGAAAAC CGTTTGCCGAAAAAAAATTTTTTCCGGCCGGTAGAACCGGAAATGTCCCG AAAAAAGCGGTTTTTTGAGATTTTCTCGAGATTTTATCATTAGTTTTTTG CGATTTTTTGCACATAGATGCACATTAGTACTGCCGAAAAGGTGTCGAAA ACCGTTTGCCGAAAAAAAATTTTTTCCGGCCGGTAGAACCGGAAATGTCC CGAAAAAAGCGGTTTTTTGAGATTTTCTCGAGATTTTATCATTAGTTTTT TGCGATTTTTTGCACATAGATGCACATTAGTACTGCCGAAAAGGTGTCGA AAACCGTTTGCCGAAAAAAAATTTTTTCCGGCCGGTAGAACCGGAAATGT CCCGAAAAAAGCGGTTTTTTGAGATTTTCTCGAGATTTTATCATTAGTTT TTTGCGATTTTTTGCACATAGATGCACATTAGTACTGCCGAAAAGGTGTC GAAAACCGTTTGCCGAAAAAAAATTTTTTCCGGCCGGTAGAACCGGAAAT GTCCCGAAAAAAGCGGTTTTTTGAGATTTTCTCGAGATTTTATCATTAGT TTTTTGCGATTTTTTGCACATAGATGCACATTAGTACTGCCGAAAAGGTG TCGAAAACCGTTTGCCGAAAAAAAATTTTTTCCGGCCGGTAGAACCGGAA ATGTCCCGAAAAAAGCGGTTTTTTGAGATTTTCTCGAGATTTTATCATTA GTTTTTTGCGATTTTTTGCACATAGATGCACATTAGTACTGCCGAAAAGG TGTCGAAAACCGTTTGCCGAAAAAAAATTTTTTCCGGCCGGTAGAACCGG AAATGTCCCGAAAAAAGCGGTTTTTTGAGATTTTCTCGAGATTTTATCAT TAGTTTTTTGCGATTTTTTGCACATAGATGCACATTAGTACTGCCGAAAA GGTGTCGAAAACCGTTTGCCGAAAAAAAATTTTTTCCGGCCGGTAGAACC GGAAATGTCCCGAAAAAAGCGGTTTTTTGAGATTTTCTCGAGATTTTATC ATTAGTTTTTTGCGATTTTTTGCACATAGATGCACATTAGTACTGCCGAA AAGGTGTCGAAAACCGTTTGCCGAAAAAAAATTTTTTCCGGCCGGTAGAA CCGGAAATGTCCCGAAAAAAGCGGTTTTTTGAGATTTTCTCGAGATTTTA TCATTAGTTTTTTGCGATTTTTTGCACATAGATGCACATTAGTACTGCCG AAAAGGTGTCGAAAACCGTTTGCCGAAAAAAAATTTTTTCCGGCCGGTAG AACCGGAAATGTCCCGAAAAAAGCGGTTTTTTGAGATTTTCTCAGTTTTA ATTTTCTCTGAATGAGTGATTAAAGTGTCGATATTATTTTTCTTTCACCG TTAAACATCGATGCGTTTCTTAATTGCTTTCTCCGTTCCAATAGATATAT AAATCGAAATTTAAAATTATACATTACTTCCATTAAATTCTAATTATTCG TTTTATAAATAGGTAGGTCCATTAAAGTATTACTTGTTTTTCTTTTTTTT TCTCCCGATCGAGATTAGATTAGAACATCATTTTCAAATGTTTTTGATTT AATCGAACGTCTGAATTAAATCGAACGTTTGATTGAAAGGAATTGAATGT TTACAAAATGTGATGCTGNTTTTTTTTTTCTCCTGATCGAGATTAGATTA GAACATCATTTTCAAATCGAACGTCTGAATTAAATCGAACGTTTGATTGA AAGGAATCGAATGTTTACAAAATGTGATGCTAAGATAAAGACATAAAAAC TTGGGTTTGATCTGGCTTGATGCAGCTTGATGTTGAGTTCTAGAGAAAGA GCTAGCAAATTTTAGTTTTACAGTTAGTTGCAGTTAATACACTTTTTGAC TCTAAAATTGTCTTAACACCATCCCCTTTGACAGTTAATACACTGGTGTA TTAACTGCAATTTGAAAATTTCGGAAAAGGACCCACCACGGTACTAAGTG TCATAGGTGCCGTTTATTAACTGCTTGCCCCCCCCTGTTGGCATCAATAA ATCAACATAAAATTTAACCAGCAGAAAATATAGGGCTTTCACTGACCGAG AAGGAAAAATATTCAACATAAAATGGTATCGAGGCCCTTGTTATACTGTT ATTCAATTTGTTGTATATTGCTTGCTATTGTATTCGGTCTATAGGTACAT CTGATTGGTCGAAGGAAGGAATCACTTTGAATAAAGATACCAATGAAGAT GAAAAGGTTTCATTCTTACTTAAATAGATTTGATTGAAAAATTCATGTTA ACTTATCAATGTGTAAACTTCCCACTGGCTGCTTTTAAACCTACGATAGA CAAACAGGAACAAAAAGGACAACATCACTTCATTTCTCTCTTTTGTCTTG TTTTAGCTGCCATCTTTAAAAGACTTTCACGGTGTATATCCGGTTGTTTT TGTGGACTCAAGTGGTCACCTCAACCTTTGCTCGTCACTCGATACCATCT CCTATCAAATGGTAAGTGAAAAAGATATTTAAGCTTGGTACTCACTTGTT GAAAAAAGTGGCGATTAACACTAGTTGCACTTGTCGCAAAATCTAAAACC ATAAAGCAACAAAAAGCCACATAAACTATAGCGAGTACACACAGAGAAAA GTTGCTTATGCTATTTTTTTTGGATTTAAAGCCTACAATATTACCAATGA GTGTTTTTGTTTCATTTCTGGATATTTCACAGTCTGTAAAGCGTTGGGCG AATTTTTGAACGATGTTCTTTTGTCTCGTCTTTTGTTTTTAGGTACCTTT TCTACTAAAAATGTGTAACATTGCCATAATTAATAATTAAAAAAAATAAA AGTAGCTTCTAAAGACGAGAGTGAATAAAGATACTTTGCCCCGAACTAAC TATTTAGTAAATCTAGATTTAGAATGTCATGGTTAGATTTAAAGTTTGCT TCATTTCGAACCAGTAGAATGGCTTATTTTCTTTCGGTGTGTAACAAAAC TGTAACGTGTTGTAGAAACTAATTTGTTTTCGTTTTTACCTTTCCATATA ACTCTACGTTTCAGTTGCGATATGAAGCTCAGCAATCGTTGGCGTTATTG GACAGTACTGAAGAAGGCTCCTTTGAATTACTTTTCATCAAAACCAAATC CTTCCTTCAAACCGTCGATCATATGTTCAGGTACGGATCAGACGTAATCT CGTCTCGCTTTCATTGATCTACATTCGCACTGTCCAAAATTGTGGAAGAT ACAGTATTTTTCTACCTTAAGGGAAGAAATTTTCGCGGAACGAATTTTCG CGGAATTTAATTTCGCTGTTTTTTGACAAATCCGCGAAACAAAAATATTC TCATGATTTGAAAAATCAACTAGAGAATTGGTGTTTTTGGGGCAAAAGCC ATATTTTAAACAAAAATTCCTCTCAACTTCGAAATTAAATTCCGCGAAAA TTTCTTCTTTTTAAAGGTAGTTAAGCTTTAAAACTTAGTTATTGCCACCG TTAGAATAGGCTGCACGCATCCTTCTAATATGATTTGATATAGGGGATGC GTATCGTCTACAATATTTATGTCCCAGCTTACCCCTGCCTTTTCCTTTTT GGACCTACCTTAAGGTAGTCCTTTAAATTAACCCTTGTCCGTTCGTTCGT CCGTTCGTCCGTTCGTTCGTTCGTCTGTTGCCAGCTTTTCTCGGGATCGG CTCATTAGTTTTTTCTATTTTTTTGCACAATGATGCAAAATGGCAATGCC CAAAATGTGACGGAGCCCGATTTTCGAAAAAAAAATTTCTNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNATTGGTTGTTTTTTCATTCAAAAACATTATTAATAGCAATGCCCACC ATCAAGCATGTTTCAATTTTCAATAAAATTGATTTTTGAAGCCGGAACTA TTTTGAAAGTCGCCGGAACAACCTATTTTCGCCGGAAAGACAGTATTTCT TGAATTTCTCGAGCTGAAATATATATTTTTTTATGAAATTTTGCACACTG ATGCAATATGACAATACCTAAAATGTGACGGAGCCTGATTTTCAAAAAAC ATTTTTTTCCAGCCGAAAATGCCGGAAATATGCTGGAAAAACCGGTTTTT TGACATTTTCTCGAATTTTCATTTTTAGTTTTTTCCGATTTTTTGCAGAA AGATGCGTATTCGCAATGCTCAAAACATGGCCGAGTTCGATTTTTGAGAA AAATTTTCTTTGATTGGATGTGAGGAGATTATTTAAATTCATGCAACTTT TGGTTACCCCAAATTTTAGATAACTCTCGGACGAGAATTTCCTACACGAT ACGCACCCCCTATATCAAAATCAATTCTGAGTATGCACGCAGCCTACTGT TAGAAGAGCTTCGAAAAAATATCGTTTTGGACGTATAAGATAATCGATCG TTAATAAGTCTAACTTCAGTTAAAATTCATTCTTTTAATTGCTTTATTCA TATTTAGAATAAATGACGCCGGCTCCTTTACAACCAAATTGTCAACGGAG GAAAATAACAAGTTGATAAGCTATGGTGGCAACGCGCGTCCGATTCTGTT GGAAAAAATGTCCGAAATTTTAAGACGGGGATTGGACGAAAGAATAACGA GTCTATTTATGAAACCCTCGCCTCTGGTTCAGGTTAGTCCTCTTTTGATG AATTTCAAAATGTTTGAAAATATGAAAGGCTCTATCTTTTAGTATCAGAG ATCAAATTGCTTATATTTTTATTGTATAACATACAAGCCACTCTGCGAGA TATTAAACCCTTTCTGATCGTCATTTGACCTACCTTTTTTATGTTTTTTG AGAATTTAGCTCAAAACTTTCTATCTATTTAAAATAAATATGTAAATCTC TTTGAGTGCTGTAAAAATAATTTTTTTTCATTCTCAGTGGTCGGTGAACG AGTCGTGCCCAGACTCTTCAAAAGGACCAATCACAGTGGGAGTCTGCTTG AACGCGTCCAATTATGACAATGTTTTGATCATGGGCCCTCCTGCTGATCA ACCTCAGGTACTCCTTATTTTTACATATATGATCTAGAATGTTTCAAGTT TTTTTTACTTTCCTGATTATAAATATGACTAGATGGCCAAGTTTGTGTAG GTTTTGATTTTAAATTTAACTTCTTCCAGGCTCAGTATTATACAACCAAT GAGCAAGATGCAAATGCACTTTATCGTAGTTTCATTTTTCTTTATATGCA AAATAAAAATTCGCAATCGTTTTAAAAGACCTTCTATATATACATAAATT ACAATCATTGAAGAAAGCTGTTGGCCCAGAAATATAAATACACGAGATCA TATTATATCACTAGTGTACTCCCAGTTCATCCGTTGTGCTAGCTCTTTGT ACATTGAAGAAAGCTGTTGGCCCAGAAATATAGATACACGAGATAATATT ATATCACTAGTGTACTCCCAGTTCATCCGTTGTGCTAGCTCTTTGTAAAC TTGACTGATGTTGTTGGTCCAGAAATATTGATACAAGAGATATTATCATC TCCTTTGACATTTTCAACTGCACTTAATCATAATTGATAGTCGATACTCA AACGTTTTACTCCTTGTTGAACTGTCGTCAGATTTGCGTAATAAGGGTCA TTACGGAAACTGGTCTCGCTCACCGTGGACATGTGGCGGAGACCGTTGTT TGTTTTCGGGCTGATACTTGGTGAAGAAATAAACCGGTTGGTCATTACTA TAGAAACTTCTGTGTTTGTTTGTTCTTTGGTGTCTGCCCTGTTGTCCGGT TTCGAAAAAAGCGTTTTCATTTTCATAGCGTACTGTCCTATTAAGTTGAC GAAAACTATGGCTTGAAACGTAAATGAGACCACATAGATTTGAATGAACG GTCTCTCAATGGTCCCATCTAAGATGAAAATGATGGAGAAAGCTGCGGTG GCAAGAAACAAAGTGATATACATGGTCACCCCAATGCTTTTGATTTCACT GAATGTCTCTGGTAGGTTTCGCGTCTTGAACGCCCAGAACGTGCACGCCA CCATGAGAGCGATGGGGAAGATGAGGTTTAGGGCGGCGCCCGTTCCACTG ATATTGCATTGTTTTATTACATAATCACGATCAGCTGGATAGACAGTCTC AATGATTGGTTGGTCTGTCAGAATCCAGAATACTCCCATTAAAAGTTCGA TGCCAGCCATGGCCAAGATGAGGAGGAATTGAGAACGCATGCTGACTAAC ATCAAACGTTTCAACTTGAATTTGCTGGAGCTGGCAAAAATTCTATAAAC GCGGTTCGTCTTCAAAACCAGTGGTGAATAACAGCACGTCAATGATAGTC CCACGAATATCTTTTGTCCGTAACAAATCAAAATGTTGGGCTCCATCGTA AAAAGAATGGGCACGAGCAACATCAAAAACAAACCGAACAAGGAAAATAA AGCTAACTCTCGACTGCTCGATTTGATGATATGTGATGAAAAATGGCGCA TGTAAACAAACAATACTGCCATGACGATGAAACAACCGAATGACGTTAGA AAGATGACGATGACGGACAAGTCGTTGTTGTGATTCATGGTAACCAGGGG TAACTGGTCGCATTGCGTTTGCTCTATGTTCGCTTTGTATCCAAGCTCAC AGGGTTGGCATTTGTTGTTCTGGATGATTTGGTGTACGGGACACTTCTTG CAATGCNATCCAAGCTCACAGGGTTGGCATTTGTTGTTCTGGATGATTTG GTGTACAGGACACTTCTTGCAATGCCAACAACAGCTTGCCAAAGCGAGGT ATTGTTTGATTTCGCGCTCACCGCACGGTAAACTACACCTTGAGTCGGTC ATGTTTAAACCCTCGTTCAAAGTCAATGCAAAAGATGTGTCTCTTTTGTT TGCATCCCAATAACCGATTTTCTTAAATTGAAAGCTGTCATTTGTTTGTA CGTATTGTAAAACATCATAACTATCCACTACTTCGTGGAGAGGCGAATTT CTTGAATAAGTCCTGTTGAACAATTTGAAACGCACATGTGGGATGTACAA ATTGAGGTTGCTTTTCATATTGGTCCTCATTTCCTTTGACATAACGCCAT AACAAATTGAAAAGGGAAGCAAAGGGAATTTTTTACTACAATATGTTTTG ATTCCATAAACGGCCGTATACATGGCACTAATGATGGGCCGCACCGGCGC AAACTGGTTGAAGCTCTGACTTTTACTGATGTCACATTTTCGATATCCTT TTCGGCCGTGCAGCGTGCAATTTCGTGTGAATTCCCAATAGAAGTTGAAA AAAAATTCGTTGCGTCTGTTATGACCTGGTTGGAGATTTGCGAAGTATTC TTGAAATTCTTTTGGTTGAGGAAGGGTTATCTGTATACTAATCATGTTCT TGAAGTAAGGGCGGACCATGGGTGGTATATTTACACCAGCACTACAGGCG GTTCCNGGGTTATCTGAATACTAATCATGTTCTTGAAGTAAGGGCGGACC ATGGGTGGTATATTTACACCAGCACTACAGGCGGTTCCCAACACAAATTG TTTACTAGCCAATCGCTCTTTAAATGGGGCGGCTGCTTGAAAGAAATCAT TACATTCTTTAAAAGCGAGGAAAAGAAACACAACCTTGATTTCGTGTTGT TGTAGAACTTTCTCGATAGTTATTTGATAACTCGCTTCACTAGCTCCACT TTTGATGTCATTTTGTGATGTGCAATACCCAATGTTGAATAGACGTTCGA TAGTTTGCACCATCATTGAGTTCCCGTCCTCATTGGAGGTGTAAATAACA CTAGTGTACTCCCAGTTCATTCGTTGTGCTAGCTCTTTGTACACTTGACT GGAAGTATTGTCTGCAGGGACAGTGCTGAAAAATTTTGGAAAGTCTTCTC GTTTCTCGTAAAAATGGTCGGAAGAAGCACCGTAACTGATCATGCTGTAG TCGAAAACGGAGATGAATTTGGTAGTAAAGTCGGAAAGTTCCGAAGAATA AGGTCCTATGATCAACGTTCCATCGAAATGAACCAATAAGTAAGGATTCA GTTTAGTGCCTTTACACGTGTCGATCACAATGACACCTAACGTGCGCCCT TCTAGAAGGTTTTCCGAAATGATTCGATCAGCGGCAAATAAGACTGCTTC TGCAAACATAACTGCTAGCGGGTTCAAAACGTTGCAGTGGCTATCTTCTT TATTGTCGAAACTTTTCATGGTGAGGTCTAAGTGTACATGTATCTTTATG TCGCTTTCGCTCGAGCCGATCACGTACCCTGAAGAAGAAGTCAAAATGAA AAAATTAAGAATTTAGATAACTTCTATATGCCTAACTCTGCGCCAATTCA GCATTGTTATAAAAAAAGGGATCTAGCTCTGGTTCGTGGAACAATTCTTT TGATTGATCTTTAGGACTGAAGATAGAGTAAACGTTTTTTGTTTTTAAGA ACAAACTATATAAGAACATAAGGCTTCGATGGCCAAAATGTTAAGAACAA GTTAAGAACATTTCAAGGCTTTACTCTAAAATACAGAGTTTCTTAGGAAA ATGGGCAAAAATACTCACAAAATGGTACAAATAAGAACATGATAAGAAAA TTTTTTGGCTTAAAACTCAAAAAGTTAAGAACATCCGAAGGCTTCAAAAA TTTTGGATACTATTATAAAAAAAAATTGTTCAATGAATTCGATGAGATGA AAAATAAACGAATTTATGACTTCTTGATTACCCTTCGTGATTCTTTTCCA TTTCCCGACATCTTCAGTGACATTTTGTGAAGCAACAAATGTACAACAAA CCAGCAGAACCCACACCACTTCATGAGCCTTCATCTTTTCTTTTTTTCCT GAAAAACTAACGAAAAAATAAGTGGACAAGTGAAACTTATCGGATGATAT TTGGACGTTTTTTTTAATTTCCTGAATCAGCCAAAGAGAATTAATAATCA TTGATGTTCGAAAAAACTTTCAAAAACGCGGACCCTTTGGGAAACTGAGG AATGAAGAGAAGTAAAAAGTCCTGTTCCCTGGGTGTGATTCCTTCCTTTT CATTCCAAGGGAAACTTTTGACACTCCTATGTGAAAAGAAAACATGGCGA AACATCCCCTCTAACAAAATGTTTCTCTTTCCCTTATCATATACACTATC GCCCTTTTTTGCCCATCGGAACCAAAAGAAGGTCTCAATTATGCATCTAT CTCTTCTTTATAAATCCGATCTGTGTTCTATTAATCGAATGATCTAGACA AGGTCACACTTTCGAGATGTACAACACTGTATCATGACAAATATTTTTGA ACGAAAAAAGATTGATTTTATTGAAATTTGTTCAGACAGCTGTATATGCC TTTCAGCGTTGTCTATTCGCCTTTCTTTTGATTTGGATGTTTAATTAAAT TCATTGTAACAAGTGTCGAATTCAAATCAAAAATTCTTTCTTTTCAAATA ATTTTTACGCAAGGTTGTTCTGAAAAGTTCAGTAATCAGATTTCTACATA TTTACTTTTATTGTTACGAAAATAGTTGGTCTTTTTGGCCCTCTTCTCAC AACATTTTCATTAGTTTGTGAAGTAAAGACAAACATATAAACAAACATCG AGCCATATAACTTCATTAAATTTCCCAACTGGCTAAACGTAAACAAATTT TTTAAAGAATTTTCCCTTCAGTTTATCCCTTAGCAGGTTTTTTCTCATAT ATCTGTAATATACGAATCACTTTAAATTTTCTGTATCACAAGATATCTCC TTGTATTTGTATTGCCAAGTATTTTTCAAGTATCTTGTGCAAGACAATTC TTATCATTAGATAGAGGCAACTCGATTCTGAGCTAACGCAAGCATTGCAC ACAACGCATATACCGTCTGCACCCCTAGGAATTTATTCCAATGTTGGCCC TGAATAGACTAATTTGCTGGTTCGGATTAGCCGGGATTTAGTAAGAGATT TCCAGAAAATAAGTTCTAGCGTCAACTCATTATTTAGCTGCACCTCATCG AATGAAGTTTATTTATTCTCCTTTACCTCTCGCCCCTCTCACATAACATA AACGTTACGATTCAAGACTGATATATTCGTATCTCCTTCCCTTATTACTG TCAACAAACGTCAATGAAAATGAAAATATTTTTTATACACTTTTATTTAG AAATATGTAGGAAGGCCTTCAATTGAATTTTTTGTCGAGGAAACCCAGAT CTACTAGAAAATCTTAACACCCCAAAAAATTTCATGCAGGTGGATGGAGG CTTTTTTTAGGTGTTAAGTGTCGGTCTGTCAATTTCCAAGTTGTATGATT GGCCGGTGTTTTCAGTCCAGGACCACTATCTTATTAACATGGTTCAATTC GGCTACTTCTTACCGAATAAGTAAATATTTAAAGAAACTTTACCTATTTT CTCATCATTGAATTTCTTTATCCTTGTGCTCAGGCGAAAGAGTTCCGCGC ATTTTGGGGCGAGAAATCAGAATTGAGGCGTTTTCAAGATGGCAGTATCA ACGAGGCGGTAGTTTGGCCATCATCCAATTCCAGCCAGAAAAAAATGGTC TGCAAACAGATCGTACAACATCTTCTTAAACTGTATGTAACTTATATCTT CATTTGTCTTGGAAAAATGAATGCTCTGAGGTATTATCAGACATCGGAGG ACAAATGGACAAGCAAAGACATGCATAATCATTTGCTGACATTTGAGTTT CTTTTTTAACCGACTTTCACCGACCTACCAAAATATCCGTCCTTCTAAAT AAGGAGTTATATAGCTCAAAAAATTAAGGTGCACCTTAAGAATCCGAGTT ATAAAACTCAATTTAAGAAGCACTTAAGTTAGAATTAACTCGCAAAATTA AGAAAACTGAGTCATGACGTCATAATTCGGGTTTTCCAGGCCTCCTAAAA AGACTTAAAATTAATATCGTTTCTAAACTAATTTTGTGTTTTACCTTCTT TTCTACAAGGCATTGTGCAATCTATCCTTCATCCATCGATTACCATGGCA ACTCGTTCGATTTCATTCTCTCTTCGAACACGTCATCGTTCGAGCACGCG TCAGCCAATCAGAAGAAAGCCACAATACCACGTGGTTGTGGTGAAGAAGA GAGCACTCACGTGATCAAAACATTTGAAGAATTGAGTCGTCAGCTACGTG GTTTGAGTGAATTACCTTTAGTCGTCAACAATATACATGCAGTGGACCCA TTGCTTAGGATGACAGAGGTATATCTACTTTTACTTTAGCGCTTTCTATC GTATGGTTGCTTCTAGCATTTTCTTCTGATCCCTTGTAATACAATCTATC CAATTCTTTTTTTATCAAAACATATTTTTATCCATAAGTCAAATAAATTT TCTATTCCACCGACAGCCATTGACTGCTCGACAATACGAAGTCAAGGAGC AATCAAAAGGTCAAGATTTTCTGGTACCCAGTAACGCAAAAAGATCACCG CTTTGGTGTCCTGTAATAAAAGGTAACAGTGCACACCTTTACACACTTTT TTTCCTAAAATTCAGTAAAACAAAAATGCATGTGAAATAGTGCGCGTTTG GCAAAACAGAGGTTAGTGGATCTTAGCATAATCTATTTCAAAAAATGCCC GAGGGAAGAAAAGCTTGTCCTTGTACCGGTAGTAAATCTACAAAATAGTA GGTTTAATAATTTATCATGATATGCACCATTGCAATGTCTTCCACGGACC CAATAGCCCGGAGGCCACTTATAGCTTTTTGATAGACTGGATGGCGCTGA TAAGTGGTCCGGCGTAATTTGGCAGGCTTCATTTTCTGGCTTTGCTTGAG GTGGTAGCAAATACATGCCACTAGATCCAGTGCCTTTTTGGAGAAAAACA AACAGAAAACCATGTCCAATAGACCAATTTTTTTCAAATTTTCGACGTAT TTTAATGTTTTTTTTATAGTTTCATAAACTTTGATTGGGTTTTAGAATAT AATTTATTCTTTTTTTGTTTTCATATAGTTTTTGAAAACGAAAGTGAAAA ATTCCAATATGCTGATATATCTTCCAGTCTACTTCACTGGATCCAACAGC TAATTGGTTGAAAGTGACGTAAAATCAGTCATTTCGTCATTCACACCCAA TCAGCTATTGGGTTCGTGATGTAATGTCAGAAGACATTGTAATGGTGCAT ATCATGAATTGAAAACAAAAGTAAAACAAAGGAAATCAGCACAGGCCACA CAATTCCTTACAATTTTGCACACTTCAGTTGACTGTTAAATTCAATATTC AAGGGAACAAAAACTTTCTTCGAATTATAGAAAAATTCGGATTACGGGGA GTAATTTATACTACTTTCCAGTTGAGGAGACCGATGTTTCAGTTCGAATT ATAGAAAGATTCGATCAAAAGAGTTTCAAATTGTAGAGAATTGACTGTAT TTACACTAATTTTGTTCTTCAGCTTATATCCAGTTTGAAGGGAGCGGTCA ATGGCCTGATAATTTAGAAGCAATCCAACACATACGCGCTGCTTTCCACA TCAAAGTTGCAGAATGCATACGTCAGCAACTTCATTTCCCTGCAAAAGCG ACTCCAAGGTGGATCGATGTGATGAAAGTGAGAGTTTTGACAAGATGATT TTATTCTTTATATTCTTTATAGTGTTGTGCAAAATCACGCAGTCCGGGTT CGATGCTACTATTTCTTTATTCAAAATGAAATTTCCATTCGGTTACTTTC CGAGAACGAAATTATATTTCAATACCCGATGGTCGTTACAGTCTCATCTT TATAACACGAACGCTTACATGGTATGGGTTAGAGGGTTTAAAAATCGTTT CTAAGGATTCCTGATTCAAAGGAGTAAAGGAAGTGAGTTCGATATTCCAG TATAAAAGAAATTCTAGTGTTTGAGAAATCTCGATCAATTCCAGGCAGGG TGTTAGGGTAGCATGACGATAGACTCTCCCACCTAACTGATTATTATATT CTCTTTCTCAAACCGCTGATCGCAGAATGATTGAGCAAAGCTCATGTTGT AAACATTCGGTATAAAAGTCTTTTCTTCTATTTCGTTTTCAACTTCTAAT TCTTTGACTTTTTTTTACAGAACGGCTACGTTTTTCGTTTGTCGGTCATC CATTACCGAGAAATGGTTTTACATAAAGAAAATGTAGCCTTGGGAAAATC AAAAACTTCCCATGACATCCAGGCTAAGAAGTTGGAAATGGAAATTGTGA AAAAGCCCCTCCATAACTCCCTCATTCACAGGCAAGTGTCTTTATAAGCC CTTAGTCTAAGTCATAATCTTAGGTTCGCAGGTTTTGCGATATTTTTTCT TCGAGAAAATTAAGAATTCATTTTACGGTTGGTGCTTAGAGAAATAGCTT TGAGAAATTTCATCATACGAATATCAAGGATGTTAGATATTTCAACATTC CAGTTTTGTTGTTTTAGTTTGAACGGTCAATTCGGTGCATTTTCGCTGAC GTGTCGCCTGGCGAAGAGGTGGATGAGTAGTCAGATGTTGTCCAATCATT TCTATGAAGAGTTGATCGAGTTGTTGGTCGCCTCCGTCTTTCTCTCACCA AACCCACCTAAGTAAGCAGACCAGCTCTCTCTCCTTTTTTGAGTATGCAC TTTTCTTTATAAGAACACGAGGCTGAAAATTGCCCAAAGCCTAAGAACAA TCTGAGCCTCGGATCATTTCAGAAATAATGATTTTAACATAATTTTAAAC CCATTTCTAAGTAAAGAAACACGGCATATTAACTTAAGGGAAGAAATTTT CGCGGAAGAAATTTTCGCGGAATTTAATTTCGCGAATTTGGGCGTAATTC GCGAAATTAAATTCCGCAAAACACACCAAAGTTGTTAAATCGCGAAATTA AATTCCGCGAAATTCGATTTTTTTTCTTCTTCTTTTATTTTGTTGTTTTT GACCAGGTATTACCAAAAAAAGATGGACACAATTGATTTTTAAGCATTAT AATGTGTATTTTTTATCAACTTTAAACGAATATAAACAACTCCGCGATGC TTAAAAGTTAATCTAAGTTGATAACTTCTTCTTAATCGTGACTCATTCGC GAAATTAAATTCCGCGAAACTTGCCATTTTGAAACTCTTATTCGCGAAAT TAAATTCCGCGAAAATTTCTTCCCTTAAGAACATTTAAGCCTGAAAATTT CAAAAAAATTAAGAACAACCAAGCCTGACAAAAATTTTACAGGCTGTTAT AAAAAAGCGTGTATTCTCTCCGCCTTTTATTATATGTCCGTCGATAAATT AAAGGTCAAAAACCTGTTTTTTTTAAGATGCTCTTCCATTTCAAGTCAAT GCATTAAATTCATTTTATTCCAATTTTTCTTTGTATTAGTTCATCTCTTT GTGGATTTGTTCGATTCTTGGATCATATAGCGACCTTCGATTGGAATGCA AACCCTTTGATTGTCAACCTCAATAGCGAAATCAAAAGTAATTAGCAATA TTTCATTTCATTCCTTTGAGTCTACATCGAGAGGTCCAGAGAGGCCTGAA ATTTTCGTAATTTAAAGTCGCTTGTTTGATAATGAAATAGAAAACTGTTT GCTATTATTACACACCGAGTTTGTCCGTTTACAAGGAGACTTATGGTCTT ATCTTAAGAGTATCGTAAAGAGGATCGTAAAGCAGAGTGTCCAATTCCAC GTTAGAGAAGTTTCATGCTCTCTGTATAGATAAAATTTTCGCATGGACAG TATTTCGAATCGGCTTCTTTTTCACCCACATTAAAAAAAGAAATTTGGCG AATTTGGTAGACTGGAGTCGTTTATAATGCATGTAATACTAATAATACCA ATACTAATAATAATAATACGGGATTTAGTTTGTATAAACGACTGGAAGAA TCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNAATCCGGTGTTCCAGCCTTATAGATACAGG GGCTAGCTACGCAGAAACTTGCGTAGCGAGAAAACAATTTATCAAGCAAC AACAAACTCTCAAAACGAAATCAACGTAAATGAAAAACTTTCAATACACA AATCCACACATATTTTTTTTCTCAAGAATTATTTTGAGCAGGAAAAAATT ATAATTACAATATTGACACTTTTCTTTTGTTTGGAGTTAGTGCACAAATG TTTCTAGACGACTAAAATTGTTCCATTCATTATTATTTTTTGCTTTATTT CTACTATGATGTATAAATTAGTCGTCTAGCTTGCTAGACTACGAATTTGG CGGATTTGGTCAAAATCAGCCAAATTACGTTCCCACCAAATTTAATTTTT TCCGTCATCCGCCAAATTAAATTCCCGTCAAAATTTCTTCCTATGTAATT TCTCTCAATTTCCTCGGACAAAATTTCTAATTAAAAGTTTTTTGCGAGGA CTTAACTTCGCGAAAATTGCGAGAATTAATCGACGCGAAATTTGATCCAC CAAAAGGTAGTACAGGTATATACACAAAACAATAAATTGAATTCTTTTAG GCGAAAGCATGGAAGCATTGAAAGAACGTTTCACAAACTCCAGAGATCAT CTTCCACACATGGTTGTCATGACTCCCTATGATGTAGATGGTACCTTATG GACAAAACAACAACCCTCACCGCAGGTCAGAAATTTCGTTTAATAAAACT TGGTATTAACCTGTAGCTATGCTCCCTCGCAGAGACATTCAGAGATTTGC GTAAAAATGTCTGAGACACGGAATGTTGCCTGACCGTAACAAACCGAACT TCGCGTTATCTTTTTACTCAGCGAAGAAGAGTTTGGTACAGGCTAACTTG GTATATACTAATGAGTCATAAAAACTACTCATGAAATTGTTTGAAATGGA AAAACCTTGCGAATTTGAATCTATACATAATTTCATTTGTAGGTGGTGAA ACGGTTATCGTTGCTCGCTCAAGCGGCTTTGGCACTAGTGGAAAGCGATG GTTTTGAATTTACACAACAAACTATAATGGTAGAGTACTTAGAGTTGATC TTTTTTTTGACTGTTTGAACTCGTTTGAACAAGACTCCTTCTCACTCAGT GAATTTTTTCATGGTATTTATCGCGGGTTGCTCATTACATCATTTTACTT ATCGGAAATACCCGAAAAAATTTATGCTCCGTCTTTAGAAATTAAATAAA AGATAACAGATTGTCGAAGTGAAAAATTTGCTAATCCTTATACATGTCTT CTTTTCAGCAATTATTTCGTCCTTCCACAAAAGATTATGATATCGTTATT GAGTTGGATAAAAACCATGTGCCGAAACTACCTTTCATCCAATCTTCAAA AAGTGTCCACAAATCGTCTGATGTGAAATTAGCATCAATGGTGTCGAACA ATGTATCGAATGAAGTCCTCCCTGTTGTCGACTTTGACCCTGCTCGCTCG TTCCTCGACCAATTACAGGTAAACCAATTTTTTGTCTTCAAAAACCTACA AGACGACTGATAGTCGAAAATTTCGCCTTTTGTACGATTATAAATAGATA AAATAAAGAATTAAAAGCCCGAGGTACAAGTCAGAATCGAAAATAGACGA AAAAATTACCCCTAGAGAGACATGCCTGGTAAAGTTCTGGTAAAGAGAGC AAAATAATCAATACAAATCTTTTTTATACTTACTAGTTATACTAGAACAT AAGGTTCTAGCCTTAAGATTTCCGTTTTCTCAAAATTCATAAACACAAAA TTATCTTCCCAACAAAATACTACTTTTAATTAAGAAAACCAAATAAAATC ACCTCTAACAATCTTCTGTTCTATTTCAGAACAGGTAGACTCGATAGACT TGATCTACTTTAGTCAAAGAATCTGGCTCTGACTCTTTATGTTATACTGT TGACGAGAGGGGCAGATAATACCTGCAGACCCCTTCTATTAAGTGACATA ACTATGAACTTTTTGTTGAAAAAATGTTTGTCTTTTCATATTTGAGACAT TCATTGTCCTTTTTCTTTTGGAGTGATGTGGAGAATTCCCCCTAGTGACA CACTGTCATATTGAATAGACCTTTTACTATCTAGTTAGGATGTCATGTTG AATAATTAAAATTCCAGCATCAAAACAATGATAAGAAACACGAACGTACA CTTAATAAAATAATTATGCATTAATGTGTCAATTTTTTATAATGCTGGAG TTTTTAATTATTCAACATGGTATCCTAACTANCTGATTTTTGCTGCACTG TAAGGGTGCAATTTTAAAAGCCATTTTTTGGCCCGCACATACCGTCAGTC CGCAAACCCAGTGCCCCCCCCGGGGGTACTTTCTGTTTGAAAAAATAAGA AGCTCCAAATCGCTGATTTTTGGACCTACCTGGAGGTCCTATAAATTAAC CTTTGTCCGTTCGTTCGTTCGTTCGTCCGTCCGTCTGTTACCAGCTTTTC TCGAGATTGGCTCATTAGTTTTTTCTGATTTCTGGCACAATGATGCAAAA TAGTAATGCCCAAAATGTGACGGAGCCCGATTTTCGAAAAAAATTCATTT CCGGCCGAAAATGCCGGAAATATGCCGGAAAAACCCGTTTTTTAGCATTT TCTCGAGATTTCATCATTAGTATTTTCAGATTTTTTGCACAAAGATGCGT ATTAGCAATGCCCAAAACATGGCCGAGTCCGATTTTTGAGAAAAATTCTT TTCCGGCCGAAAATGCCGGAAATATGCTGGAAATCGCCGTTATTGCAGAT TTTCATCAGACTCTTTCCTTACATTTCGTTGTTTTTTCACACAAAAACAT TATTAATAGCAATGTCCACGATCAAGCATGGTTCAATTGTCAATAAAACT GATTTTTGAAGCCGGAACTTTCTAAAAATCGCCGGAAATGCCGATTTTCG CCGGAAAAACGGTATTTCTTGAATTTCTTGAGCTGTACTTTTTATTTTTT CATGAAATTTTGCACACTGATGCAAAACGTCAATACCTAAATTGTGACGG AGCCCGATTTTCGAAAAAGATTCATTACCGGCTGAAAATGCCGGAAATAT GCCGGAAAAACTTTTTTTTTGGCATTTTCTCAACATTTTATCATTAGTTT TTTCTGATTTTTTGCTCAAAGATGCGTATTAACAATGCCCAAAACATGGC CGAGTACGATTTTTGAGAAAAATTTTTTTCCGGCGGAAAATGCCTGAAAT ATGCTGGAAATCGCCGTTTTTCTGGGTTTTCATTGGACTTTTTCCTTATA ATTGGTTGTTTTTTCATTCAAAAACATTATTAATAGCAATGCCCACCATC AAGTATGTTTCAATTTAAAATAAAATTGATTTTTGAAGCCGGAACTATTT AAAAATCGCCGGAACAGCCTATTTTCGCCGGAAAGACAGTAATTCTTGAA TTTCTCGAGCTGTACTTTACATTTTTTTATGAAATTTTTCACACTGATGC AATATGACAATACCTAAAATGTGACGGAGCCCACTTTTCGCCGGAAAAAC TGGTTTTTTGACATTTTCTCGAATTTGAATCTTTAGTTTTTTCTGATTTT TTGCAGAAAGATGCTCAAAAACATGGCTGAGTTTTTTTCCGGTTGAAAAT GCCGGAAATCGCCGTTTTTGCAGATTTTCATTGGATTTTTTCCTTATATT TCTATGTTTTTCACACAAAAACATTATTGATAACAATGCTCACCATCAAG CATGATTCAATTGTCAATAAAACTGATTTTTGCTACCAGAACTTTCTATA TTTATTTTTTCCCTACAACCCTCCCCTCTCCCCCCATCATCAATCAATGA TGAATTTCTTGCGTTATGCATTTTCGCTAAACGCTATGTTTTCTGACCGA TTCTTTTCATTTTTCTCCTCGCATTGCTATCTAACTTTCATCATCAGGTA GGTCCATTCAGCATCTAGCTTGTTACTACTTAATTCTTTCTTTAGCAGTC AGAGAAATAAAAGATCTTTTGTCAATACTCCTTTAGGCTAACACGACTGC CTATTGTACTTATTACGAAAGCTTAAATTTATGATACTTCTATGCTTCAG TAAATGCAAGTAAAGCCAGCAGGAAATTAGATATTACCTGATGTATAAGA TTTGTTCATATTGGCTATGAAGTATAAGGGTTTTATTTCCGTCGTACAGA GTAAATAATTTCTGGCCTAAATGGCTGGAGTAATTTAATATGCAGAATTG GAGGTCGTAGGTTGACGCGTTTTCCCAAACAACTATCAGGCAAATCAACC TTCCTGTTATTCCTATCTTCAAAGAAGGTGACGGAATTAGATGAGGAGTG TCGACACAATGGACCTGCTTACGGTATCACACGAAAGCATATTTAGTATA AACACGTGTAACTAGATATTTTCTTATTATTGTTTTAATGCTGGATTCAG TGGAGTTATTAATTATATATTCGTTTGGGATAACGTGACAACCTATTGAC TCAGTTCTGCATATCGAATTACTCCACCCATTCGGGCCAGAAATTACCGT GAAGTCCGGTAACTTGCATCAGTGGAGGGAAACTTGCCTAGCCAGCAAAT GACTGACCAATCAAAGCAGCAAAACTTCAAAACAAATGGATTCACAGCAC TACTCTACCATTTTTGTTTTGATTTAATTTTGTATTTTATTGACCAGCCG AGTCATTCATTCGAGGAATGTTTACAAATGCTTAGTTACTTTAACTATGC ATTTTGCGGTCTCAAAACCGCATAGATTTTATCTTAGCAAGTGAGTCCAT TTTTTGAATCTATTCGAGAATATTCTAGAAGTTTCTACGTTTCTACACTG TGTTAGTTATACTTTCGTTTTCTAATTTTTTTTCCGATGACACCAGCACC GCGAAAGGCTATCGTAATACTTTCGCTAGGCGAAATTAACAATCTACCAT GGCTTTTACATAACACCCCTGTCTCACATCCCCGGTGGAACTTTTTTCCT CAGTGGGGATAAAAATTATTATTGAAATTCCAATAGGAATAGAAATTCTA TTGTTCTAAGGTCACAAATTCCGGTAGGGATGGTTTTGGAAAGCCATTTT TAAACATTGAATTTCGGATGGGGATGGAATCAAAGTAAATTTCCCAGTGG GGCTGGAATTCCAGGGTATTTTTCCACCGGGGACGAAATCTTTGCCGAAT TTTCCAGTAGGGATTCATAATCTATCGGATTGGATATTCTCTTTCTTAGA AAAATATTTAGAGGCGGCTTTCTAATAGAAAGTTTGTATTTGCCCTAATA ACGACAAGATTCAGCTTGTAAGTTTGTGATGAGATGTACTCGTGTACGCT CCGTAAATTTGTTAATTTGCTTTTCCCTATAGGAACTTTTCAATGATACC GCTATGTTCTTTTGCGATCAATACGGGGGAAGTCAAATTGGTGTGGTGTG GAAACGAAACAAACTCGCTGCTCAACCTTTCAAAGTAAGACTTCCCGTGT TCTCTTCTCTCTGGTTTGTTTTTGAAAGTCCCTTTGAAACGAGCTTACTT CTAAGGGATAACATGTCCCTTTTAATTTCAAATTAGCATGAGCTTCTTTT ATAATAGCGAGTTTATGTATTCGAGATAAATCGATGGGGACGGTATAATG CATAGTTGACATATCTCCAAAATCACCGTCCACTTTGCTCGACGACGGTA AAAACACCAAAATACCGTCGTCTGTTTAGGTGAGCAAAGGCGATATAGAG CCGTACATCAACTATCGACTTTGTTTTGTATCATTTCACGTACCTTCGCC CTCGATATCCTTCGATACATAAACTCGGTAATGTCAGTGACTGCGGAACG TCAATATTTTCTTGTCGTGACATTGCATATTAATGTTGTGTTGTTGTCAA AACCAAAATAATGACAATTATGGACATTTCTTTAGATAATGAACGCAAAA TACAAACATGTCGAAGAAGATGTCGCACAAAAGAAAAAGAAAAAACAGAA AGCTAAAGATACAAAGGTCACAACCCTTTTTCCTATTATAGACGAAGTCC CTGATTTCCTAATGGTATTATAATTTCTAGGGGCGTAAGAAGAGATAATG TCTAAGGGCGTAAGAAGAGATAATGTCTAAGGCTGTAAGAAGAGATAATG TCTAAGGCTGTAAGAAGAGATAACGTAGCCTAAACTTATTCTCCAGTTTC GCGAAGAAGGAGCTTCATGCTCTCTGAGAGATAGGATAAATAACCTTTCT GAACCTAGTAGCACAACAATTAGTCACGCATGCGCGGGAAGAAAAACATA TTATTTTGATGTATTTTTTTTACAATAACGGATTGTTAGTTTCTTGAATA TTTCAAGTCAACAATAATCTCTACAAAATTACAAATCATTTCTATAGTGC TTATACGATTATGATTTCATGGATGTCATTTCTTTCTTTCCTCAGATCAC AACAAACGAAGAAACAATGCTAAAAACGAACACTAAAGCCATCATCCAAG ACTTTTCAATCCTGGGTCAAGGTTTAGTAAAGAATATACAAGTAGTGAAT CAAGTGTAAAAATGTTTTCCTAGTAAACTTTGCAAATCTTTATCTCGTTT TTACTTTTTTTAAACAAATGACAGCGTTATTTACTGCCTTTTTTTTAAAC CTTTTGTAAATCCTAAGGATATTTTCTATGTTCATTTTCTTTACAATTTA CAAATAGAGTTTTGACAAATGTGATGTGATGACATAAACATGAAGAGACA ATAGCATGTGCCAATAAGTAGCAAAATTATAAAAATAAATGAATAAATTT AAATAAAAAGAATAAAAGGTAATCATAAATTACTGTATTACAATATTTAC AACGATTTTAGTTGTTCACCACAACTTACTGATCATGTGTCGCGTCTTTC ACACATGCACTTTCGTCGAAATTAAAAAAAGGCACTAAGTATCACAAAAT AAGATTTTTTAACGCGAAGTGGCTTCTTTTTTTCAATGGAAAGGTTTTTC GTCATTTTTGTTATGGTTCTTCCAACGTCGTTTACATCGCATGTTTAGTT GATGTTTCGGTTCGGAACTATCGGAGTTGCTGAGTCTGAGGGCTGATTCA AGCTTCTGCGGACTTGGGCTGAAGCTCAGTTGCGGAGGGTGTAACCTAAA ATGAAAGTAAAAGAAGAAATTATGTAAGGATCTTTTTATGTACTATATTA TTCTTTTTCATGCAGTTTTGTATGTTGATTTCTTTAAAATGACTGCTTTT ACGTGGTTGTTTTGCTTTTTGTGATTGATGGTTTTTGATGTTGTTGGTTG TTATCGGTTCCTCGCCACGCGGTATGAACTAATATGCGAGATGAGCAAAA GGAATCAGAGTTATAGAGTCTCGAGTATAGTTACCTTTTGTTTCTTTTTG ATGACAAAGATGTAAACGACGACAACGACCACCACAATGATTGCCAATAG CAACAAAACGATCAACAGAATCAACCATGTGGTATCTTCATCTTCTTCAG TGGAGGACCCGCCACCGTTCTGTGTGTTGTGGTAATTCGTTGAACCTGAG TAAGGAGTCATTGACGTGGTGTCTGTCCCGTCGCCTCGGTACATATAATT TCCGCTGACTGGCTGCAATGTCTGTGATGTCCCGTTGGATGTGGTGATCG TTATTTGCAGTTGATCCGCTTCTGCTTTGGTGTACAGAACATCGAAGGCT GCATCAGTCTCTGATGGTGTTAAGAATACCTCAAAAGTGACTTTGATACT ACCTTCTGAGACATTACAAGCAGTCAACGGGACGCCTATTTGATCTTCTG TTTCATTACAAACAGCAGTTTTAAGTGCATCGAATCCCATTTCATCGACC CAAGCGTTGTAATTGGCATCGAGGTATACACTGCCTCTTGATACTTCTTT TGCTGGTTCGGTTGTTGCGTCTCCATCAGCTTCAGTAAGTTGGGCACTTG TAGATTCAGTGACAGTAACCTCAGTAGTTATCATCTCCGTTGTATTGAAA GCGCTTCCACTCTGTGTCGGATCCACATCGCCGCCATTATCCGCCATGGT TGTAGTAGCATTGTCCCCGCCGCCACTTGTATCGGGGGCCTCAGTAACAG TAGAGTTTGAGTTACTTCCGCCAGAGTTATCACCTCCGTCTACTGTTGAA TTACCCCCAGTTGGATTCTCCGTATAGCCTCCATAATCAGTTGAGTTGGT ACCATTGGTAGGAGGATTAGTTGAACCCCCTCCATTTGAAGGGTCGGTTG AGTTACTTCCAGAGTCACCGGAATCAGTGACGCCAGGGTCAGAGGCTTCT GTTGTTGTGGCAACCGGGACACATCGACTCACTGTGGTATAAGTGACGTT TGATGATGTACCATTGGAAGAGACAGTATCATTGGAAGAGATAGTATCAT TGGAAGAGATAGTACCATTGGAAGAGACAGTATCATTGGAAGAGACAGCG ATGGTGAAGTTCTGCCAGACACAGGGTGTTGCGGTGGTTTCTGCGGGTTG TTGTGGAGCTTGTGTGGTTGTGGAGACAGTGTCATTACCAGTGCTGTTGG TGGCACCCTCAACGCAACACGTATATAACACCAAACTAAAAGCTATATGA AAAGATAGCAGTCATTTAAATTGGCGTTGACGACTAAAAACCTGAATATT ATTCCAGTTATGTATAAAATTTAACAGGTCCCTACTCCTAAGTTTTCTAA ATCAACCTTTATTTCGCCCGTCTTAAAATCCAAAACTACGTGATACCAAC CCAGCAGGCACACAACGTTGTTTCAACGTTTATCTAACGTTCACAACGTC CATATATCGTTAGATGAACGTTAAAACAACATTATGTGCCGCCTGGGAAC TTGTGCTTTTAGGTCGAAAAAATCTGATGCCCGCCCCGGGTATCACTCAC ACCGGGACAATATTTTTGGCTGATTTTCCGACTAAGGAGGGACATCTACC GGGACCCTTCATCAGGCTAATTAAAAATAGAAATGATGAATGAGTTGGAG

Coding sequence (CDS) from alignment at sc0000018:762016..792515-

>TCONS_00002157 ID=TCONS_00002157|Name=TCONS_00002157|organism=Clytia hemisphaerica|type=CDS|length=70587bp|location=Sequence derived from alignment at sc0000018:762016..792515- (Clytia hemisphaerica)
ATCACAACAAACGAAGAAACAATGCTAAAAACGAACACTAAAGCCATCAT
CCAAGACTTTTCAATCCTGGGTCAAGGTTTAGTAAAGAATATACAAGTAG
TGAATCAAGTGTAAATAATGAACGCAAAATACAAACATGTCGAAGAAGAT
GTCGCACAAAAGAAAAAGAAAAAACAGAAAGCTAAAGATACAAAGGAACT
TTTCAATGATACCGCTATGTTCTTTTGCGATCAATACGGGGGAAGTCAAA
TTGGTGTGGTGTGGAAACGAAACAAACTCGCTGCTCAACCTTTCAAACAA
TTATTTCGTCCTTCCACAAAAGATTATGATATCGTTATTGAGTTGGATAA
AAACCATGTGCCGAAACTACCTTTCATCCAATCTTCAAAAAGTGTCCACA
AATCGTCTGATGTGAAATTAGCATCAATGGTGTCGAACAATGTATCGAAT
GAAGTCCTCCCTGTTGTCGACTTTGACCCTGCTCGCTCGTTCCTCGACCA
ATTACAGGTGGTGAAACGGTTATCGTTGCTCGCTCAAGCGGCTTTGGCAC
TAGTGGAAAGCGATGGTTTTGAATTTACACAACAAACTATAATGGCGAAA
GCATGGAAGCATTGAAAGAACGTTTCACAAACTCCAGAGATCATCTTCCA
CACATGGTTGTCATGACTCCCTATGATGTAGATGGTACCTTATGGACAAA
ACAACAACCCTCACCGCAGTTCATCTCTTTGTGGATTTGTTCGATTCTTG
GATCATATAGCGACCTTCGATTGGAATGCAAACCCTTTGATTGTCAACCT
CAATAGCGAAATCAAAATTTGAACGGTCAATTCGGTGCATTTTCGCTGAC
GTGTCGCCTGGCGAAGAGGTGGATGAGTAGTCAGATGTTGTCCAATCATT
TCTATGAAGAGTTGATCGAGTTGTTGGTCGCCTCCGTCTTTCTCTCACCA
AACCCACCTAAAACGGCTACGTTTTTCGTTTGTCGGTCATCCATTACCGA
GAAATGGTTTTACATAAAGAAAATGTAGCCTTGGGAAAATCAAAAACTTC
CCATGACATCCAGGCTAAGAAGTTGGAAATGGAAATTGTGAAAAAGCCCC
TCCATAACTCCCTCATTCACAGCTTATATCCAGTTTGAAGGGAGCGGTCA
ATGGCCTGATAATTTAGAAGCAATCCAACACATACGCGCTGCTTTCCACA
TCAAAGTTGCAGAATGCATACGTCAGCAACTTCATTTCCCTGCAAAAGCG
ACTCCAAGGTGGATCGATGTGATGAAACCATTGACTGCTCGACAATACGA
AGTCAAGGAGCAATCAAAAGGTCAAGATTTTCTGGTACCCAGTAACGCAA
AAAGATCACCGCTTTGGTGTCCTGTAATAAAAGGCATTGTGCAATCTATC
CTTCATCCATCGATTACCATGGCAACTCGTTCGATTTCATTCTCTCTTCG
AACACGTCATCGTTCGAGCACGCGTCAGCCAATCAGAAGAAAGCCACAAT
ACCACGTGGTTGTGGTGAAGAAGAGAGCACTCACGTGATCAAAACATTTG
AAGAATTGAGTCGTCAGCTACGTGGTTTGAGTGAATTACCTTTAGTCGTC
AACAATATACATGCAGTGGACCCATTGCTTAGGATGACAGAGGCGAAAGA
GTTCCGCGCATTTTGGGGCGAGAAATCAGAATTGAGGCGTTTTCAAGATG
GCAGTATCAACGAGGCGGTAGTTTGGCCATCATCCAATTCCAGCCAGAAA
AAAATGGTCTGCAAACAGATCGTACAACATCTTCTTAAACTTGGTCGGTG
AACGAGTCGTGCCCAGACTCTTCAAAAGGACCAATCACAGTGGGAGTCTG
CTTGAACGCGTCCAATTATGACAATGTTTTGATCATGGGCCCTCCTGCTG
ATCAACCTCAGAATAAATGACGCCGGCTCCTTTACAACCAAATTGTCAAC
GGAGGAAAATAACAAGTTGATAAGCTATGGTGGCAACGCGCGTCCGATTC
TGTTGGAAAAAATGTCCGAAATTTTAAGACGGGGATTGGACGAAAGAATA
ACGAGTCTATTTATGAAACCCTCGCCTCTGGTTCAGTTGCGATATGAAGC
TCAGCAATCGTTGGCGTTATTGGACAGTACTGAAGAAGGCTCCTTTGAAT
TACTTTTCATCAAAACCAAATCCTTCCTTCAAACCGTCGATCATATGTTC
AGCTGCCATCTTTAAAAGACTTTCACGGTGTATATCCGGTTGTTTTTGTG
GACTCAAGTGGTCACCTCAACCTTTGCTCGTCACTCGATACCATCTCCTA
TCAAATGGTACATCTGATTGGTCGAAGGAAGGAATCACTTTGAATAAAGA
TACCAATGAAGATGAAAAGGGTAATGTACCATTTAATGGGTTTTGTTGTT
CAATGTTGCTGGTGTATTTGTTGTCAGTACGAAAGATTTCTGCACACATG
AGCTCCTATCAAATGTTTCGACTTACTCTTCACTTCATTGAGTTTCCAAC
AGCAGATTACAACAATGGAGTTCTGGAGGACATGTTATACGAAGATCACT
TACGATTGTTGTACTCTACTCTCAAAGAATGTCCTGGTATGAGTGAAGCC
ATCCTACTCCTCAAAACGTGGCTCAAACAACGAAGTTACAAGGGAAAGTT
GGGAAAAAATTTAACGTTGTGCTTCACCTAGCTACACCCGAAGGGCATTT
CAAGTTGTCACGGTTTTTACCGCTGAAAAATAACATAAGACATAATTGGT
ATCACGGCTATGAACAGGATACAACAGAAGAAATTGGCTGTGTTACATGG
AAAAGATTATCTGAACTATCGTTATTACTACAAACGAGCTATATATCTTT
CATGGTTGGCTTATTACTTGAAAGATTGGGAACACACAGAAGATCTCTCC
TTTACCTGTGGAACAAATATCTTCAAACCAACTTTGAAAATTAATTTGAA
AGATGAAAGGAAAATTTTGTTTTCACACTCCCTCTGAAATAAAAGTTGTT
GGTAGCTTTTTATTGAAAACTATGATCAAAGCGAATCATTCAATTGACAT
TGCTGTACAAATGCCACAGATCACAACAAACGAAGAAACAATGCTAAAAA
CGAACACTAAAGCCATCATCCAAGACTTTTCAATCCTGGGTCAAGGTTTA
GTAAAGAATATACAAGTAGTGAATCAAGTGTAAATAATGAACGCAAAATA
CAAACATGTCGAAGAAGATGTCGCACAAAAGAAAAAGAAAAAACAGAAAG
CTAAAGATACAAAGGAACTTTTCAATGATACCGCTATGTTCTTTTGCGAT
CAATACGGGGGAAGTCAAATTGGTGTGGTGTGGAAACGAAACAAACTCGC
TGCTCAACCTTTCAAACAATTATTTCGTCCTTCCACAAAAGATTATGATA
TCGTTATTGAGTTGGATAAAAACCATGTGCCGAAACTACCTTTCATCCAA
TCTTCAAAAAGTGTCCACAAATCGTCTGATGTGAAATTAGCATCAATGGT
GTCGAACAATGTATCGAATGAAGTCCTCCCTGTTGTCGACTTTGACCCTG
CTCGCTCGTTCCTCGACCAATTACAGGTGGTGAAACGGTTATCGTTGCTC
GCTCAAGCGGCTTTGGCACTAGTGGAAAGCGATGGTTTTGAATTTACACA
ACAAACTATAATGGCGAAAGCATGGAAGCATTGAAAGAACGTTTCACAAA
CTCCAGAGATCATCTTCCACACATGGTTGTCATGACTCCCTATGATGTAG
ATGGTACCTTATGGACAAAACAACAACCCTCACCGCAGTTCATCTCTTTG
TGGATTTGTTCGATTCTTGGATCATATAGCGACCTTCGATTGGAATGCAA
ACCCTTTGATTGTCAACCTCAATAGCGAAATCAAAATTTGAACGGTCAAT
TCGGTGCATTTTCGCTGACGTGTCGCCTGGCGAAGAGGTGGATGAGTAGT
CAGATGTTGTCCAATCATTTCTATGAAGAGTTGATCGAGTTGTTGGTCGC
CTCCGTCTTTCTCTCACCAAACCCACCTAAAACGGCTACGTTTTTCGTTT
GTCGGTCATCCATTACCGAGAAATGGTTTTACATAAAGAAAATGTAGCCT
TGGGAAAATCAAAAACTTCCCATGACATCCAGGCTAAGAAGTTGGAAATG
GAAATTGTGAAAAAGCCCCTCCATAACTCCCTCATTCACAGCTTATATCC
AGTTTGAAGGGAGCGGTCAATGGCCTGATAATTTAGAAGCAATCCAACAC
ATACGCGCTGCTTTCCACATCAAAGTTGCAGAATGCATACGTCAGCAACT
TCATTTCCCTGCAAAAGCGACTCCAAGGTGGATCGATGTGATGAAACCAT
TGACTGCTCGACAATACGAAGTCAAGGAGCAATCAAAAGGTCAAGATTTT
CTGGTACCCAGTAACGCAAAAAGATCACCGCTTTGGTGTCCTGTAATAAA
AGGCATTGTGCAATCTATCCTTCATCCATCGATTACCATGGCAACTCGTT
CGATTTCATTCTCTCTTCGAACACGTCATCGTTCGAGCACGCGTCAGCCA
ATCAGAAGAAAGCCACAATACCACGTGGTTGTGGTGAAGAAGAGAGCACT
CACGTGATCAAAACATTTGAAGAATTGAGTCGTCAGCTACGTGGTTTGAG
TGAATTACCTTTAGTCGTCAACAATATACATGCAGTGGACCCATTGCTTA
GGATGACAGAGGCGAAAGAGTTCCGCGCATTTTGGGGCGAGAAATCAGAA
TTGAGGCGTTTTCAAGATGGCAGTATCAACGAGGCGGTAGTTTGGCCATC
ATCCAATTCCAGCCAGAAAAAAATGGTCTGCAAACAGATCGTACAACATC
TTCTTAAACTTGGTCGGTGAACGAGTCGTGCCCAGACTCTTCAAAAGGAC
CAATCACAGTGGGAGTCTGCTTGAACGCGTCCAATTATGACAATGTTTTG
ATCATGGGCCCTCCTGCTGATCAACCTCAGAATAAATGACGCCGGCTCCT
TTACAACCAAATTGTCAACGGAGGAAAATAACAAGTTGATAAGCTATGGT
GGCAACGCGCGTCCGATTCTGTTGGAAAAAATGTCCGAAATTTTAAGACG
GGGATTGGACGAAAGAATAACGAGTCTATTTATGAAACCCTCGCCTCTGG
TTCAGTTGCGATATGAAGCTCAGCAATCGTTGGCGTTATTGGACAGTACT
GAAGAAGGCTCCTTTGAATTACTTTTCATCAAAACCAAATCCTTCCTTCA
AACCGTCGATCATATGTTCAGCTGCCATCTTTAAAAGACTTTCACGGTGT
ATATCCGGTTGTTTTTGTGGACTCAAGTGGTCACCTCAACCTTTGCTCGT
CACTCGATACCATCTCCTATCAAATGGTACATCTGATTGGTCGAAGGAAG
GAATCACTTTGAATAAAGATACCAATGAAGATGAAAAGGGTAATGTACCA
TTTAATGGGTTTTGTTGTTCAATGTTGCTGGTGTATTTGTTGTCAGTACG
AAAGATTTCTGCACACATGAGCTCCTATCAAATGTTTCGACTTACTCTTC
ACTTCATTGAGTTTCCAACAGCAGATTACAACAATGGAGTTCTGGAGGAC
ATGTTATACGAAGATCACTTACGATTGTTGTACTCTACTCTCAAAGAATG
TCCTGGTATGAGTGAAGCCATCCTACTCCTCAAAACGTGGCTCAAACAAC
GAAGTTACAAGGGAAAGTTGGGAAAAAATTTAACGTTGTGCTTCACCTAG
CTACACCCGAAGGGCATTTCAAGTTGTCACGGTTTTTACCGCTGAAAAAT
AACATAAGACATAATTGGTATCACGGCTATGAACAGGATACAACAGAAGA
AATTGGCTGTGTTACATGGAAAAGATTATCTGAACTATCGTTATTACTAC
AAACGAGCTATATATCTTTCATGGTTGGCTTATTACTTGAAAGATTGGGA
ACACACAGAAGATCTCTCCTTTACCTGTGGAACAAATATCTTCAAACCAA
CTTTGAAAATTAATTTGAAAGATGAAAGGAAAATTTTGTTTTCACACTCC
CTCTGAAATAAAAGTTGTTGGTAGCTTTTTATTGAAAACTATGATCAAAG
CGAATCATTCAATTGACATTGCTGTACAAATGCCACAGATCACAACAAAC
GAAGAAACAATGCTAAAAACGAACACTAAAGCCATCATCCAAGACTTTTC
AATCCTGGGTCAAGGTTTAGTAAAGAATATACAAGTAGTGAATCAAGTGT
AAATAATGAACGCAAAATACAAACATGTCGAAGAAGATGTCGCACAAAAG
AAAAAGAAAAAACAGAAAGCTAAAGATACAAAGGAACTTTTCAATGATAC
CGCTATGTTCTTTTGCGATCAATACGGGGGAAGTCAAATTGGTGTGGTGT
GGAAACGAAACAAACTCGCTGCTCAACCTTTCAAACAATTATTTCGTCCT
TCCACAAAAGATTATGATATCGTTATTGAGTTGGATAAAAACCATGTGCC
GAAACTACCTTTCATCCAATCTTCAAAAAGTGTCCACAAATCGTCTGATG
TGAAATTAGCATCAATGGTGTCGAACAATGTATCGAATGAAGTCCTCCCT
GTTGTCGACTTTGACCCTGCTCGCTCGTTCCTCGACCAATTACAGGTGGT
GAAACGGTTATCGTTGCTCGCTCAAGCGGCTTTGGCACTAGTGGAAAGCG
ATGGTTTTGAATTTACACAACAAACTATAATGGCGAAAGCATGGAAGCAT
TGAAAGAACGTTTCACAAACTCCAGAGATCATCTTCCACACATGGTTGTC
ATGACTCCCTATGATGTAGATGGTACCTTATGGACAAAACAACAACCCTC
ACCGCAGTTCATCTCTTTGTGGATTTGTTCGATTCTTGGATCATATAGCG
ACCTTCGATTGGAATGCAAACCCTTTGATTGTCAACCTCAATAGCGAAAT
CAAAATTTGAACGGTCAATTCGGTGCATTTTCGCTGACGTGTCGCCTGGC
GAAGAGGTGGATGAGTAGTCAGATGTTGTCCAATCATTTCTATGAAGAGT
TGATCGAGTTGTTGGTCGCCTCCGTCTTTCTCTCACCAAACCCACCTAAA
ACGGCTACGTTTTTCGTTTGTCGGTCATCCATTACCGAGAAATGGTTTTA
CATAAAGAAAATGTAGCCTTGGGAAAATCAAAAACTTCCCATGACATCCA
GGCTAAGAAGTTGGAAATGGAAATTGTGAAAAAGCCCCTCCATAACTCCC
TCATTCACAGCTTATATCCAGTTTGAAGGGAGCGGTCAATGGCCTGATAA
TTTAGAAGCAATCCAACACATACGCGCTGCTTTCCACATCAAAGTTGCAG
AATGCATACGTCAGCAACTTCATTTCCCTGCAAAAGCGACTCCAAGGTGG
ATCGATGTGATGAAACCATTGACTGCTCGACAATACGAAGTCAAGGAGCA
ATCAAAAGGTCAAGATTTTCTGGTACCCAGTAACGCAAAAAGATCACCGC
TTTGGTGTCCTGTAATAAAAGGCATTGTGCAATCTATCCTTCATCCATCG
ATTACCATGGCAACTCGTTCGATTTCATTCTCTCTTCGAACACGTCATCG
TTCGAGCACGCGTCAGCCAATCAGAAGAAAGCCACAATACCACGTGGTTG
TGGTGAAGAAGAGAGCACTCACGTGATCAAAACATTTGAAGAATTGAGTC
GTCAGCTACGTGGTTTGAGTGAATTACCTTTAGTCGTCAACAATATACAT
GCAGTGGACCCATTGCTTAGGATGACAGAGGCGAAAGAGTTCCGCGCATT
TTGGGGCGAGAAATCAGAATTGAGGCGTTTTCAAGATGGCAGTATCAACG
AGGCGGTAGTTTGGCCATCATCCAATTCCAGCCAGAAAAAAATGGTCTGC
AAACAGATCGTACAACATCTTCTTAAACTTGGTCGGTGAACGAGTCGTGC
CCAGACTCTTCAAAAGGACCAATCACAGTGGGAGTCTGCTTGAACGCGTC
CAATTATGACAATGTTTTGATCATGGGCCCTCCTGCTGATCAACCTCAGA
ATAAATGACGCCGGCTCCTTTACAACCAAATTGTCAACGGAGGAAAATAA
CAAGTTGATAAGCTATGGTGGCAACGCGCGTCCGATTCTGTTGGAAAAAA
TGTCCGAAATTTTAAGACGGGGATTGGACGAAAGAATAACGAGTCTATTT
ATGAAACCCTCGCCTCTGGTTCAGTTGCGATATGAAGCTCAGCAATCGTT
GGCGTTATTGGACAGTACTGAAGAAGGCTCCTTTGAATTACTTTTCATCA
AAACCAAATCCTTCCTTCAAACCGTCGATCATATGTTCAGCTGCCATCTT
TAAAAGACTTTCACGGTGTATATCCGGTTGTTTTTGTGGACTCAAGTGGT
CACCTCAACCTTTGCTCGTCACTCGATACCATCTCCTATCAAATGGTACA
TCTGATTGGTCGAAGGAAGGAATCACTTTGAATAAAGATACCAATGAAGA
TGAAAAGGGTAATGTACCATTTAATGGGTTTTGTTGTTCAATGTTGCTGG
TGTATTTGTTGTCAGTACGAAAGATTTCTGCACACATGAGCTCCTATCAA
ATGTTTCGACTTACTCTTCACTTCATTGAGTTTCCAACAGCAGATTACAA
CAATGGAGTTCTGGAGGACATGTTATACGAAGATCACTTACGATTGTTGT
ACTCTACTCTCAAAGAATGTCCTGGTATGAGTGAAGCCATCCTACTCCTC
AAAACGTGGCTCAAACAACGAAGTTACAAGGGAAAGTTGGGAAAAAATTT
AACGTTGTGCTTCACCTAGCTACACCCGAAGGGCATTTCAAGTTGTCACG
GTTTTTACCGCTGAAAAATAACATAAGACATAATTGGTATCACGGCTATG
AACAGGATACAACAGAAGAAATTGGCTGTGTTACATGGAAAAGATTATCT
GAACTATCGTTATTACTACAAACGAGCTATATATCTTTCATGGTTGGCTT
ATTACTTGAAAGATTGGGAACACACAGAAGATCTCTCCTTTACCTGTGGA
ACAAATATCTTCAAACCAACTTTGAAAATTAATTTGAAAGATGAAAGGAA
AATTTTGTTTTCACACTCCCTCTGAAATAAAAGTTGTTGGTAGCTTTTTA
TTGAAAACTATGATCAAAGCGAATCATTCAATTGACATTGCTGTACAAAT
GCCACAGATCACAACAAACGAAGAAACAATGCTAAAAACGAACACTAAAG
CCATCATCCAAGACTTTTCAATCCTGGGTCAAGGTTTAGTAAAGAATATA
CAAGTAGTGAATCAAGTGTAAATAATGAACGCAAAATACAAACATGTCGA
AGAAGATGTCGCACAAAAGAAAAAGAAAAAACAGAAAGCTAAAGATACAA
AGGAACTTTTCAATGATACCGCTATGTTCTTTTGCGATCAATACGGGGGA
AGTCAAATTGGTGTGGTGTGGAAACGAAACAAACTCGCTGCTCAACCTTT
CAAACAATTATTTCGTCCTTCCACAAAAGATTATGATATCGTTATTGAGT
TGGATAAAAACCATGTGCCGAAACTACCTTTCATCCAATCTTCAAAAAGT
GTCCACAAATCGTCTGATGTGAAATTAGCATCAATGGTGTCGAACAATGT
ATCGAATGAAGTCCTCCCTGTTGTCGACTTTGACCCTGCTCGCTCGTTCC
TCGACCAATTACAGGTGGTGAAACGGTTATCGTTGCTCGCTCAAGCGGCT
TTGGCACTAGTGGAAAGCGATGGTTTTGAATTTACACAACAAACTATAAT
GGCGAAAGCATGGAAGCATTGAAAGAACGTTTCACAAACTCCAGAGATCA
TCTTCCACACATGGTTGTCATGACTCCCTATGATGTAGATGGTACCTTAT
GGACAAAACAACAACCCTCACCGCAGTTCATCTCTTTGTGGATTTGTTCG
ATTCTTGGATCATATAGCGACCTTCGATTGGAATGCAAACCCTTTGATTG
TCAACCTCAATAGCGAAATCAAAATTTGAACGGTCAATTCGGTGCATTTT
CGCTGACGTGTCGCCTGGCGAAGAGGTGGATGAGTAGTCAGATGTTGTCC
AATCATTTCTATGAAGAGTTGATCGAGTTGTTGGTCGCCTCCGTCTTTCT
CTCACCAAACCCACCTAAAACGGCTACGTTTTTCGTTTGTCGGTCATCCA
TTACCGAGAAATGGTTTTACATAAAGAAAATGTAGCCTTGGGAAAATCAA
AAACTTCCCATGACATCCAGGCTAAGAAGTTGGAAATGGAAATTGTGAAA
AAGCCCCTCCATAACTCCCTCATTCACAGCTTATATCCAGTTTGAAGGGA
GCGGTCAATGGCCTGATAATTTAGAAGCAATCCAACACATACGCGCTGCT
TTCCACATCAAAGTTGCAGAATGCATACGTCAGCAACTTCATTTCCCTGC
AAAAGCGACTCCAAGGTGGATCGATGTGATGAAACCATTGACTGCTCGAC
AATACGAAGTCAAGGAGCAATCAAAAGGTCAAGATTTTCTGGTACCCAGT
AACGCAAAAAGATCACCGCTTTGGTGTCCTGTAATAAAAGGCATTGTGCA
ATCTATCCTTCATCCATCGATTACCATGGCAACTCGTTCGATTTCATTCT
CTCTTCGAACACGTCATCGTTCGAGCACGCGTCAGCCAATCAGAAGAAAG
CCACAATACCACGTGGTTGTGGTGAAGAAGAGAGCACTCACGTGATCAAA
ACATTTGAAGAATTGAGTCGTCAGCTACGTGGTTTGAGTGAATTACCTTT
AGTCGTCAACAATATACATGCAGTGGACCCATTGCTTAGGATGACAGAGG
CGAAAGAGTTCCGCGCATTTTGGGGCGAGAAATCAGAATTGAGGCGTTTT
CAAGATGGCAGTATCAACGAGGCGGTAGTTTGGCCATCATCCAATTCCAG
CCAGAAAAAAATGGTCTGCAAACAGATCGTACAACATCTTCTTAAACTTG
GTCGGTGAACGAGTCGTGCCCAGACTCTTCAAAAGGACCAATCACAGTGG
GAGTCTGCTTGAACGCGTCCAATTATGACAATGTTTTGATCATGGGCCCT
CCTGCTGATCAACCTCAGAATAAATGACGCCGGCTCCTTTACAACCAAAT
TGTCAACGGAGGAAAATAACAAGTTGATAAGCTATGGTGGCAACGCGCGT
CCGATTCTGTTGGAAAAAATGTCCGAAATTTTAAGACGGGGATTGGACGA
AAGAATAACGAGTCTATTTATGAAACCCTCGCCTCTGGTTCAGTTGCGAT
ATGAAGCTCAGCAATCGTTGGCGTTATTGGACAGTACTGAAGAAGGCTCC
TTTGAATTACTTTTCATCAAAACCAAATCCTTCCTTCAAACCGTCGATCA
TATGTTCAGCTGCCATCTTTAAAAGACTTTCACGGTGTATATCCGGTTGT
TTTTGTGGACTCAAGTGGTCACCTCAACCTTTGCTCGTCACTCGATACCA
TCTCCTATCAAATGGTACATCTGATTGGTCGAAGGAAGGAATCACTTTGA
ATAAAGATACCAATGAAGATGAAAAGGGTAATGTACCATTTAATGGGTTT
TGTTGTTCAATGTTGCTGGTGTATTTGTTGTCAGTACGAAAGATTTCTGC
ACACATGAGCTCCTATCAAATGTTTCGACTTACTCTTCACTTCATTGAGT
TTCCAACAGCAGATTACAACAATGGAGTTCTGGAGGACATGTTATACGAA
GATCACTTACGATTGTTGTACTCTACTCTCAAAGAATGTCCTGGTATGAG
TGAAGCCATCCTACTCCTCAAAACGTGGCTCAAACAACGAAGTTACAAGG
GAAAGTTGGGAAAAAATTTAACGTTGTGCTTCACCTAGCTACACCCGAAG
GGCATTTCAAGTTGTCACGGTTTTTACCGCTGAAAAATAACATAAGACAT
AATTGGTATCACGGCTATGAACAGGATACAACAGAAGAAATTGGCTGTGT
TACATGGAAAAGATTATCTGAACTATCGTTATTACTACAAACGAGCTATA
TATCTTTCATGGTTGGCTTATTACTTGAAAGATTGGGAACACACAGAAGA
TCTCTCCTTTACCTGTGGAACAAATATCTTCAAACCAACTTTGAAAATTA
ATTTGAAAGATGAAAGGAAAATTTTGTTTTCACACTCCCTCTGAAATAAA
AGTTGTTGGTAGCTTTTTATTGAAAACTATGATCAAAGCGAATCATTCAA
TTGACATTGCTGTACAAATGCCACAGATCACAACAAACGAAGAAACAATG
CTAAAAACGAACACTAAAGCCATCATCCAAGACTTTTCAATCCTGGGTCA
AGGTTTAGTAAAGAATATACAAGTAGTGAATCAAGTGTAAATAATGAACG
CAAAATACAAACATGTCGAAGAAGATGTCGCACAAAAGAAAAAGAAAAAA
CAGAAAGCTAAAGATACAAAGGAACTTTTCAATGATACCGCTATGTTCTT
TTGCGATCAATACGGGGGAAGTCAAATTGGTGTGGTGTGGAAACGAAACA
AACTCGCTGCTCAACCTTTCAAACAATTATTTCGTCCTTCCACAAAAGAT
TATGATATCGTTATTGAGTTGGATAAAAACCATGTGCCGAAACTACCTTT
CATCCAATCTTCAAAAAGTGTCCACAAATCGTCTGATGTGAAATTAGCAT
CAATGGTGTCGAACAATGTATCGAATGAAGTCCTCCCTGTTGTCGACTTT
GACCCTGCTCGCTCGTTCCTCGACCAATTACAGGTGGTGAAACGGTTATC
GTTGCTCGCTCAAGCGGCTTTGGCACTAGTGGAAAGCGATGGTTTTGAAT
TTACACAACAAACTATAATGGCGAAAGCATGGAAGCATTGAAAGAACGTT
TCACAAACTCCAGAGATCATCTTCCACACATGGTTGTCATGACTCCCTAT
GATGTAGATGGTACCTTATGGACAAAACAACAACCCTCACCGCAGTTCAT
CTCTTTGTGGATTTGTTCGATTCTTGGATCATATAGCGACCTTCGATTGG
AATGCAAACCCTTTGATTGTCAACCTCAATAGCGAAATCAAAATTTGAAC
GGTCAATTCGGTGCATTTTCGCTGACGTGTCGCCTGGCGAAGAGGTGGAT
GAGTAGTCAGATGTTGTCCAATCATTTCTATGAAGAGTTGATCGAGTTGT
TGGTCGCCTCCGTCTTTCTCTCACCAAACCCACCTAAAACGGCTACGTTT
TTCGTTTGTCGGTCATCCATTACCGAGAAATGGTTTTACATAAAGAAAAT
GTAGCCTTGGGAAAATCAAAAACTTCCCATGACATCCAGGCTAAGAAGTT
GGAAATGGAAATTGTGAAAAAGCCCCTCCATAACTCCCTCATTCACAGCT
TATATCCAGTTTGAAGGGAGCGGTCAATGGCCTGATAATTTAGAAGCAAT
CCAACACATACGCGCTGCTTTCCACATCAAAGTTGCAGAATGCATACGTC
AGCAACTTCATTTCCCTGCAAAAGCGACTCCAAGGTGGATCGATGTGATG
AAACCATTGACTGCTCGACAATACGAAGTCAAGGAGCAATCAAAAGGTCA
AGATTTTCTGGTACCCAGTAACGCAAAAAGATCACCGCTTTGGTGTCCTG
TAATAAAAGGCATTGTGCAATCTATCCTTCATCCATCGATTACCATGGCA
ACTCGTTCGATTTCATTCTCTCTTCGAACACGTCATCGTTCGAGCACGCG
TCAGCCAATCAGAAGAAAGCCACAATACCACGTGGTTGTGGTGAAGAAGA
GAGCACTCACGTGATCAAAACATTTGAAGAATTGAGTCGTCAGCTACGTG
GTTTGAGTGAATTACCTTTAGTCGTCAACAATATACATGCAGTGGACCCA
TTGCTTAGGATGACAGAGGCGAAAGAGTTCCGCGCATTTTGGGGCGAGAA
ATCAGAATTGAGGCGTTTTCAAGATGGCAGTATCAACGAGGCGGTAGTTT
GGCCATCATCCAATTCCAGCCAGAAAAAAATGGTCTGCAAACAGATCGTA
CAACATCTTCTTAAACTTGGTCGGTGAACGAGTCGTGCCCAGACTCTTCA
AAAGGACCAATCACAGTGGGAGTCTGCTTGAACGCGTCCAATTATGACAA
TGTTTTGATCATGGGCCCTCCTGCTGATCAACCTCAGAATAAATGACGCC
GGCTCCTTTACAACCAAATTGTCAACGGAGGAAAATAACAAGTTGATAAG
CTATGGTGGCAACGCGCGTCCGATTCTGTTGGAAAAAATGTCCGAAATTT
TAAGACGGGGATTGGACGAAAGAATAACGAGTCTATTTATGAAACCCTCG
CCTCTGGTTCAGTTGCGATATGAAGCTCAGCAATCGTTGGCGTTATTGGA
CAGTACTGAAGAAGGCTCCTTTGAATTACTTTTCATCAAAACCAAATCCT
TCCTTCAAACCGTCGATCATATGTTCAGCTGCCATCTTTAAAAGACTTTC
ACGGTGTATATCCGGTTGTTTTTGTGGACTCAAGTGGTCACCTCAACCTT
TGCTCGTCACTCGATACCATCTCCTATCAAATGGTACATCTGATTGGTCG
AAGGAAGGAATCACTTTGAATAAAGATACCAATGAAGATGAAAAGGGTAA
TGTACCATTTAATGGGTTTTGTTGTTCAATGTTGCTGGTGTATTTGTTGT
CAGTACGAAAGATTTCTGCACACATGAGCTCCTATCAAATGTTTCGACTT
ACTCTTCACTTCATTGAGTTTCCAACAGCAGATTACAACAATGGAGTTCT
GGAGGACATGTTATACGAAGATCACTTACGATTGTTGTACTCTACTCTCA
AAGAATGTCCTGGTATGAGTGAAGCCATCCTACTCCTCAAAACGTGGCTC
AAACAACGAAGTTACAAGGGAAAGTTGGGAAAAAATTTAACGTTGTGCTT
CACCTAGCTACACCCGAAGGGCATTTCAAGTTGTCACGGTTTTTACCGCT
GAAAAATAACATAAGACATAATTGGTATCACGGCTATGAACAGGATACAA
CAGAAGAAATTGGCTGTGTTACATGGAAAAGATTATCTGAACTATCGTTA
TTACTACAAACGAGCTATATATCTTTCATGGTTGGCTTATTACTTGAAAG
ATTGGGAACACACAGAAGATCTCTCCTTTACCTGTGGAACAAATATCTTC
AAACCAACTTTGAAAATTAATTTGAAAGATGAAAGGAAAATTTTGTTTTC
ACACTCCCTCTGAAATAAAAGTTGTTGGTAGCTTTTTATTGAAAACTATG
ATCAAAGCGAATCATTCAATTGACATTGCTGTACAAATGCCACAGATCAC
AACAAACGAAGAAACAATGCTAAAAACGAACACTAAAGCCATCATCCAAG
ACTTTTCAATCCTGGGTCAAGGTTTAGTAAAGAATATACAAGTAGTGAAT
CAAGTGTAAATAATGAACGCAAAATACAAACATGTCGAAGAAGATGTCGC
ACAAAAGAAAAAGAAAAAACAGAAAGCTAAAGATACAAAGGAACTTTTCA
ATGATACCGCTATGTTCTTTTGCGATCAATACGGGGGAAGTCAAATTGGT
GTGGTGTGGAAACGAAACAAACTCGCTGCTCAACCTTTCAAACAATTATT
TCGTCCTTCCACAAAAGATTATGATATCGTTATTGAGTTGGATAAAAACC
ATGTGCCGAAACTACCTTTCATCCAATCTTCAAAAAGTGTCCACAAATCG
TCTGATGTGAAATTAGCATCAATGGTGTCGAACAATGTATCGAATGAAGT
CCTCCCTGTTGTCGACTTTGACCCTGCTCGCTCGTTCCTCGACCAATTAC
AGGTGGTGAAACGGTTATCGTTGCTCGCTCAAGCGGCTTTGGCACTAGTG
GAAAGCGATGGTTTTGAATTTACACAACAAACTATAATGGCGAAAGCATG
GAAGCATTGAAAGAACGTTTCACAAACTCCAGAGATCATCTTCCACACAT
GGTTGTCATGACTCCCTATGATGTAGATGGTACCTTATGGACAAAACAAC
AACCCTCACCGCAGTTCATCTCTTTGTGGATTTGTTCGATTCTTGGATCA
TATAGCGACCTTCGATTGGAATGCAAACCCTTTGATTGTCAACCTCAATA
GCGAAATCAAAATTTGAACGGTCAATTCGGTGCATTTTCGCTGACGTGTC
GCCTGGCGAAGAGGTGGATGAGTAGTCAGATGTTGTCCAATCATTTCTAT
GAAGAGTTGATCGAGTTGTTGGTCGCCTCCGTCTTTCTCTCACCAAACCC
ACCTAAAACGGCTACGTTTTTCGTTTGTCGGTCATCCATTACCGAGAAAT
GGTTTTACATAAAGAAAATGTAGCCTTGGGAAAATCAAAAACTTCCCATG
ACATCCAGGCTAAGAAGTTGGAAATGGAAATTGTGAAAAAGCCCCTCCAT
AACTCCCTCATTCACAGCTTATATCCAGTTTGAAGGGAGCGGTCAATGGC
CTGATAATTTAGAAGCAATCCAACACATACGCGCTGCTTTCCACATCAAA
GTTGCAGAATGCATACGTCAGCAACTTCATTTCCCTGCAAAAGCGACTCC
AAGGTGGATCGATGTGATGAAACCATTGACTGCTCGACAATACGAAGTCA
AGGAGCAATCAAAAGGTCAAGATTTTCTGGTACCCAGTAACGCAAAAAGA
TCACCGCTTTGGTGTCCTGTAATAAAAGGCATTGTGCAATCTATCCTTCA
TCCATCGATTACCATGGCAACTCGTTCGATTTCATTCTCTCTTCGAACAC
GTCATCGTTCGAGCACGCGTCAGCCAATCAGAAGAAAGCCACAATACCAC
GTGGTTGTGGTGAAGAAGAGAGCACTCACGTGATCAAAACATTTGAAGAA
TTGAGTCGTCAGCTACGTGGTTTGAGTGAATTACCTTTAGTCGTCAACAA
TATACATGCAGTGGACCCATTGCTTAGGATGACAGAGGCGAAAGAGTTCC
GCGCATTTTGGGGCGAGAAATCAGAATTGAGGCGTTTTCAAGATGGCAGT
ATCAACGAGGCGGTAGTTTGGCCATCATCCAATTCCAGCCAGAAAAAAAT
GGTCTGCAAACAGATCGTACAACATCTTCTTAAACTTGGTCGGTGAACGA
GTCGTGCCCAGACTCTTCAAAAGGACCAATCACAGTGGGAGTCTGCTTGA
ACGCGTCCAATTATGACAATGTTTTGATCATGGGCCCTCCTGCTGATCAA
CCTCAGAATAAATGACGCCGGCTCCTTTACAACCAAATTGTCAACGGAGG
AAAATAACAAGTTGATAAGCTATGGTGGCAACGCGCGTCCGATTCTGTTG
GAAAAAATGTCCGAAATTTTAAGACGGGGATTGGACGAAAGAATAACGAG
TCTATTTATGAAACCCTCGCCTCTGGTTCAGTTGCGATATGAAGCTCAGC
AATCGTTGGCGTTATTGGACAGTACTGAAGAAGGCTCCTTTGAATTACTT
TTCATCAAAACCAAATCCTTCCTTCAAACCGTCGATCATATGTTCAGCTG
CCATCTTTAAAAGACTTTCACGGTGTATATCCGGTTGTTTTTGTGGACTC
AAGTGGTCACCTCAACCTTTGCTCGTCACTCGATACCATCTCCTATCAAA
TGGTACATCTGATTGGTCGAAGGAAGGAATCACTTTGAATAAAGATACCA
ATGAAGATGAAAAGGGTAATGTACCATTTAATGGGTTTTGTTGTTCAATG
TTGCTGGTGTATTTGTTGTCAGTACGAAAGATTTCTGCACACATGAGCTC
CTATCAAATGTTTCGACTTACTCTTCACTTCATTGAGTTTCCAACAGCAG
ATTACAACAATGGAGTTCTGGAGGACATGTTATACGAAGATCACTTACGA
TTGTTGTACTCTACTCTCAAAGAATGTCCTGGTATGAGTGAAGCCATCCT
ACTCCTCAAAACGTGGCTCAAACAACGAAGTTACAAGGGAAAGTTGGGAA
AAAATTTAACGTTGTGCTTCACCTAGCTACACCCGAAGGGCATTTCAAGT
TGTCACGGTTTTTACCGCTGAAAAATAACATAAGACATAATTGGTATCAC
GGCTATGAACAGGATACAACAGAAGAAATTGGCTGTGTTACATGGAAAAG
ATTATCTGAACTATCGTTATTACTACAAACGAGCTATATATCTTTCATGG
TTGGCTTATTACTTGAAAGATTGGGAACACACAGAAGATCTCTCCTTTAC
CTGTGGAACAAATATCTTCAAACCAACTTTGAAAATTAATTTGAAAGATG
AAAGGAAAATTTTGTTTTCACACTCCCTCTGAAATAAAAGTTGTTGGTAG
CTTTTTATTGAAAACTATGATCAAAGCGAATCATTCAATTGACATTGCTG
TACAAATGCCACAGATCACAACAAACGAAGAAACAATGCTAAAAACGAAC
ACTAAAGCCATCATCCAAGACTTTTCAATCCTGGGTCAAGGTTTAGTAAA
GAATATACAAGTAGTGAATCAAGTGTAAATAATGAACGCAAAATACAAAC
ATGTCGAAGAAGATGTCGCACAAAAGAAAAAGAAAAAACAGAAAGCTAAA
GATACAAAGGAACTTTTCAATGATACCGCTATGTTCTTTTGCGATCAATA
CGGGGGAAGTCAAATTGGTGTGGTGTGGAAACGAAACAAACTCGCTGCTC
AACCTTTCAAACAATTATTTCGTCCTTCCACAAAAGATTATGATATCGTT
ATTGAGTTGGATAAAAACCATGTGCCGAAACTACCTTTCATCCAATCTTC
AAAAAGTGTCCACAAATCGTCTGATGTGAAATTAGCATCAATGGTGTCGA
ACAATGTATCGAATGAAGTCCTCCCTGTTGTCGACTTTGACCCTGCTCGC
TCGTTCCTCGACCAATTACAGGTGGTGAAACGGTTATCGTTGCTCGCTCA
AGCGGCTTTGGCACTAGTGGAAAGCGATGGTTTTGAATTTACACAACAAA
CTATAATGGCGAAAGCATGGAAGCATTGAAAGAACGTTTCACAAACTCCA
GAGATCATCTTCCACACATGGTTGTCATGACTCCCTATGATGTAGATGGT
ACCTTATGGACAAAACAACAACCCTCACCGCAGTTCATCTCTTTGTGGAT
TTGTTCGATTCTTGGATCATATAGCGACCTTCGATTGGAATGCAAACCCT
TTGATTGTCAACCTCAATAGCGAAATCAAAATTTGAACGGTCAATTCGGT
GCATTTTCGCTGACGTGTCGCCTGGCGAAGAGGTGGATGAGTAGTCAGAT
GTTGTCCAATCATTTCTATGAAGAGTTGATCGAGTTGTTGGTCGCCTCCG
TCTTTCTCTCACCAAACCCACCTAAAACGGCTACGTTTTTCGTTTGTCGG
TCATCCATTACCGAGAAATGGTTTTACATAAAGAAAATGTAGCCTTGGGA
AAATCAAAAACTTCCCATGACATCCAGGCTAAGAAGTTGGAAATGGAAAT
TGTGAAAAAGCCCCTCCATAACTCCCTCATTCACAGCTTATATCCAGTTT
GAAGGGAGCGGTCAATGGCCTGATAATTTAGAAGCAATCCAACACATACG
CGCTGCTTTCCACATCAAAGTTGCAGAATGCATACGTCAGCAACTTCATT
TCCCTGCAAAAGCGACTCCAAGGTGGATCGATGTGATGAAACCATTGACT
GCTCGACAATACGAAGTCAAGGAGCAATCAAAAGGTCAAGATTTTCTGGT
ACCCAGTAACGCAAAAAGATCACCGCTTTGGTGTCCTGTAATAAAAGGCA
TTGTGCAATCTATCCTTCATCCATCGATTACCATGGCAACTCGTTCGATT
TCATTCTCTCTTCGAACACGTCATCGTTCGAGCACGCGTCAGCCAATCAG
AAGAAAGCCACAATACCACGTGGTTGTGGTGAAGAAGAGAGCACTCACGT
GATCAAAACATTTGAAGAATTGAGTCGTCAGCTACGTGGTTTGAGTGAAT
TACCTTTAGTCGTCAACAATATACATGCAGTGGACCCATTGCTTAGGATG
ACAGAGGCGAAAGAGTTCCGCGCATTTTGGGGCGAGAAATCAGAATTGAG
GCGTTTTCAAGATGGCAGTATCAACGAGGCGGTAGTTTGGCCATCATCCA
ATTCCAGCCAGAAAAAAATGGTCTGCAAACAGATCGTACAACATCTTCTT
AAACTTGGTCGGTGAACGAGTCGTGCCCAGACTCTTCAAAAGGACCAATC
ACAGTGGGAGTCTGCTTGAACGCGTCCAATTATGACAATGTTTTGATCAT
GGGCCCTCCTGCTGATCAACCTCAGAATAAATGACGCCGGCTCCTTTACA
ACCAAATTGTCAACGGAGGAAAATAACAAGTTGATAAGCTATGGTGGCAA
CGCGCGTCCGATTCTGTTGGAAAAAATGTCCGAAATTTTAAGACGGGGAT
TGGACGAAAGAATAACGAGTCTATTTATGAAACCCTCGCCTCTGGTTCAG
TTGCGATATGAAGCTCAGCAATCGTTGGCGTTATTGGACAGTACTGAAGA
AGGCTCCTTTGAATTACTTTTCATCAAAACCAAATCCTTCCTTCAAACCG
TCGATCATATGTTCAGCTGCCATCTTTAAAAGACTTTCACGGTGTATATC
CGGTTGTTTTTGTGGACTCAAGTGGTCACCTCAACCTTTGCTCGTCACTC
GATACCATCTCCTATCAAATGGTACATCTGATTGGTCGAAGGAAGGAATC
ACTTTGAATAAAGATACCAATGAAGATGAAAAGGGTAATGTACCATTTAA
TGGGTTTTGTTGTTCAATGTTGCTGGTGTATTTGTTGTCAGTACGAAAGA
TTTCTGCACACATGAGCTCCTATCAAATGTTTCGACTTACTCTTCACTTC
ATTGAGTTTCCAACAGCAGATTACAACAATGGAGTTCTGGAGGACATGTT
ATACGAAGATCACTTACGATTGTTGTACTCTACTCTCAAAGAATGTCCTG
GTATGAGTGAAGCCATCCTACTCCTCAAAACGTGGCTCAAACAACGAAGT
TACAAGGGAAAGTTGGGAAAAAATTTAACGTTGTGCTTCACCTAGCTACA
CCCGAAGGGCATTTCAAGTTGTCACGGTTTTTACCGCTGAAAAATAACAT
AAGACATAATTGGTATCACGGCTATGAACAGGATACAACAGAAGAAATTG
GCTGTGTTACATGGAAAAGATTATCTGAACTATCGTTATTACTACAAACG
AGCTATATATCTTTCATGGTTGGCTTATTACTTGAAAGATTGGGAACACA
CAGAAGATCTCTCCTTTACCTGTGGAACAAATATCTTCAAACCAACTTTG
AAAATTAATTTGAAAGATGAAAGGAAAATTTTGTTTTCACACTCCCTCTG
AAATAAAAGTTGTTGGTAGCTTTTTATTGAAAACTATGATCAAAGCGAAT
CATTCAATTGACATTGCTGTACAAATGCCACAGATCACAACAAACGAAGA
AACAATGCTAAAAACGAACACTAAAGCCATCATCCAAGACTTTTCAATCC
TGGGTCAAGGTTTAGTAAAGAATATACAAGTAGTGAATCAAGTGTAAATA
ATGAACGCAAAATACAAACATGTCGAAGAAGATGTCGCACAAAAGAAAAA
GAAAAAACAGAAAGCTAAAGATACAAAGGAACTTTTCAATGATACCGCTA
TGTTCTTTTGCGATCAATACGGGGGAAGTCAAATTGGTGTGGTGTGGAAA
CGAAACAAACTCGCTGCTCAACCTTTCAAACAATTATTTCGTCCTTCCAC
AAAAGATTATGATATCGTTATTGAGTTGGATAAAAACCATGTGCCGAAAC
TACCTTTCATCCAATCTTCAAAAAGTGTCCACAAATCGTCTGATGTGAAA
TTAGCATCAATGGTGTCGAACAATGTATCGAATGAAGTCCTCCCTGTTGT
CGACTTTGACCCTGCTCGCTCGTTCCTCGACCAATTACAGGTGGTGAAAC
GGTTATCGTTGCTCGCTCAAGCGGCTTTGGCACTAGTGGAAAGCGATGGT
TTTGAATTTACACAACAAACTATAATGGCGAAAGCATGGAAGCATTGAAA
GAACGTTTCACAAACTCCAGAGATCATCTTCCACACATGGTTGTCATGAC
TCCCTATGATGTAGATGGTACCTTATGGACAAAACAACAACCCTCACCGC
AGTTCATCTCTTTGTGGATTTGTTCGATTCTTGGATCATATAGCGACCTT
CGATTGGAATGCAAACCCTTTGATTGTCAACCTCAATAGCGAAATCAAAA
TTTGAACGGTCAATTCGGTGCATTTTCGCTGACGTGTCGCCTGGCGAAGA
GGTGGATGAGTAGTCAGATGTTGTCCAATCATTTCTATGAAGAGTTGATC
GAGTTGTTGGTCGCCTCCGTCTTTCTCTCACCAAACCCACCTAAAACGGC
TACGTTTTTCGTTTGTCGGTCATCCATTACCGAGAAATGGTTTTACATAA
AGAAAATGTAGCCTTGGGAAAATCAAAAACTTCCCATGACATCCAGGCTA
AGAAGTTGGAAATGGAAATTGTGAAAAAGCCCCTCCATAACTCCCTCATT
CACAGCTTATATCCAGTTTGAAGGGAGCGGTCAATGGCCTGATAATTTAG
AAGCAATCCAACACATACGCGCTGCTTTCCACATCAAAGTTGCAGAATGC
ATACGTCAGCAACTTCATTTCCCTGCAAAAGCGACTCCAAGGTGGATCGA
TGTGATGAAACCATTGACTGCTCGACAATACGAAGTCAAGGAGCAATCAA
AAGGTCAAGATTTTCTGGTACCCAGTAACGCAAAAAGATCACCGCTTTGG
TGTCCTGTAATAAAAGGCATTGTGCAATCTATCCTTCATCCATCGATTAC
CATGGCAACTCGTTCGATTTCATTCTCTCTTCGAACACGTCATCGTTCGA
GCACGCGTCAGCCAATCAGAAGAAAGCCACAATACCACGTGGTTGTGGTG
AAGAAGAGAGCACTCACGTGATCAAAACATTTGAAGAATTGAGTCGTCAG
CTACGTGGTTTGAGTGAATTACCTTTAGTCGTCAACAATATACATGCAGT
GGACCCATTGCTTAGGATGACAGAGGCGAAAGAGTTCCGCGCATTTTGGG
GCGAGAAATCAGAATTGAGGCGTTTTCAAGATGGCAGTATCAACGAGGCG
GTAGTTTGGCCATCATCCAATTCCAGCCAGAAAAAAATGGTCTGCAAACA
GATCGTACAACATCTTCTTAAACTTGGTCGGTGAACGAGTCGTGCCCAGA
CTCTTCAAAAGGACCAATCACAGTGGGAGTCTGCTTGAACGCGTCCAATT
ATGACAATGTTTTGATCATGGGCCCTCCTGCTGATCAACCTCAGAATAAA
TGACGCCGGCTCCTTTACAACCAAATTGTCAACGGAGGAAAATAACAAGT
TGATAAGCTATGGTGGCAACGCGCGTCCGATTCTGTTGGAAAAAATGTCC
GAAATTTTAAGACGGGGATTGGACGAAAGAATAACGAGTCTATTTATGAA
ACCCTCGCCTCTGGTTCAGTTGCGATATGAAGCTCAGCAATCGTTGGCGT
TATTGGACAGTACTGAAGAAGGCTCCTTTGAATTACTTTTCATCAAAACC
AAATCCTTCCTTCAAACCGTCGATCATATGTTCAGCTGCCATCTTTAAAA
GACTTTCACGGTGTATATCCGGTTGTTTTTGTGGACTCAAGTGGTCACCT
CAACCTTTGCTCGTCACTCGATACCATCTCCTATCAAATGGTACATCTGA
TTGGTCGAAGGAAGGAATCACTTTGAATAAAGATACCAATGAAGATGAAA
AGGGTAATGTACCATTTAATGGGTTTTGTTGTTCAATGTTGCTGGTGTAT
TTGTTGTCAGTACGAAAGATTTCTGCACACATGAGCTCCTATCAAATGTT
TCGACTTACTCTTCACTTCATTGAGTTTCCAACAGCAGATTACAACAATG
GAGTTCTGGAGGACATGTTATACGAAGATCACTTACGATTGTTGTACTCT
ACTCTCAAAGAATGTCCTGGTATGAGTGAAGCCATCCTACTCCTCAAAAC
GTGGCTCAAACAACGAAGTTACAAGGGAAAGTTGGGAAAAAATTTAACGT
TGTGCTTCACCTAGCTACACCCGAAGGGCATTTCAAGTTGTCACGGTTTT
TACCGCTGAAAAATAACATAAGACATAATTGGTATCACGGCTATGAACAG
GATACAACAGAAGAAATTGGCTGTGTTACATGGAAAAGATTATCTGAACT
ATCGTTATTACTACAAACGAGCTATATATCTTTCATGGTTGGCTTATTAC
TTGAAAGATTGGGAACACACAGAAGATCTCTCCTTTACCTGTGGAACAAA
TATCTTCAAACCAACTTTGAAAATTAATTTGAAAGATGAAAGGAAAATTT
TGTTTTCACACTCCCTCTGAAATAAAAGTTGTTGGTAGCTTTTTATTGAA
AACTATGATCAAAGCGAATCATTCAATTGACATTGCTGTACAAATGCCAC
AGATCACAACAAACGAAGAAACAATGCTAAAAACGAACACTAAAGCCATC
ATCCAAGACTTTTCAATCCTGGGTCAAGGTTTAGTAAAGAATATACAAGT
AGTGAATCAAGTGTAAATAATGAACGCAAAATACAAACATGTCGAAGAAG
ATGTCGCACAAAAGAAAAAGAAAAAACAGAAAGCTAAAGATACAAAGGAA
CTTTTCAATGATACCGCTATGTTCTTTTGCGATCAATACGGGGGAAGTCA
AATTGGTGTGGTGTGGAAACGAAACAAACTCGCTGCTCAACCTTTCAAAC
AATTATTTCGTCCTTCCACAAAAGATTATGATATCGTTATTGAGTTGGAT
AAAAACCATGTGCCGAAACTACCTTTCATCCAATCTTCAAAAAGTGTCCA
CAAATCGTCTGATGTGAAATTAGCATCAATGGTGTCGAACAATGTATCGA
ATGAAGTCCTCCCTGTTGTCGACTTTGACCCTGCTCGCTCGTTCCTCGAC
CAATTACAGGTGGTGAAACGGTTATCGTTGCTCGCTCAAGCGGCTTTGGC
ACTAGTGGAAAGCGATGGTTTTGAATTTACACAACAAACTATAATGGCGA
AAGCATGGAAGCATTGAAAGAACGTTTCACAAACTCCAGAGATCATCTTC
CACACATGGTTGTCATGACTCCCTATGATGTAGATGGTACCTTATGGACA
AAACAACAACCCTCACCGCAGTTCATCTCTTTGTGGATTTGTTCGATTCT
TGGATCATATAGCGACCTTCGATTGGAATGCAAACCCTTTGATTGTCAAC
CTCAATAGCGAAATCAAAATTTGAACGGTCAATTCGGTGCATTTTCGCTG
ACGTGTCGCCTGGCGAAGAGGTGGATGAGTAGTCAGATGTTGTCCAATCA
TTTCTATGAAGAGTTGATCGAGTTGTTGGTCGCCTCCGTCTTTCTCTCAC
CAAACCCACCTAAAACGGCTACGTTTTTCGTTTGTCGGTCATCCATTACC
GAGAAATGGTTTTACATAAAGAAAATGTAGCCTTGGGAAAATCAAAAACT
TCCCATGACATCCAGGCTAAGAAGTTGGAAATGGAAATTGTGAAAAAGCC
CCTCCATAACTCCCTCATTCACAGCTTATATCCAGTTTGAAGGGAGCGGT
CAATGGCCTGATAATTTAGAAGCAATCCAACACATACGCGCTGCTTTCCA
CATCAAAGTTGCAGAATGCATACGTCAGCAACTTCATTTCCCTGCAAAAG
CGACTCCAAGGTGGATCGATGTGATGAAACCATTGACTGCTCGACAATAC
GAAGTCAAGGAGCAATCAAAAGGTCAAGATTTTCTGGTACCCAGTAACGC
AAAAAGATCACCGCTTTGGTGTCCTGTAATAAAAGGCATTGTGCAATCTA
TCCTTCATCCATCGATTACCATGGCAACTCGTTCGATTTCATTCTCTCTT
CGAACACGTCATCGTTCGAGCACGCGTCAGCCAATCAGAAGAAAGCCACA
ATACCACGTGGTTGTGGTGAAGAAGAGAGCACTCACGTGATCAAAACATT
TGAAGAATTGAGTCGTCAGCTACGTGGTTTGAGTGAATTACCTTTAGTCG
TCAACAATATACATGCAGTGGACCCATTGCTTAGGATGACAGAGGCGAAA
GAGTTCCGCGCATTTTGGGGCGAGAAATCAGAATTGAGGCGTTTTCAAGA
TGGCAGTATCAACGAGGCGGTAGTTTGGCCATCATCCAATTCCAGCCAGA
AAAAAATGGTCTGCAAACAGATCGTACAACATCTTCTTAAACTTGGTCGG
TGAACGAGTCGTGCCCAGACTCTTCAAAAGGACCAATCACAGTGGGAGTC
TGCTTGAACGCGTCCAATTATGACAATGTTTTGATCATGGGCCCTCCTGC
TGATCAACCTCAGAATAAATGACGCCGGCTCCTTTACAACCAAATTGTCA
ACGGAGGAAAATAACAAGTTGATAAGCTATGGTGGCAACGCGCGTCCGAT
TCTGTTGGAAAAAATGTCCGAAATTTTAAGACGGGGATTGGACGAAAGAA
TAACGAGTCTATTTATGAAACCCTCGCCTCTGGTTCAGTTGCGATATGAA
GCTCAGCAATCGTTGGCGTTATTGGACAGTACTGAAGAAGGCTCCTTTGA
ATTACTTTTCATCAAAACCAAATCCTTCCTTCAAACCGTCGATCATATGT
TCAGCTGCCATCTTTAAAAGACTTTCACGGTGTATATCCGGTTGTTTTTG
TGGACTCAAGTGGTCACCTCAACCTTTGCTCGTCACTCGATACCATCTCC
TATCAAATGGTACATCTGATTGGTCGAAGGAAGGAATCACTTTGAATAAA
GATACCAATGAAGATGAAAAGGGTAATGTACCATTTAATGGGTTTTGTTG
TTCAATGTTGCTGGTGTATTTGTTGTCAGTACGAAAGATTTCTGCACACA
TGAGCTCCTATCAAATGTTTCGACTTACTCTTCACTTCATTGAGTTTCCA
ACAGCAGATTACAACAATGGAGTTCTGGAGGACATGTTATACGAAGATCA
CTTACGATTGTTGTACTCTACTCTCAAAGAATGTCCTGGTATGAGTGAAG
CCATCCTACTCCTCAAAACGTGGCTCAAACAACGAAGTTACAAGGGAAAG
TTGGGAAAAAATTTAACGTTGTGCTTCACCTAGCTACACCCGAAGGGCAT
TTCAAGTTGTCACGGTTTTTACCGCTGAAAAATAACATAAGACATAATTG
GTATCACGGCTATGAACAGGATACAACAGAAGAAATTGGCTGTGTTACAT
GGAAAAGATTATCTGAACTATCGTTATTACTACAAACGAGCTATATATCT
TTCATGGTTGGCTTATTACTTGAAAGATTGGGAACACACAGAAGATCTCT
CCTTTACCTGTGGAACAAATATCTTCAAACCAACTTTGAAAATTAATTTG
AAAGATGAAAGGAAAATTTTGTTTTCACACTCCCTCTGAAATAAAAGTTG
TTGGTAGCTTTTTATTGAAAACTATGATCAAAGCGAATCATTCAATTGAC
ATTGCTGTACAAATGCCACAGATCACAACAAACGAAGAAACAATGCTAAA
AACGAACACTAAAGCCATCATCCAAGACTTTTCAATCCTGGGTCAAGGTT
TAGTAAAGAATATACAAGTAGTGAATCAAGTGTAAATAATGAACGCAAAA
TACAAACATGTCGAAGAAGATGTCGCACAAAAGAAAAAGAAAAAACAGAA
AGCTAAAGATACAAAGGAACTTTTCAATGATACCGCTATGTTCTTTTGCG
ATCAATACGGGGGAAGTCAAATTGGTGTGGTGTGGAAACGAAACAAACTC
GCTGCTCAACCTTTCAAACAATTATTTCGTCCTTCCACAAAAGATTATGA
TATCGTTATTGAGTTGGATAAAAACCATGTGCCGAAACTACCTTTCATCC
AATCTTCAAAAAGTGTCCACAAATCGTCTGATGTGAAATTAGCATCAATG
GTGTCGAACAATGTATCGAATGAAGTCCTCCCTGTTGTCGACTTTGACCC
TGCTCGCTCGTTCCTCGACCAATTACAGGTGGTGAAACGGTTATCGTTGC
TCGCTCAAGCGGCTTTGGCACTAGTGGAAAGCGATGGTTTTGAATTTACA
CAACAAACTATAATGGCGAAAGCATGGAAGCATTGAAAGAACGTTTCACA
AACTCCAGAGATCATCTTCCACACATGGTTGTCATGACTCCCTATGATGT
AGATGGTACCTTATGGACAAAACAACAACCCTCACCGCAGTTCATCTCTT
TGTGGATTTGTTCGATTCTTGGATCATATAGCGACCTTCGATTGGAATGC
AAACCCTTTGATTGTCAACCTCAATAGCGAAATCAAAATTTGAACGGTCA
ATTCGGTGCATTTTCGCTGACGTGTCGCCTGGCGAAGAGGTGGATGAGTA
GTCAGATGTTGTCCAATCATTTCTATGAAGAGTTGATCGAGTTGTTGGTC
GCCTCCGTCTTTCTCTCACCAAACCCACCTAAAACGGCTACGTTTTTCGT
TTGTCGGTCATCCATTACCGAGAAATGGTTTTACATAAAGAAAATGTAGC
CTTGGGAAAATCAAAAACTTCCCATGACATCCAGGCTAAGAAGTTGGAAA
TGGAAATTGTGAAAAAGCCCCTCCATAACTCCCTCATTCACAGCTTATAT
CCAGTTTGAAGGGAGCGGTCAATGGCCTGATAATTTAGAAGCAATCCAAC
ACATACGCGCTGCTTTCCACATCAAAGTTGCAGAATGCATACGTCAGCAA
CTTCATTTCCCTGCAAAAGCGACTCCAAGGTGGATCGATGTGATGAAACC
ATTGACTGCTCGACAATACGAAGTCAAGGAGCAATCAAAAGGTCAAGATT
TTCTGGTACCCAGTAACGCAAAAAGATCACCGCTTTGGTGTCCTGTAATA
AAAGGCATTGTGCAATCTATCCTTCATCCATCGATTACCATGGCAACTCG
TTCGATTTCATTCTCTCTTCGAACACGTCATCGTTCGAGCACGCGTCAGC
CAATCAGAAGAAAGCCACAATACCACGTGGTTGTGGTGAAGAAGAGAGCA
CTCACGTGATCAAAACATTTGAAGAATTGAGTCGTCAGCTACGTGGTTTG
AGTGAATTACCTTTAGTCGTCAACAATATACATGCAGTGGACCCATTGCT
TAGGATGACAGAGGCGAAAGAGTTCCGCGCATTTTGGGGCGAGAAATCAG
AATTGAGGCGTTTTCAAGATGGCAGTATCAACGAGGCGGTAGTTTGGCCA
TCATCCAATTCCAGCCAGAAAAAAATGGTCTGCAAACAGATCGTACAACA
TCTTCTTAAACTTGGTCGGTGAACGAGTCGTGCCCAGACTCTTCAAAAGG
ACCAATCACAGTGGGAGTCTGCTTGAACGCGTCCAATTATGACAATGTTT
TGATCATGGGCCCTCCTGCTGATCAACCTCAGAATAAATGACGCCGGCTC
CTTTACAACCAAATTGTCAACGGAGGAAAATAACAAGTTGATAAGCTATG
GTGGCAACGCGCGTCCGATTCTGTTGGAAAAAATGTCCGAAATTTTAAGA
CGGGGATTGGACGAAAGAATAACGAGTCTATTTATGAAACCCTCGCCTCT
GGTTCAGTTGCGATATGAAGCTCAGCAATCGTTGGCGTTATTGGACAGTA
CTGAAGAAGGCTCCTTTGAATTACTTTTCATCAAAACCAAATCCTTCCTT
CAAACCGTCGATCATATGTTCAGCTGCCATCTTTAAAAGACTTTCACGGT
GTATATCCGGTTGTTTTTGTGGACTCAAGTGGTCACCTCAACCTTTGCTC
GTCACTCGATACCATCTCCTATCAAATGGTACATCTGATTGGTCGAAGGA
AGGAATCACTTTGAATAAAGATACCAATGAAGATGAAAAGGGTAATGTAC
CATTTAATGGGTTTTGTTGTTCAATGTTGCTGGTGTATTTGTTGTCAGTA
CGAAAGATTTCTGCACACATGAGCTCCTATCAAATGTTTCGACTTACTCT
TCACTTCATTGAGTTTCCAACAGCAGATTACAACAATGGAGTTCTGGAGG
ACATGTTATACGAAGATCACTTACGATTGTTGTACTCTACTCTCAAAGAA
TGTCCTGGTATGAGTGAAGCCATCCTACTCCTCAAAACGTGGCTCAAACA
ACGAAGTTACAAGGGAAAGTTGGGAAAAAATTTAACGTTGTGCTTCACCT
AGCTACACCCGAAGGGCATTTCAAGTTGTCACGGTTTTTACCGCTGAAAA
ATAACATAAGACATAATTGGTATCACGGCTATGAACAGGATACAACAGAA
GAAATTGGCTGTGTTACATGGAAAAGATTATCTGAACTATCGTTATTACT
ACAAACGAGCTATATATCTTTCATGGTTGGCTTATTACTTGAAAGATTGG
GAACACACAGAAGATCTCTCCTTTACCTGTGGAACAAATATCTTCAAACC
AACTTTGAAAATTAATTTGAAAGATGAAAGGAAAATTTTGTTTTCACACT
CCCTCTGAAATAAAAGTTGTTGGTAGCTTTTTATTGAAAACTATGATCAA
AGCGAATCATTCAATTGACATTGCTGTACAAATGCCACAGATCACAACAA
ACGAAGAAACAATGCTAAAAACGAACACTAAAGCCATCATCCAAGACTTT
TCAATCCTGGGTCAAGGTTTAGTAAAGAATATACAAGTAGTGAATCAAGT
GTAAATAATGAACGCAAAATACAAACATGTCGAAGAAGATGTCGCACAAA
AGAAAAAGAAAAAACAGAAAGCTAAAGATACAAAGGAACTTTTCAATGAT
ACCGCTATGTTCTTTTGCGATCAATACGGGGGAAGTCAAATTGGTGTGGT
GTGGAAACGAAACAAACTCGCTGCTCAACCTTTCAAACAATTATTTCGTC
CTTCCACAAAAGATTATGATATCGTTATTGAGTTGGATAAAAACCATGTG
CCGAAACTACCTTTCATCCAATCTTCAAAAAGTGTCCACAAATCGTCTGA
TGTGAAATTAGCATCAATGGTGTCGAACAATGTATCGAATGAAGTCCTCC
CTGTTGTCGACTTTGACCCTGCTCGCTCGTTCCTCGACCAATTACAGGTG
GTGAAACGGTTATCGTTGCTCGCTCAAGCGGCTTTGGCACTAGTGGAAAG
CGATGGTTTTGAATTTACACAACAAACTATAATGGCGAAAGCATGGAAGC
ATTGAAAGAACGTTTCACAAACTCCAGAGATCATCTTCCACACATGGTTG
TCATGACTCCCTATGATGTAGATGGTACCTTATGGACAAAACAACAACCC
TCACCGCAGTTCATCTCTTTGTGGATTTGTTCGATTCTTGGATCATATAG
CGACCTTCGATTGGAATGCAAACCCTTTGATTGTCAACCTCAATAGCGAA
ATCAAAATTTGAACGGTCAATTCGGTGCATTTTCGCTGACGTGTCGCCTG
GCGAAGAGGTGGATGAGTAGTCAGATGTTGTCCAATCATTTCTATGAAGA
GTTGATCGAGTTGTTGGTCGCCTCCGTCTTTCTCTCACCAAACCCACCTA
AAACGGCTACGTTTTTCGTTTGTCGGTCATCCATTACCGAGAAATGGTTT
TACATAAAGAAAATGTAGCCTTGGGAAAATCAAAAACTTCCCATGACATC
CAGGCTAAGAAGTTGGAAATGGAAATTGTGAAAAAGCCCCTCCATAACTC
CCTCATTCACAGCTTATATCCAGTTTGAAGGGAGCGGTCAATGGCCTGAT
AATTTAGAAGCAATCCAACACATACGCGCTGCTTTCCACATCAAAGTTGC
AGAATGCATACGTCAGCAACTTCATTTCCCTGCAAAAGCGACTCCAAGGT
GGATCGATGTGATGAAACCATTGACTGCTCGACAATACGAAGTCAAGGAG
CAATCAAAAGGTCAAGATTTTCTGGTACCCAGTAACGCAAAAAGATCACC
GCTTTGGTGTCCTGTAATAAAAGGCATTGTGCAATCTATCCTTCATCCAT
CGATTACCATGGCAACTCGTTCGATTTCATTCTCTCTTCGAACACGTCAT
CGTTCGAGCACGCGTCAGCCAATCAGAAGAAAGCCACAATACCACGTGGT
TGTGGTGAAGAAGAGAGCACTCACGTGATCAAAACATTTGAAGAATTGAG
TCGTCAGCTACGTGGTTTGAGTGAATTACCTTTAGTCGTCAACAATATAC
ATGCAGTGGACCCATTGCTTAGGATGACAGAGGCGAAAGAGTTCCGCGCA
TTTTGGGGCGAGAAATCAGAATTGAGGCGTTTTCAAGATGGCAGTATCAA
CGAGGCGGTAGTTTGGCCATCATCCAATTCCAGCCAGAAAAAAATGGTCT
GCAAACAGATCGTACAACATCTTCTTAAACTTGGTCGGTGAACGAGTCGT
GCCCAGACTCTTCAAAAGGACCAATCACAGTGGGAGTCTGCTTGAACGCG
TCCAATTATGACAATGTTTTGATCATGGGCCCTCCTGCTGATCAACCTCA
GAATAAATGACGCCGGCTCCTTTACAACCAAATTGTCAACGGAGGAAAAT
AACAAGTTGATAAGCTATGGTGGCAACGCGCGTCCGATTCTGTTGGAAAA
AATGTCCGAAATTTTAAGACGGGGATTGGACGAAAGAATAACGAGTCTAT
TTATGAAACCCTCGCCTCTGGTTCAGTTGCGATATGAAGCTCAGCAATCG
TTGGCGTTATTGGACAGTACTGAAGAAGGCTCCTTTGAATTACTTTTCAT
CAAAACCAAATCCTTCCTTCAAACCGTCGATCATATGTTCAGCTGCCATC
TTTAAAAGACTTTCACGGTGTATATCCGGTTGTTTTTGTGGACTCAAGTG
GTCACCTCAACCTTTGCTCGTCACTCGATACCATCTCCTATCAAATGGTA
CATCTGATTGGTCGAAGGAAGGAATCACTTTGAATAAAGATACCAATGAA
GATGAAAAGGGTAATGTACCATTTAATGGGTTTTGTTGTTCAATGTTGCT
GGTGTATTTGTTGTCAGTACGAAAGATTTCTGCACACATGAGCTCCTATC
AAATGTTTCGACTTACTCTTCACTTCATTGAGTTTCCAACAGCAGATTAC
AACAATGGAGTTCTGGAGGACATGTTATACGAAGATCACTTACGATTGTT
GTACTCTACTCTCAAAGAATGTCCTGGTATGAGTGAAGCCATCCTACTCC
TCAAAACGTGGCTCAAACAACGAAGTTACAAGGGAAAGTTGGGAAAAAAT
TTAACGTTGTGCTTCACCTAGCTACACCCGAAGGGCATTTCAAGTTGTCA
CGGTTTTTACCGCTGAAAAATAACATAAGACATAATTGGTATCACGGCTA
TGAACAGGATACAACAGAAGAAATTGGCTGTGTTACATGGAAAAGATTAT
CTGAACTATCGTTATTACTACAAACGAGCTATATATCTTTCATGGTTGGC
TTATTACTTGAAAGATTGGGAACACACAGAAGATCTCTCCTTTACCTGTG
GAACAAATATCTTCAAACCAACTTTGAAAATTAATTTGAAAGATGAAAGG
AAAATTTTGTTTTCACACTCCCTCTGAAATAAAAGTTGTTGGTAGCTTTT
TATTGAAAACTATGATCAAAGCGAATCATTCAATTGACATTGCTGTACAA
ATGCCACAGATCACAACAAACGAAGAAACAATGCTAAAAACGAACACTAA
AGCCATCATCCAAGACTTTTCAATCCTGGGTCAAGGTTTAGTAAAGAATA
TACAAGTAGTGAATCAAGTGTAAATAATGAACGCAAAATACAAACATGTC
GAAGAAGATGTCGCACAAAAGAAAAAGAAAAAACAGAAAGCTAAAGATAC
AAAGGAACTTTTCAATGATACCGCTATGTTCTTTTGCGATCAATACGGGG
GAAGTCAAATTGGTGTGGTGTGGAAACGAAACAAACTCGCTGCTCAACCT
TTCAAACAATTATTTCGTCCTTCCACAAAAGATTATGATATCGTTATTGA
GTTGGATAAAAACCATGTGCCGAAACTACCTTTCATCCAATCTTCAAAAA
GTGTCCACAAATCGTCTGATGTGAAATTAGCATCAATGGTGTCGAACAAT
GTATCGAATGAAGTCCTCCCTGTTGTCGACTTTGACCCTGCTCGCTCGTT
CCTCGACCAATTACAGGTGGTGAAACGGTTATCGTTGCTCGCTCAAGCGG
CTTTGGCACTAGTGGAAAGCGATGGTTTTGAATTTACACAACAAACTATA
ATGGCGAAAGCATGGAAGCATTGAAAGAACGTTTCACAAACTCCAGAGAT
CATCTTCCACACATGGTTGTCATGACTCCCTATGATGTAGATGGTACCTT
ATGGACAAAACAACAACCCTCACCGCAGTTCATCTCTTTGTGGATTTGTT
CGATTCTTGGATCATATAGCGACCTTCGATTGGAATGCAAACCCTTTGAT
TGTCAACCTCAATAGCGAAATCAAAATTTGAACGGTCAATTCGGTGCATT
TTCGCTGACGTGTCGCCTGGCGAAGAGGTGGATGAGTAGTCAGATGTTGT
CCAATCATTTCTATGAAGAGTTGATCGAGTTGTTGGTCGCCTCCGTCTTT
CTCTCACCAAACCCACCTAAAACGGCTACGTTTTTCGTTTGTCGGTCATC
CATTACCGAGAAATGGTTTTACATAAAGAAAATGTAGCCTTGGGAAAATC
AAAAACTTCCCATGACATCCAGGCTAAGAAGTTGGAAATGGAAATTGTGA
AAAAGCCCCTCCATAACTCCCTCATTCACAGCTTATATCCAGTTTGAAGG
GAGCGGTCAATGGCCTGATAATTTAGAAGCAATCCAACACATACGCGCTG
CTTTCCACATCAAAGTTGCAGAATGCATACGTCAGCAACTTCATTTCCCT
GCAAAAGCGACTCCAAGGTGGATCGATGTGATGAAACCATTGACTGCTCG
ACAATACGAAGTCAAGGAGCAATCAAAAGGTCAAGATTTTCTGGTACCCA
GTAACGCAAAAAGATCACCGCTTTGGTGTCCTGTAATAAAAGGCATTGTG
CAATCTATCCTTCATCCATCGATTACCATGGCAACTCGTTCGATTTCATT
CTCTCTTCGAACACGTCATCGTTCGAGCACGCGTCAGCCAATCAGAAGAA
AGCCACAATACCACGTGGTTGTGGTGAAGAAGAGAGCACTCACGTGATCA
AAACATTTGAAGAATTGAGTCGTCAGCTACGTGGTTTGAGTGAATTACCT
TTAGTCGTCAACAATATACATGCAGTGGACCCATTGCTTAGGATGACAGA
GGCGAAAGAGTTCCGCGCATTTTGGGGCGAGAAATCAGAATTGAGGCGTT
TTCAAGATGGCAGTATCAACGAGGCGGTAGTTTGGCCATCATCCAATTCC
AGCCAGAAAAAAATGGTCTGCAAACAGATCGTACAACATCTTCTTAAACT
TGGTCGGTGAACGAGTCGTGCCCAGACTCTTCAAAAGGACCAATCACAGT
GGGAGTCTGCTTGAACGCGTCCAATTATGACAATGTTTTGATCATGGGCC
CTCCTGCTGATCAACCTCAGAATAAATGACGCCGGCTCCTTTACAACCAA
ATTGTCAACGGAGGAAAATAACAAGTTGATAAGCTATGGTGGCAACGCGC
GTCCGATTCTGTTGGAAAAAATGTCCGAAATTTTAAGACGGGGATTGGAC
GAAAGAATAACGAGTCTATTTATGAAACCCTCGCCTCTGGTTCAGTTGCG
ATATGAAGCTCAGCAATCGTTGGCGTTATTGGACAGTACTGAAGAAGGCT
CCTTTGAATTACTTTTCATCAAAACCAAATCCTTCCTTCAAACCGTCGAT
CATATGTTCAGCTGCCATCTTTAAAAGACTTTCACGGTGTATATCCGGTT
GTTTTTGTGGACTCAAGTGGTCACCTCAACCTTTGCTCGTCACTCGATAC
CATCTCCTATCAAATGGTACATCTGATTGGTCGAAGGAAGGAATCACTTT
GAATAAAGATACCAATGAAGATGAAAAGGGTAATGTACCATTTAATGGGT
TTTGTTGTTCAATGTTGCTGGTGTATTTGTTGTCAGTACGAAAGATTTCT
GCACACATGAGCTCCTATCAAATGTTTCGACTTACTCTTCACTTCATTGA
GTTTCCAACAGCAGATTACAACAATGGAGTTCTGGAGGACATGTTATACG
AAGATCACTTACGATTGTTGTACTCTACTCTCAAAGAATGTCCTGGTATG
AGTGAAGCCATCCTACTCCTCAAAACGTGGCTCAAACAACGAAGTTACAA
GGGAAAGTTGGGAAAAAATTTAACGTTGTGCTTCACCTAGCTACACCCGA
AGGGCATTTCAAGTTGTCACGGTTTTTACCGCTGAAAAATAACATAAGAC
ATAATTGGTATCACGGCTATGAACAGGATACAACAGAAGAAATTGGCTGT
GTTACATGGAAAAGATTATCTGAACTATCGTTATTACTACAAACGAGCTA
TATATCTTTCATGGTTGGCTTATTACTTGAAAGATTGGGAACACACAGAA
GATCTCTCCTTTACCTGTGGAACAAATATCTTCAAACCAACTTTGAAAAT
TAATTTGAAAGATGAAAGGAAAATTTTGTTTTCACACTCCCTCTGAAATA
AAAGTTGTTGGTAGCTTTTTATTGAAAACTATGATCAAAGCGAATCATTC
AATTGACATTGCTGTACAAATGCCACAGATCACAACAAACGAAGAAACAA
TGCTAAAAACGAACACTAAAGCCATCATCCAAGACTTTTCAATCCTGGGT
CAAGGTTTAGTAAAGAATATACAAGTAGTGAATCAAGTGTAAATAATGAA
CGCAAAATACAAACATGTCGAAGAAGATGTCGCACAAAAGAAAAAGAAAA
AACAGAAAGCTAAAGATACAAAGGAACTTTTCAATGATACCGCTATGTTC
TTTTGCGATCAATACGGGGGAAGTCAAATTGGTGTGGTGTGGAAACGAAA
CAAACTCGCTGCTCAACCTTTCAAACAATTATTTCGTCCTTCCACAAAAG
ATTATGATATCGTTATTGAGTTGGATAAAAACCATGTGCCGAAACTACCT
TTCATCCAATCTTCAAAAAGTGTCCACAAATCGTCTGATGTGAAATTAGC
ATCAATGGTGTCGAACAATGTATCGAATGAAGTCCTCCCTGTTGTCGACT
TTGACCCTGCTCGCTCGTTCCTCGACCAATTACAGGTGGTGAAACGGTTA
TCGTTGCTCGCTCAAGCGGCTTTGGCACTAGTGGAAAGCGATGGTTTTGA
ATTTACACAACAAACTATAATGGCGAAAGCATGGAAGCATTGAAAGAACG
TTTCACAAACTCCAGAGATCATCTTCCACACATGGTTGTCATGACTCCCT
ATGATGTAGATGGTACCTTATGGACAAAACAACAACCCTCACCGCAGTTC
ATCTCTTTGTGGATTTGTTCGATTCTTGGATCATATAGCGACCTTCGATT
GGAATGCAAACCCTTTGATTGTCAACCTCAATAGCGAAATCAAAATTTGA
ACGGTCAATTCGGTGCATTTTCGCTGACGTGTCGCCTGGCGAAGAGGTGG
ATGAGTAGTCAGATGTTGTCCAATCATTTCTATGAAGAGTTGATCGAGTT
GTTGGTCGCCTCCGTCTTTCTCTCACCAAACCCACCTAAAACGGCTACGT
TTTTCGTTTGTCGGTCATCCATTACCGAGAAATGGTTTTACATAAAGAAA
ATGTAGCCTTGGGAAAATCAAAAACTTCCCATGACATCCAGGCTAAGAAG
TTGGAAATGGAAATTGTGAAAAAGCCCCTCCATAACTCCCTCATTCACAG
CTTATATCCAGTTTGAAGGGAGCGGTCAATGGCCTGATAATTTAGAAGCA
ATCCAACACATACGCGCTGCTTTCCACATCAAAGTTGCAGAATGCATACG
TCAGCAACTTCATTTCCCTGCAAAAGCGACTCCAAGGTGGATCGATGTGA
TGAAACCATTGACTGCTCGACAATACGAAGTCAAGGAGCAATCAAAAGGT
CAAGATTTTCTGGTACCCAGTAACGCAAAAAGATCACCGCTTTGGTGTCC
TGTAATAAAAGGCATTGTGCAATCTATCCTTCATCCATCGATTACCATGG
CAACTCGTTCGATTTCATTCTCTCTTCGAACACGTCATCGTTCGAGCACG
CGTCAGCCAATCAGAAGAAAGCCACAATACCACGTGGTTGTGGTGAAGAA
GAGAGCACTCACGTGATCAAAACATTTGAAGAATTGAGTCGTCAGCTACG
TGGTTTGAGTGAATTACCTTTAGTCGTCAACAATATACATGCAGTGGACC
CATTGCTTAGGATGACAGAGGCGAAAGAGTTCCGCGCATTTTGGGGCGAG
AAATCAGAATTGAGGCGTTTTCAAGATGGCAGTATCAACGAGGCGGTAGT
TTGGCCATCATCCAATTCCAGCCAGAAAAAAATGGTCTGCAAACAGATCG
TACAACATCTTCTTAAACTTGGTCGGTGAACGAGTCGTGCCCAGACTCTT
CAAAAGGACCAATCACAGTGGGAGTCTGCTTGAACGCGTCCAATTATGAC
AATGTTTTGATCATGGGCCCTCCTGCTGATCAACCTCAGAATAAATGACG
CCGGCTCCTTTACAACCAAATTGTCAACGGAGGAAAATAACAAGTTGATA
AGCTATGGTGGCAACGCGCGTCCGATTCTGTTGGAAAAAATGTCCGAAAT
TTTAAGACGGGGATTGGACGAAAGAATAACGAGTCTATTTATGAAACCCT
CGCCTCTGGTTCAGTTGCGATATGAAGCTCAGCAATCGTTGGCGTTATTG
GACAGTACTGAAGAAGGCTCCTTTGAATTACTTTTCATCAAAACCAAATC
CTTCCTTCAAACCGTCGATCATATGTTCAGCTGCCATCTTTAAAAGACTT
TCACGGTGTATATCCGGTTGTTTTTGTGGACTCAAGTGGTCACCTCAACC
TTTGCTCGTCACTCGATACCATCTCCTATCAAATGGTACATCTGATTGGT
CGAAGGAAGGAATCACTTTGAATAAAGATACCAATGAAGATGAAAAGGGT
AATGTACCATTTAATGGGTTTTGTTGTTCAATGTTGCTGGTGTATTTGTT
GTCAGTACGAAAGATTTCTGCACACATGAGCTCCTATCAAATGTTTCGAC
TTACTCTTCACTTCATTGAGTTTCCAACAGCAGATTACAACAATGGAGTT
CTGGAGGACATGTTATACGAAGATCACTTACGATTGTTGTACTCTACTCT
CAAAGAATGTCCTGGTATGAGTGAAGCCATCCTACTCCTCAAAACGTGGC
TCAAACAACGAAGTTACAAGGGAAAGTTGGGAAAAAATTTAACGTTGTGC
TTCACCTAGCTACACCCGAAGGGCATTTCAAGTTGTCACGGTTTTTACCG
CTGAAAAATAACATAAGACATAATTGGTATCACGGCTATGAACAGGATAC
AACAGAAGAAATTGGCTGTGTTACATGGAAAAGATTATCTGAACTATCGT
TATTACTACAAACGAGCTATATATCTTTCATGGTTGGCTTATTACTTGAA
AGATTGGGAACACACAGAAGATCTCTCCTTTACCTGTGGAACAAATATCT
TCAAACCAACTTTGAAAATTAATTTGAAAGATGAAAGGAAAATTTTGTTT
TCACACTCCCTCTGAAATAAAAGTTGTTGGTAGCTTTTTATTGAAAACTA
TGATCAAAGCGAATCATTCAATTGACATTGCTGTACAAATGCCACAGATC
ACAACAAACGAAGAAACAATGCTAAAAACGAACACTAAAGCCATCATCCA
AGACTTTTCAATCCTGGGTCAAGGTTTAGTAAAGAATATACAAGTAGTGA
ATCAAGTGTAAATAATGAACGCAAAATACAAACATGTCGAAGAAGATGTC
GCACAAAAGAAAAAGAAAAAACAGAAAGCTAAAGATACAAAGGAACTTTT
CAATGATACCGCTATGTTCTTTTGCGATCAATACGGGGGAAGTCAAATTG
GTGTGGTGTGGAAACGAAACAAACTCGCTGCTCAACCTTTCAAACAATTA
TTTCGTCCTTCCACAAAAGATTATGATATCGTTATTGAGTTGGATAAAAA
CCATGTGCCGAAACTACCTTTCATCCAATCTTCAAAAAGTGTCCACAAAT
CGTCTGATGTGAAATTAGCATCAATGGTGTCGAACAATGTATCGAATGAA
GTCCTCCCTGTTGTCGACTTTGACCCTGCTCGCTCGTTCCTCGACCAATT
ACAGGTGGTGAAACGGTTATCGTTGCTCGCTCAAGCGGCTTTGGCACTAG
TGGAAAGCGATGGTTTTGAATTTACACAACAAACTATAATGGCGAAAGCA
TGGAAGCATTGAAAGAACGTTTCACAAACTCCAGAGATCATCTTCCACAC
ATGGTTGTCATGACTCCCTATGATGTAGATGGTACCTTATGGACAAAACA
ACAACCCTCACCGCAGTTCATCTCTTTGTGGATTTGTTCGATTCTTGGAT
CATATAGCGACCTTCGATTGGAATGCAAACCCTTTGATTGTCAACCTCAA
TAGCGAAATCAAAATTTGAACGGTCAATTCGGTGCATTTTCGCTGACGTG
TCGCCTGGCGAAGAGGTGGATGAGTAGTCAGATGTTGTCCAATCATTTCT
ATGAAGAGTTGATCGAGTTGTTGGTCGCCTCCGTCTTTCTCTCACCAAAC
CCACCTAAAACGGCTACGTTTTTCGTTTGTCGGTCATCCATTACCGAGAA
ATGGTTTTACATAAAGAAAATGTAGCCTTGGGAAAATCAAAAACTTCCCA
TGACATCCAGGCTAAGAAGTTGGAAATGGAAATTGTGAAAAAGCCCCTCC
ATAACTCCCTCATTCACAGCTTATATCCAGTTTGAAGGGAGCGGTCAATG
GCCTGATAATTTAGAAGCAATCCAACACATACGCGCTGCTTTCCACATCA
AAGTTGCAGAATGCATACGTCAGCAACTTCATTTCCCTGCAAAAGCGACT
CCAAGGTGGATCGATGTGATGAAACCATTGACTGCTCGACAATACGAAGT
CAAGGAGCAATCAAAAGGTCAAGATTTTCTGGTACCCAGTAACGCAAAAA
GATCACCGCTTTGGTGTCCTGTAATAAAAGGCATTGTGCAATCTATCCTT
CATCCATCGATTACCATGGCAACTCGTTCGATTTCATTCTCTCTTCGAAC
ACGTCATCGTTCGAGCACGCGTCAGCCAATCAGAAGAAAGCCACAATACC
ACGTGGTTGTGGTGAAGAAGAGAGCACTCACGTGATCAAAACATTTGAAG
AATTGAGTCGTCAGCTACGTGGTTTGAGTGAATTACCTTTAGTCGTCAAC
AATATACATGCAGTGGACCCATTGCTTAGGATGACAGAGGCGAAAGAGTT
CCGCGCATTTTGGGGCGAGAAATCAGAATTGAGGCGTTTTCAAGATGGCA
GTATCAACGAGGCGGTAGTTTGGCCATCATCCAATTCCAGCCAGAAAAAA
ATGGTCTGCAAACAGATCGTACAACATCTTCTTAAACTTGGTCGGTGAAC
GAGTCGTGCCCAGACTCTTCAAAAGGACCAATCACAGTGGGAGTCTGCTT
GAACGCGTCCAATTATGACAATGTTTTGATCATGGGCCCTCCTGCTGATC
AACCTCAGAATAAATGACGCCGGCTCCTTTACAACCAAATTGTCAACGGA
GGAAAATAACAAGTTGATAAGCTATGGTGGCAACGCGCGTCCGATTCTGT
TGGAAAAAATGTCCGAAATTTTAAGACGGGGATTGGACGAAAGAATAACG
AGTCTATTTATGAAACCCTCGCCTCTGGTTCAGTTGCGATATGAAGCTCA
GCAATCGTTGGCGTTATTGGACAGTACTGAAGAAGGCTCCTTTGAATTAC
TTTTCATCAAAACCAAATCCTTCCTTCAAACCGTCGATCATATGTTCAGC
TGCCATCTTTAAAAGACTTTCACGGTGTATATCCGGTTGTTTTTGTGGAC
TCAAGTGGTCACCTCAACCTTTGCTCGTCACTCGATACCATCTCCTATCA
AATGGTACATCTGATTGGTCGAAGGAAGGAATCACTTTGAATAAAGATAC
CAATGAAGATGAAAAGGGTAATGTACCATTTAATGGGTTTTGTTGTTCAA
TGTTGCTGGTGTATTTGTTGTCAGTACGAAAGATTTCTGCACACATGAGC
TCCTATCAAATGTTTCGACTTACTCTTCACTTCATTGAGTTTCCAACAGC
AGATTACAACAATGGAGTTCTGGAGGACATGTTATACGAAGATCACTTAC
GATTGTTGTACTCTACTCTCAAAGAATGTCCTGGTATGAGTGAAGCCATC
CTACTCCTCAAAACGTGGCTCAAACAACGAAGTTACAAGGGAAAGTTGGG
AAAAAATTTAACGTTGTGCTTCACCTAGCTACACCCGAAGGGCATTTCAA
GTTGTCACGGTTTTTACCGCTGAAAAATAACATAAGACATAATTGGTATC
ACGGCTATGAACAGGATACAACAGAAGAAATTGGCTGTGTTACATGGAAA
AGATTATCTGAACTATCGTTATTACTACAAACGAGCTATATATCTTTCAT
GGTTGGCTTATTACTTGAAAGATTGGGAACACACAGAAGATCTCTCCTTT
ACCTGTGGAACAAATATCTTCAAACCAACTTTGAAAATTAATTTGAAAGA
TGAAAGGAAAATTTTGTTTTCACACTCCCTCTGAAATAAAAGTTGTTGGT
AGCTTTTTATTGAAAACTATGATCAAAGCGAATCATTCAATTGACATTGC
TGTACAAATGCCACAGATCACAACAAACGAAGAAACAATGCTAAAAACGA
ACACTAAAGCCATCATCCAAGACTTTTCAATCCTGGGTCAAGGTTTAGTA
AAGAATATACAAGTAGTGAATCAAGTGTAAATAATGAACGCAAAATACAA
ACATGTCGAAGAAGATGTCGCACAAAAGAAAAAGAAAAAACAGAAAGCTA
AAGATACAAAGGAACTTTTCAATGATACCGCTATGTTCTTTTGCGATCAA
TACGGGGGAAGTCAAATTGGTGTGGTGTGGAAACGAAACAAACTCGCTGC
TCAACCTTTCAAACAATTATTTCGTCCTTCCACAAAAGATTATGATATCG
TTATTGAGTTGGATAAAAACCATGTGCCGAAACTACCTTTCATCCAATCT
TCAAAAAGTGTCCACAAATCGTCTGATGTGAAATTAGCATCAATGGTGTC
GAACAATGTATCGAATGAAGTCCTCCCTGTTGTCGACTTTGACCCTGCTC
GCTCGTTCCTCGACCAATTACAGGTGGTGAAACGGTTATCGTTGCTCGCT
CAAGCGGCTTTGGCACTAGTGGAAAGCGATGGTTTTGAATTTACACAACA
AACTATAATGGCGAAAGCATGGAAGCATTGAAAGAACGTTTCACAAACTC
CAGAGATCATCTTCCACACATGGTTGTCATGACTCCCTATGATGTAGATG
GTACCTTATGGACAAAACAACAACCCTCACCGCAGTTCATCTCTTTGTGG
ATTTGTTCGATTCTTGGATCATATAGCGACCTTCGATTGGAATGCAAACC
CTTTGATTGTCAACCTCAATAGCGAAATCAAAATTTGAACGGTCAATTCG
GTGCATTTTCGCTGACGTGTCGCCTGGCGAAGAGGTGGATGAGTAGTCAG
ATGTTGTCCAATCATTTCTATGAAGAGTTGATCGAGTTGTTGGTCGCCTC
CGTCTTTCTCTCACCAAACCCACCTAAAACGGCTACGTTTTTCGTTTGTC
GGTCATCCATTACCGAGAAATGGTTTTACATAAAGAAAATGTAGCCTTGG
GAAAATCAAAAACTTCCCATGACATCCAGGCTAAGAAGTTGGAAATGGAA
ATTGTGAAAAAGCCCCTCCATAACTCCCTCATTCACAGCTTATATCCAGT
TTGAAGGGAGCGGTCAATGGCCTGATAATTTAGAAGCAATCCAACACATA
CGCGCTGCTTTCCACATCAAAGTTGCAGAATGCATACGTCAGCAACTTCA
TTTCCCTGCAAAAGCGACTCCAAGGTGGATCGATGTGATGAAACCATTGA
CTGCTCGACAATACGAAGTCAAGGAGCAATCAAAAGGTCAAGATTTTCTG
GTACCCAGTAACGCAAAAAGATCACCGCTTTGGTGTCCTGTAATAAAAGG
CATTGTGCAATCTATCCTTCATCCATCGATTACCATGGCAACTCGTTCGA
TTTCATTCTCTCTTCGAACACGTCATCGTTCGAGCACGCGTCAGCCAATC
AGAAGAAAGCCACAATACCACGTGGTTGTGGTGAAGAAGAGAGCACTCAC
GTGATCAAAACATTTGAAGAATTGAGTCGTCAGCTACGTGGTTTGAGTGA
ATTACCTTTAGTCGTCAACAATATACATGCAGTGGACCCATTGCTTAGGA
TGACAGAGGCGAAAGAGTTCCGCGCATTTTGGGGCGAGAAATCAGAATTG
AGGCGTTTTCAAGATGGCAGTATCAACGAGGCGGTAGTTTGGCCATCATC
CAATTCCAGCCAGAAAAAAATGGTCTGCAAACAGATCGTACAACATCTTC
TTAAACTTGGTCGGTGAACGAGTCGTGCCCAGACTCTTCAAAAGGACCAA
TCACAGTGGGAGTCTGCTTGAACGCGTCCAATTATGACAATGTTTTGATC
ATGGGCCCTCCTGCTGATCAACCTCAGAATAAATGACGCCGGCTCCTTTA
CAACCAAATTGTCAACGGAGGAAAATAACAAGTTGATAAGCTATGGTGGC
AACGCGCGTCCGATTCTGTTGGAAAAAATGTCCGAAATTTTAAGACGGGG
ATTGGACGAAAGAATAACGAGTCTATTTATGAAACCCTCGCCTCTGGTTC
AGTTGCGATATGAAGCTCAGCAATCGTTGGCGTTATTGGACAGTACTGAA
GAAGGCTCCTTTGAATTACTTTTCATCAAAACCAAATCCTTCCTTCAAAC
CGTCGATCATATGTTCAGCTGCCATCTTTAAAAGACTTTCACGGTGTATA
TCCGGTTGTTTTTGTGGACTCAAGTGGTCACCTCAACCTTTGCTCGTCAC
TCGATACCATCTCCTATCAAATGGTACATCTGATTGGTCGAAGGAAGGAA
TCACTTTGAATAAAGATACCAATGAAGATGAAAAGGGTAATGTACCATTT
AATGGGTTTTGTTGTTCAATGTTGCTGGTGTATTTGTTGTCAGTACGAAA
GATTTCTGCACACATGAGCTCCTATCAAATGTTTCGACTTACTCTTCACT
TCATTGAGTTTCCAACAGCAGATTACAACAATGGAGTTCTGGAGGACATG
TTATACGAAGATCACTTACGATTGTTGTACTCTACTCTCAAAGAATGTCC
TGGTATGAGTGAAGCCATCCTACTCCTCAAAACGTGGCTCAAACAACGAA
GTTACAAGGGAAAGTTGGGAAAAAATTTAACGTTGTGCTTCACCTAGCTA
CACCCGAAGGGCATTTCAAGTTGTCACGGTTTTTACCGCTGAAAAATAAC
ATAAGACATAATTGGTATCACGGCTATGAACAGGATACAACAGAAGAAAT
TGGCTGTGTTACATGGAAAAGATTATCTGAACTATCGTTATTACTACAAA
CGAGCTATATATCTTTCATGGTTGGCTTATTACTTGAAAGATTGGGAACA
CACAGAAGATCTCTCCTTTACCTGTGGAACAAATATCTTCAAACCAACTT
TGAAAATTAATTTGAAAGATGAAAGGAAAATTTTGTTTTCACACTCCCTC
TGAAATAAAAGTTGTTGGTAGCTTTTTATTGAAAACTATGATCAAAGCGA
ATCATTCAATTGACATTGCTGTACAAATGCCACAGATCACAACAAACGAA
GAAACAATGCTAAAAACGAACACTAAAGCCATCATCCAAGACTTTTCAAT
CCTGGGTCAAGGTTTAGTAAAGAATATACAAGTAGTGAATCAAGTGTAAA
TAATGAACGCAAAATACAAACATGTCGAAGAAGATGTCGCACAAAAGAAA
AAGAAAAAACAGAAAGCTAAAGATACAAAGGAACTTTTCAATGATACCGC
TATGTTCTTTTGCGATCAATACGGGGGAAGTCAAATTGGTGTGGTGTGGA
AACGAAACAAACTCGCTGCTCAACCTTTCAAACAATTATTTCGTCCTTCC
ACAAAAGATTATGATATCGTTATTGAGTTGGATAAAAACCATGTGCCGAA
ACTACCTTTCATCCAATCTTCAAAAAGTGTCCACAAATCGTCTGATGTGA
AATTAGCATCAATGGTGTCGAACAATGTATCGAATGAAGTCCTCCCTGTT
GTCGACTTTGACCCTGCTCGCTCGTTCCTCGACCAATTACAGGTGGTGAA
ACGGTTATCGTTGCTCGCTCAAGCGGCTTTGGCACTAGTGGAAAGCGATG
GTTTTGAATTTACACAACAAACTATAATGGCGAAAGCATGGAAGCATTGA
AAGAACGTTTCACAAACTCCAGAGATCATCTTCCACACATGGTTGTCATG
ACTCCCTATGATGTAGATGGTACCTTATGGACAAAACAACAACCCTCACC
GCAGTTCATCTCTTTGTGGATTTGTTCGATTCTTGGATCATATAGCGACC
TTCGATTGGAATGCAAACCCTTTGATTGTCAACCTCAATAGCGAAATCAA
AATTTGAACGGTCAATTCGGTGCATTTTCGCTGACGTGTCGCCTGGCGAA
GAGGTGGATGAGTAGTCAGATGTTGTCCAATCATTTCTATGAAGAGTTGA
TCGAGTTGTTGGTCGCCTCCGTCTTTCTCTCACCAAACCCACCTAAAACG
GCTACGTTTTTCGTTTGTCGGTCATCCATTACCGAGAAATGGTTTTACAT
AAAGAAAATGTAGCCTTGGGAAAATCAAAAACTTCCCATGACATCCAGGC
TAAGAAGTTGGAAATGGAAATTGTGAAAAAGCCCCTCCATAACTCCCTCA
TTCACAGCTTATATCCAGTTTGAAGGGAGCGGTCAATGGCCTGATAATTT
AGAAGCAATCCAACACATACGCGCTGCTTTCCACATCAAAGTTGCAGAAT
GCATACGTCAGCAACTTCATTTCCCTGCAAAAGCGACTCCAAGGTGGATC
GATGTGATGAAACCATTGACTGCTCGACAATACGAAGTCAAGGAGCAATC
AAAAGGTCAAGATTTTCTGGTACCCAGTAACGCAAAAAGATCACCGCTTT
GGTGTCCTGTAATAAAAGGCATTGTGCAATCTATCCTTCATCCATCGATT
ACCATGGCAACTCGTTCGATTTCATTCTCTCTTCGAACACGTCATCGTTC
GAGCACGCGTCAGCCAATCAGAAGAAAGCCACAATACCACGTGGTTGTGG
TGAAGAAGAGAGCACTCACGTGATCAAAACATTTGAAGAATTGAGTCGTC
AGCTACGTGGTTTGAGTGAATTACCTTTAGTCGTCAACAATATACATGCA
GTGGACCCATTGCTTAGGATGACAGAGGCGAAAGAGTTCCGCGCATTTTG
GGGCGAGAAATCAGAATTGAGGCGTTTTCAAGATGGCAGTATCAACGAGG
CGGTAGTTTGGCCATCATCCAATTCCAGCCAGAAAAAAATGGTCTGCAAA
CAGATCGTACAACATCTTCTTAAACTTGGTCGGTGAACGAGTCGTGCCCA
GACTCTTCAAAAGGACCAATCACAGTGGGAGTCTGCTTGAACGCGTCCAA
TTATGACAATGTTTTGATCATGGGCCCTCCTGCTGATCAACCTCAGAATA
AATGACGCCGGCTCCTTTACAACCAAATTGTCAACGGAGGAAAATAACAA
GTTGATAAGCTATGGTGGCAACGCGCGTCCGATTCTGTTGGAAAAAATGT
CCGAAATTTTAAGACGGGGATTGGACGAAAGAATAACGAGTCTATTTATG
AAACCCTCGCCTCTGGTTCAGTTGCGATATGAAGCTCAGCAATCGTTGGC
GTTATTGGACAGTACTGAAGAAGGCTCCTTTGAATTACTTTTCATCAAAA
CCAAATCCTTCCTTCAAACCGTCGATCATATGTTCAGCTGCCATCTTTAA
AAGACTTTCACGGTGTATATCCGGTTGTTTTTGTGGACTCAAGTGGTCAC
CTCAACCTTTGCTCGTCACTCGATACCATCTCCTATCAAATGGTACATCT
GATTGGTCGAAGGAAGGAATCACTTTGAATAAAGATACCAATGAAGATGA
AAAGGGTAATGTACCATTTAATGGGTTTTGTTGTTCAATGTTGCTGGTGT
ATTTGTTGTCAGTACGAAAGATTTCTGCACACATGAGCTCCTATCAAATG
TTTCGACTTACTCTTCACTTCATTGAGTTTCCAACAGCAGATTACAACAA
TGGAGTTCTGGAGGACATGTTATACGAAGATCACTTACGATTGTTGTACT
CTACTCTCAAAGAATGTCCTGGTATGAGTGAAGCCATCCTACTCCTCAAA
ACGTGGCTCAAACAACGAAGTTACAAGGGAAAGTTGGGAAAAAATTTAAC
GTTGTGCTTCACCTAGCTACACCCGAAGGGCATTTCAAGTTGTCACGGTT
TTTACCGCTGAAAAATAACATAAGACATAATTGGTATCACGGCTATGAAC
AGGATACAACAGAAGAAATTGGCTGTGTTACATGGAAAAGATTATCTGAA
CTATCGTTATTACTACAAACGAGCTATATATCTTTCATGGTTGGCTTATT
ACTTGAAAGATTGGGAACACACAGAAGATCTCTCCTTTACCTGTGGAACA
AATATCTTCAAACCAACTTTGAAAATTAATTTGAAAGATGAAAGGAAAAT
TTTGTTTTCACACTCCCTCTGAAATAAAAGTTGTTGGTAGCTTTTTATTG
AAAACTATGATCAAAGCGAATCATTCAATTGACATTGCTGTACAAATGCC
ACAGATCACAACAAACGAAGAAACAATGCTAAAAACGAACACTAAAGCCA
TCATCCAAGACTTTTCAATCCTGGGTCAAGGTTTAGTAAAGAATATACAA
GTAGTGAATCAAGTGTAAATAATGAACGCAAAATACAAACATGTCGAAGA
AGATGTCGCACAAAAGAAAAAGAAAAAACAGAAAGCTAAAGATACAAAGG
AACTTTTCAATGATACCGCTATGTTCTTTTGCGATCAATACGGGGGAAGT
CAAATTGGTGTGGTGTGGAAACGAAACAAACTCGCTGCTCAACCTTTCAA
ACAATTATTTCGTCCTTCCACAAAAGATTATGATATCGTTATTGAGTTGG
ATAAAAACCATGTGCCGAAACTACCTTTCATCCAATCTTCAAAAAGTGTC
CACAAATCGTCTGATGTGAAATTAGCATCAATGGTGTCGAACAATGTATC
GAATGAAGTCCTCCCTGTTGTCGACTTTGACCCTGCTCGCTCGTTCCTCG
ACCAATTACAGGTGGTGAAACGGTTATCGTTGCTCGCTCAAGCGGCTTTG
GCACTAGTGGAAAGCGATGGTTTTGAATTTACACAACAAACTATAATGGC
GAAAGCATGGAAGCATTGAAAGAACGTTTCACAAACTCCAGAGATCATCT
TCCACACATGGTTGTCATGACTCCCTATGATGTAGATGGTACCTTATGGA
CAAAACAACAACCCTCACCGCAGTTCATCTCTTTGTGGATTTGTTCGATT
CTTGGATCATATAGCGACCTTCGATTGGAATGCAAACCCTTTGATTGTCA
ACCTCAATAGCGAAATCAAAATTTGAACGGTCAATTCGGTGCATTTTCGC
TGACGTGTCGCCTGGCGAAGAGGTGGATGAGTAGTCAGATGTTGTCCAAT
CATTTCTATGAAGAGTTGATCGAGTTGTTGGTCGCCTCCGTCTTTCTCTC
ACCAAACCCACCTAAAACGGCTACGTTTTTCGTTTGTCGGTCATCCATTA
CCGAGAAATGGTTTTACATAAAGAAAATGTAGCCTTGGGAAAATCAAAAA
CTTCCCATGACATCCAGGCTAAGAAGTTGGAAATGGAAATTGTGAAAAAG
CCCCTCCATAACTCCCTCATTCACAGCTTATATCCAGTTTGAAGGGAGCG
GTCAATGGCCTGATAATTTAGAAGCAATCCAACACATACGCGCTGCTTTC
CACATCAAAGTTGCAGAATGCATACGTCAGCAACTTCATTTCCCTGCAAA
AGCGACTCCAAGGTGGATCGATGTGATGAAACCATTGACTGCTCGACAAT
ACGAAGTCAAGGAGCAATCAAAAGGTCAAGATTTTCTGGTACCCAGTAAC
GCAAAAAGATCACCGCTTTGGTGTCCTGTAATAAAAGGCATTGTGCAATC
TATCCTTCATCCATCGATTACCATGGCAACTCGTTCGATTTCATTCTCTC
TTCGAACACGTCATCGTTCGAGCACGCGTCAGCCAATCAGAAGAAAGCCA
CAATACCACGTGGTTGTGGTGAAGAAGAGAGCACTCACGTGATCAAAACA
TTTGAAGAATTGAGTCGTCAGCTACGTGGTTTGAGTGAATTACCTTTAGT
CGTCAACAATATACATGCAGTGGACCCATTGCTTAGGATGACAGAGGCGA
AAGAGTTCCGCGCATTTTGGGGCGAGAAATCAGAATTGAGGCGTTTTCAA
GATGGCAGTATCAACGAGGCGGTAGTTTGGCCATCATCCAATTCCAGCCA
GAAAAAAATGGTCTGCAAACAGATCGTACAACATCTTCTTAAACTTGGTC
GGTGAACGAGTCGTGCCCAGACTCTTCAAAAGGACCAATCACAGTGGGAG
TCTGCTTGAACGCGTCCAATTATGACAATGTTTTGATCATGGGCCCTCCT
GCTGATCAACCTCAGAATAAATGACGCCGGCTCCTTTACAACCAAATTGT
CAACGGAGGAAAATAACAAGTTGATAAGCTATGGTGGCAACGCGCGTCCG
ATTCTGTTGGAAAAAATGTCCGAAATTTTAAGACGGGGATTGGACGAAAG
AATAACGAGTCTATTTATGAAACCCTCGCCTCTGGTTCAGTTGCGATATG
AAGCTCAGCAATCGTTGGCGTTATTGGACAGTACTGAAGAAGGCTCCTTT
GAATTACTTTTCATCAAAACCAAATCCTTCCTTCAAACCGTCGATCATAT
GTTCAGCTGCCATCTTTAAAAGACTTTCACGGTGTATATCCGGTTGTTTT
TGTGGACTCAAGTGGTCACCTCAACCTTTGCTCGTCACTCGATACCATCT
CCTATCAAATGGTACATCTGATTGGTCGAAGGAAGGAATCACTTTGAATA
AAGATACCAATGAAGATGAAAAGGGTAATGTACCATTTAATGGGTTTTGT
TGTTCAATGTTGCTGGTGTATTTGTTGTCAGTACGAAAGATTTCTGCACA
CATGAGCTCCTATCAAATGTTTCGACTTACTCTTCACTTCATTGAGTTTC
CAACAGCAGATTACAACAATGGAGTTCTGGAGGACATGTTATACGAAGAT
CACTTACGATTGTTGTACTCTACTCTCAAAGAATGTCCTGGTATGAGTGA
AGCCATCCTACTCCTCAAAACGTGGCTCAAACAACGAAGTTACAAGGGAA
AGTTGGGAAAAAATTTAACGTTGTGCTTCACCTAGCTACACCCGAAGGGC
ATTTCAAGTTGTCACGGTTTTTACCGCTGAAAAATAACATAAGACATAAT
TGGTATCACGGCTATGAACAGGATACAACAGAAGAAATTGGCTGTGTTAC
ATGGAAAAGATTATCTGAACTATCGTTATTACTACAAACGAGCTATATAT
CTTTCATGGTTGGCTTATTACTTGAAAGATTGGGAACACACAGAAGATCT
CTCCTTTACCTGTGGAACAAATATCTTCAAACCAACTTTGAAAATTAATT
TGAAAGATGAAAGGAAAATTTTGTTTTCACACTCCCTCTGAAATAAAAGT
TGTTGGTAGCTTTTTATTGAAAACTATGATCAAAGCGAATCATTCAATTG
ACATTGCTGTACAAATGCCACAGATCACAACAAACGAAGAAACAATGCTA
AAAACGAACACTAAAGCCATCATCCAAGACTTTTCAATCCTGGGTCAAGG
TTTAGTAAAGAATATACAAGTAGTGAATCAAGTGTAAATAATGAACGCAA
AATACAAACATGTCGAAGAAGATGTCGCACAAAAGAAAAAGAAAAAACAG
AAAGCTAAAGATACAAAGGAACTTTTCAATGATACCGCTATGTTCTTTTG
CGATCAATACGGGGGAAGTCAAATTGGTGTGGTGTGGAAACGAAACAAAC
TCGCTGCTCAACCTTTCAAACAATTATTTCGTCCTTCCACAAAAGATTAT
GATATCGTTATTGAGTTGGATAAAAACCATGTGCCGAAACTACCTTTCAT
CCAATCTTCAAAAAGTGTCCACAAATCGTCTGATGTGAAATTAGCATCAA
TGGTGTCGAACAATGTATCGAATGAAGTCCTCCCTGTTGTCGACTTTGAC
CCTGCTCGCTCGTTCCTCGACCAATTACAGGTGGTGAAACGGTTATCGTT
GCTCGCTCAAGCGGCTTTGGCACTAGTGGAAAGCGATGGTTTTGAATTTA
CACAACAAACTATAATGGCGAAAGCATGGAAGCATTGAAAGAACGTTTCA
CAAACTCCAGAGATCATCTTCCACACATGGTTGTCATGACTCCCTATGAT
GTAGATGGTACCTTATGGACAAAACAACAACCCTCACCGCAGTTCATCTC
TTTGTGGATTTGTTCGATTCTTGGATCATATAGCGACCTTCGATTGGAAT
GCAAACCCTTTGATTGTCAACCTCAATAGCGAAATCAAAATTTGAACGGT
CAATTCGGTGCATTTTCGCTGACGTGTCGCCTGGCGAAGAGGTGGATGAG
TAGTCAGATGTTGTCCAATCATTTCTATGAAGAGTTGATCGAGTTGTTGG
TCGCCTCCGTCTTTCTCTCACCAAACCCACCTAAAACGGCTACGTTTTTC
GTTTGTCGGTCATCCATTACCGAGAAATGGTTTTACATAAAGAAAATGTA
GCCTTGGGAAAATCAAAAACTTCCCATGACATCCAGGCTAAGAAGTTGGA
AATGGAAATTGTGAAAAAGCCCCTCCATAACTCCCTCATTCACAGCTTAT
ATCCAGTTTGAAGGGAGCGGTCAATGGCCTGATAATTTAGAAGCAATCCA
ACACATACGCGCTGCTTTCCACATCAAAGTTGCAGAATGCATACGTCAGC
AACTTCATTTCCCTGCAAAAGCGACTCCAAGGTGGATCGATGTGATGAAA
CCATTGACTGCTCGACAATACGAAGTCAAGGAGCAATCAAAAGGTCAAGA
TTTTCTGGTACCCAGTAACGCAAAAAGATCACCGCTTTGGTGTCCTGTAA
TAAAAGGCATTGTGCAATCTATCCTTCATCCATCGATTACCATGGCAACT
CGTTCGATTTCATTCTCTCTTCGAACACGTCATCGTTCGAGCACGCGTCA
GCCAATCAGAAGAAAGCCACAATACCACGTGGTTGTGGTGAAGAAGAGAG
CACTCACGTGATCAAAACATTTGAAGAATTGAGTCGTCAGCTACGTGGTT
TGAGTGAATTACCTTTAGTCGTCAACAATATACATGCAGTGGACCCATTG
CTTAGGATGACAGAGGCGAAAGAGTTCCGCGCATTTTGGGGCGAGAAATC
AGAATTGAGGCGTTTTCAAGATGGCAGTATCAACGAGGCGGTAGTTTGGC
CATCATCCAATTCCAGCCAGAAAAAAATGGTCTGCAAACAGATCGTACAA
CATCTTCTTAAACTTGGTCGGTGAACGAGTCGTGCCCAGACTCTTCAAAA
GGACCAATCACAGTGGGAGTCTGCTTGAACGCGTCCAATTATGACAATGT
TTTGATCATGGGCCCTCCTGCTGATCAACCTCAGAATAAATGACGCCGGC
TCCTTTACAACCAAATTGTCAACGGAGGAAAATAACAAGTTGATAAGCTA
TGGTGGCAACGCGCGTCCGATTCTGTTGGAAAAAATGTCCGAAATTTTAA
GACGGGGATTGGACGAAAGAATAACGAGTCTATTTATGAAACCCTCGCCT
CTGGTTCAGTTGCGATATGAAGCTCAGCAATCGTTGGCGTTATTGGACAG
TACTGAAGAAGGCTCCTTTGAATTACTTTTCATCAAAACCAAATCCTTCC
TTCAAACCGTCGATCATATGTTCAGCTGCCATCTTTAAAAGACTTTCACG
GTGTATATCCGGTTGTTTTTGTGGACTCAAGTGGTCACCTCAACCTTTGC
TCGTCACTCGATACCATCTCCTATCAAATGGTACATCTGATTGGTCGAAG
GAAGGAATCACTTTGAATAAAGATACCAATGAAGATGAAAAGGGTAATGT
ACCATTTAATGGGTTTTGTTGTTCAATGTTGCTGGTGTATTTGTTGTCAG
TACGAAAGATTTCTGCACACATGAGCTCCTATCAAATGTTTCGACTTACT
CTTCACTTCATTGAGTTTCCAACAGCAGATTACAACAATGGAGTTCTGGA
GGACATGTTATACGAAGATCACTTACGATTGTTGTACTCTACTCTCAAAG
AATGTCCTGGTATGAGTGAAGCCATCCTACTCCTCAAAACGTGGCTCAAA
CAACGAAGTTACAAGGGAAAGTTGGGAAAAAATTTAACGTTGTGCTTCAC
CTAGCTACACCCGAAGGGCATTTCAAGTTGTCACGGTTTTTACCGCTGAA
AAATAACATAAGACATAATTGGTATCACGGCTATGAACAGGATACAACAG
AAGAAATTGGCTGTGTTACATGGAAAAGATTATCTGAACTATCGTTATTA
CTACAAACGAGCTATATATCTTTCATGGTTGGCTTATTACTTGAAAGATT
GGGAACACACAGAAGATCTCTCCTTTACCTGTGGAACAAATATCTTCAAA
CCAACTTTGAAAATTAATTTGAAAGATGAAAGGAAAATTTTGTTTTCACA
CTCCCTCTGAAATAAAAGTTGTTGGTAGCTTTTTATTGAAAACTATGATC
AAAGCGAATCATTCAATTGACATTGCTGTACAAATGCCACAGATCACAAC
AAACGAAGAAACAATGCTAAAAACGAACACTAAAGCCATCATCCAAGACT
TTTCAATCCTGGGTCAAGGTTTAGTAAAGAATATACAAGTAGTGAATCAA
GTGTAAATAATGAACGCAAAATACAAACATGTCGAAGAAGATGTCGCACA
AAAGAAAAAGAAAAAACAGAAAGCTAAAGATACAAAGGAACTTTTCAATG
ATACCGCTATGTTCTTTTGCGATCAATACGGGGGAAGTCAAATTGGTGTG
GTGTGGAAACGAAACAAACTCGCTGCTCAACCTTTCAAACAATTATTTCG
TCCTTCCACAAAAGATTATGATATCGTTATTGAGTTGGATAAAAACCATG
TGCCGAAACTACCTTTCATCCAATCTTCAAAAAGTGTCCACAAATCGTCT
GATGTGAAATTAGCATCAATGGTGTCGAACAATGTATCGAATGAAGTCCT
CCCTGTTGTCGACTTTGACCCTGCTCGCTCGTTCCTCGACCAATTACAGG
TGGTGAAACGGTTATCGTTGCTCGCTCAAGCGGCTTTGGCACTAGTGGAA
AGCGATGGTTTTGAATTTACACAACAAACTATAATGGCGAAAGCATGGAA
GCATTGAAAGAACGTTTCACAAACTCCAGAGATCATCTTCCACACATGGT
TGTCATGACTCCCTATGATGTAGATGGTACCTTATGGACAAAACAACAAC
CCTCACCGCAGTTCATCTCTTTGTGGATTTGTTCGATTCTTGGATCATAT
AGCGACCTTCGATTGGAATGCAAACCCTTTGATTGTCAACCTCAATAGCG
AAATCAAAATTTGAACGGTCAATTCGGTGCATTTTCGCTGACGTGTCGCC
TGGCGAAGAGGTGGATGAGTAGTCAGATGTTGTCCAATCATTTCTATGAA
GAGTTGATCGAGTTGTTGGTCGCCTCCGTCTTTCTCTCACCAAACCCACC
TAAAACGGCTACGTTTTTCGTTTGTCGGTCATCCATTACCGAGAAATGGT
TTTACATAAAGAAAATGTAGCCTTGGGAAAATCAAAAACTTCCCATGACA
TCCAGGCTAAGAAGTTGGAAATGGAAATTGTGAAAAAGCCCCTCCATAAC
TCCCTCATTCACAGCTTATATCCAGTTTGAAGGGAGCGGTCAATGGCCTG
ATAATTTAGAAGCAATCCAACACATACGCGCTGCTTTCCACATCAAAGTT
GCAGAATGCATACGTCAGCAACTTCATTTCCCTGCAAAAGCGACTCCAAG
GTGGATCGATGTGATGAAACCATTGACTGCTCGACAATACGAAGTCAAGG
AGCAATCAAAAGGTCAAGATTTTCTGGTACCCAGTAACGCAAAAAGATCA
CCGCTTTGGTGTCCTGTAATAAAAGGCATTGTGCAATCTATCCTTCATCC
ATCGATTACCATGGCAACTCGTTCGATTTCATTCTCTCTTCGAACACGTC
ATCGTTCGAGCACGCGTCAGCCAATCAGAAGAAAGCCACAATACCACGTG
GTTGTGGTGAAGAAGAGAGCACTCACGTGATCAAAACATTTGAAGAATTG
AGTCGTCAGCTACGTGGTTTGAGTGAATTACCTTTAGTCGTCAACAATAT
ACATGCAGTGGACCCATTGCTTAGGATGACAGAGGCGAAAGAGTTCCGCG
CATTTTGGGGCGAGAAATCAGAATTGAGGCGTTTTCAAGATGGCAGTATC
AACGAGGCGGTAGTTTGGCCATCATCCAATTCCAGCCAGAAAAAAATGGT
CTGCAAACAGATCGTACAACATCTTCTTAAACTTGGTCGGTGAACGAGTC
GTGCCCAGACTCTTCAAAAGGACCAATCACAGTGGGAGTCTGCTTGAACG
CGTCCAATTATGACAATGTTTTGATCATGGGCCCTCCTGCTGATCAACCT
CAGAATAAATGACGCCGGCTCCTTTACAACCAAATTGTCAACGGAGGAAA
ATAACAAGTTGATAAGCTATGGTGGCAACGCGCGTCCGATTCTGTTGGAA
AAAATGTCCGAAATTTTAAGACGGGGATTGGACGAAAGAATAACGAGTCT
ATTTATGAAACCCTCGCCTCTGGTTCAGTTGCGATATGAAGCTCAGCAAT
CGTTGGCGTTATTGGACAGTACTGAAGAAGGCTCCTTTGAATTACTTTTC
ATCAAAACCAAATCCTTCCTTCAAACCGTCGATCATATGTTCAGCTGCCA
TCTTTAAAAGACTTTCACGGTGTATATCCGGTTGTTTTTGTGGACTCAAG
TGGTCACCTCAACCTTTGCTCGTCACTCGATACCATCTCCTATCAAATGG
TACATCTGATTGGTCGAAGGAAGGAATCACTTTGAATAAAGATACCAATG
AAGATGAAAAGGGTAATGTACCATTTAATGGGTTTTGTTGTTCAATGTTG
CTGGTGTATTTGTTGTCAGTACGAAAGATTTCTGCACACATGAGCTCCTA
TCAAATGTTTCGACTTACTCTTCACTTCATTGAGTTTCCAACAGCAGATT
ACAACAATGGAGTTCTGGAGGACATGTTATACGAAGATCACTTACGATTG
TTGTACTCTACTCTCAAAGAATGTCCTGGTATGAGTGAAGCCATCCTACT
CCTCAAAACGTGGCTCAAACAACGAAGTTACAAGGGAAAGTTGGGAAAAA
ATTTAACGTTGTGCTTCACCTAGCTACACCCGAAGGGCATTTCAAGTTGT
CACGGTTTTTACCGCTGAAAAATAACATAAGACATAATTGGTATCACGGC
TATGAACAGGATACAACAGAAGAAATTGGCTGTGTTACATGGAAAAGATT
ATCTGAACTATCGTTATTACTACAAACGAGCTATATATCTTTCATGGTTG
GCTTATTACTTGAAAGATTGGGAACACACAGAAGATCTCTCCTTTACCTG
TGGAACAAATATCTTCAAACCAACTTTGAAAATTAATTTGAAAGATGAAA
GGAAAATTTTGTTTTCACACTCCCTCTGAAATAAAAGTTGTTGGTAGCTT
TTTATTGAAAACTATGATCAAAGCGAATCATTCAATTGACATTGCTGTAC
AAATGCCACAGATCACAACAAACGAAGAAACAATGCTAAAAACGAACACT
AAAGCCATCATCCAAGACTTTTCAATCCTGGGTCAAGGTTTAGTAAAGAA
TATACAAGTAGTGAATCAAGTGTAAATAATGAACGCAAAATACAAACATG
TCGAAGAAGATGTCGCACAAAAGAAAAAGAAAAAACAGAAAGCTAAAGAT
ACAAAGGAACTTTTCAATGATACCGCTATGTTCTTTTGCGATCAATACGG
GGGAAGTCAAATTGGTGTGGTGTGGAAACGAAACAAACTCGCTGCTCAAC
CTTTCAAACAATTATTTCGTCCTTCCACAAAAGATTATGATATCGTTATT
GAGTTGGATAAAAACCATGTGCCGAAACTACCTTTCATCCAATCTTCAAA
AAGTGTCCACAAATCGTCTGATGTGAAATTAGCATCAATGGTGTCGAACA
ATGTATCGAATGAAGTCCTCCCTGTTGTCGACTTTGACCCTGCTCGCTCG
TTCCTCGACCAATTACAGGTGGTGAAACGGTTATCGTTGCTCGCTCAAGC
GGCTTTGGCACTAGTGGAAAGCGATGGTTTTGAATTTACACAACAAACTA
TAATGGCGAAAGCATGGAAGCATTGAAAGAACGTTTCACAAACTCCAGAG
ATCATCTTCCACACATGGTTGTCATGACTCCCTATGATGTAGATGGTACC
TTATGGACAAAACAACAACCCTCACCGCAGTTCATCTCTTTGTGGATTTG
TTCGATTCTTGGATCATATAGCGACCTTCGATTGGAATGCAAACCCTTTG
ATTGTCAACCTCAATAGCGAAATCAAAATTTGAACGGTCAATTCGGTGCA
TTTTCGCTGACGTGTCGCCTGGCGAAGAGGTGGATGAGTAGTCAGATGTT
GTCCAATCATTTCTATGAAGAGTTGATCGAGTTGTTGGTCGCCTCCGTCT
TTCTCTCACCAAACCCACCTAAAACGGCTACGTTTTTCGTTTGTCGGTCA
TCCATTACCGAGAAATGGTTTTACATAAAGAAAATGTAGCCTTGGGAAAA
TCAAAAACTTCCCATGACATCCAGGCTAAGAAGTTGGAAATGGAAATTGT
GAAAAAGCCCCTCCATAACTCCCTCATTCACAGCTTATATCCAGTTTGAA
GGGAGCGGTCAATGGCCTGATAATTTAGAAGCAATCCAACACATACGCGC
TGCTTTCCACATCAAAGTTGCAGAATGCATACGTCAGCAACTTCATTTCC
CTGCAAAAGCGACTCCAAGGTGGATCGATGTGATGAAACCATTGACTGCT
CGACAATACGAAGTCAAGGAGCAATCAAAAGGTCAAGATTTTCTGGTACC
CAGTAACGCAAAAAGATCACCGCTTTGGTGTCCTGTAATAAAAGGCATTG
TGCAATCTATCCTTCATCCATCGATTACCATGGCAACTCGTTCGATTTCA
TTCTCTCTTCGAACACGTCATCGTTCGAGCACGCGTCAGCCAATCAGAAG
AAAGCCACAATACCACGTGGTTGTGGTGAAGAAGAGAGCACTCACGTGAT
CAAAACATTTGAAGAATTGAGTCGTCAGCTACGTGGTTTGAGTGAATTAC
CTTTAGTCGTCAACAATATACATGCAGTGGACCCATTGCTTAGGATGACA
GAGGCGAAAGAGTTCCGCGCATTTTGGGGCGAGAAATCAGAATTGAGGCG
TTTTCAAGATGGCAGTATCAACGAGGCGGTAGTTTGGCCATCATCCAATT
CCAGCCAGAAAAAAATGGTCTGCAAACAGATCGTACAACATCTTCTTAAA
CTTGGTCGGTGAACGAGTCGTGCCCAGACTCTTCAAAAGGACCAATCACA
GTGGGAGTCTGCTTGAACGCGTCCAATTATGACAATGTTTTGATCATGGG
CCCTCCTGCTGATCAACCTCAGAATAAATGACGCCGGCTCCTTTACAACC
AAATTGTCAACGGAGGAAAATAACAAGTTGATAAGCTATGGTGGCAACGC
GCGTCCGATTCTGTTGGAAAAAATGTCCGAAATTTTAAGACGGGGATTGG
ACGAAAGAATAACGAGTCTATTTATGAAACCCTCGCCTCTGGTTCAGTTG
CGATATGAAGCTCAGCAATCGTTGGCGTTATTGGACAGTACTGAAGAAGG
CTCCTTTGAATTACTTTTCATCAAAACCAAATCCTTCCTTCAAACCGTCG
ATCATATGTTCAGCTGCCATCTTTAAAAGACTTTCACGGTGTATATCCGG
TTGTTTTTGTGGACTCAAGTGGTCACCTCAACCTTTGCTCGTCACTCGAT
ACCATCTCCTATCAAATGGTACATCTGATTGGTCGAAGGAAGGAATCACT
TTGAATAAAGATACCAATGAAGATGAAAAGGGTAATGTACCATTTAATGG
GTTTTGTTGTTCAATGTTGCTGGTGTATTTGTTGTCAGTACGAAAGATTT
CTGCACACATGAGCTCCTATCAAATGTTTCGACTTACTCTTCACTTCATT
GAGTTTCCAACAGCAGATTACAACAATGGAGTTCTGGAGGACATGTTATA
CGAAGATCACTTACGATTGTTGTACTCTACTCTCAAAGAATGTCCTGGTA
TGAGTGAAGCCATCCTACTCCTCAAAACGTGGCTCAAACAACGAAGTTAC
AAGGGAAAGTTGGGAAAAAATTTAACGTTGTGCTTCACCTAGCTACACCC
GAAGGGCATTTCAAGTTGTCACGGTTTTTACCGCTGAAAAATAACATAAG
ACATAATTGGTATCACGGCTATGAACAGGATACAACAGAAGAAATTGGCT
GTGTTACATGGAAAAGATTATCTGAACTATCGTTATTACTACAAACGAGC
TATATATCTTTCATGGTTGGCTTATTACTTGAAAGATTGGGAACACACAG
AAGATCTCTCCTTTACCTGTGGAACAAATATCTTCAAACCAACTTTGAAA
ATTAATTTGAAAGATGAAAGGAAAATTTTGTTTTCACACTCCCTCTGAAA
TAAAAGTTGTTGGTAGCTTTTTATTGAAAACTATGATCAAAGCGAATCAT
TCAATTGACATTGCTGTACAAATGCCACAGATCACAACAAACGAAGAAAC
AATGCTAAAAACGAACACTAAAGCCATCATCCAAGACTTTTCAATCCTGG
GTCAAGGTTTAGTAAAGAATATACAAGTAGTGAATCAAGTGTAAATAATG
AACGCAAAATACAAACATGTCGAAGAAGATGTCGCACAAAAGAAAAAGAA
AAAACAGAAAGCTAAAGATACAAAGGAACTTTTCAATGATACCGCTATGT
TCTTTTGCGATCAATACGGGGGAAGTCAAATTGGTGTGGTGTGGAAACGA
AACAAACTCGCTGCTCAACCTTTCAAACAATTATTTCGTCCTTCCACAAA
AGATTATGATATCGTTATTGAGTTGGATAAAAACCATGTGCCGAAACTAC
CTTTCATCCAATCTTCAAAAAGTGTCCACAAATCGTCTGATGTGAAATTA
GCATCAATGGTGTCGAACAATGTATCGAATGAAGTCCTCCCTGTTGTCGA
CTTTGACCCTGCTCGCTCGTTCCTCGACCAATTACAGGTGGTGAAACGGT
TATCGTTGCTCGCTCAAGCGGCTTTGGCACTAGTGGAAAGCGATGGTTTT
GAATTTACACAACAAACTATAATGGCGAAAGCATGGAAGCATTGAAAGAA
CGTTTCACAAACTCCAGAGATCATCTTCCACACATGGTTGTCATGACTCC
CTATGATGTAGATGGTACCTTATGGACAAAACAACAACCCTCACCGCAGT
TCATCTCTTTGTGGATTTGTTCGATTCTTGGATCATATAGCGACCTTCGA
TTGGAATGCAAACCCTTTGATTGTCAACCTCAATAGCGAAATCAAAATTT
GAACGGTCAATTCGGTGCATTTTCGCTGACGTGTCGCCTGGCGAAGAGGT
GGATGAGTAGTCAGATGTTGTCCAATCATTTCTATGAAGAGTTGATCGAG
TTGTTGGTCGCCTCCGTCTTTCTCTCACCAAACCCACCTAAAACGGCTAC
GTTTTTCGTTTGTCGGTCATCCATTACCGAGAAATGGTTTTACATAAAGA
AAATGTAGCCTTGGGAAAATCAAAAACTTCCCATGACATCCAGGCTAAGA
AGTTGGAAATGGAAATTGTGAAAAAGCCCCTCCATAACTCCCTCATTCAC
AGCTTATATCCAGTTTGAAGGGAGCGGTCAATGGCCTGATAATTTAGAAG
CAATCCAACACATACGCGCTGCTTTCCACATCAAAGTTGCAGAATGCATA
CGTCAGCAACTTCATTTCCCTGCAAAAGCGACTCCAAGGTGGATCGATGT
GATGAAACCATTGACTGCTCGACAATACGAAGTCAAGGAGCAATCAAAAG
GTCAAGATTTTCTGGTACCCAGTAACGCAAAAAGATCACCGCTTTGGTGT
CCTGTAATAAAAGGCATTGTGCAATCTATCCTTCATCCATCGATTACCAT
GGCAACTCGTTCGATTTCATTCTCTCTTCGAACACGTCATCGTTCGAGCA
CGCGTCAGCCAATCAGAAGAAAGCCACAATACCACGTGGTTGTGGTGAAG
AAGAGAGCACTCACGTGATCAAAACATTTGAAGAATTGAGTCGTCAGCTA
CGTGGTTTGAGTGAATTACCTTTAGTCGTCAACAATATACATGCAGTGGA
CCCATTGCTTAGGATGACAGAGGCGAAAGAGTTCCGCGCATTTTGGGGCG
AGAAATCAGAATTGAGGCGTTTTCAAGATGGCAGTATCAACGAGGCGGTA
GTTTGGCCATCATCCAATTCCAGCCAGAAAAAAATGGTCTGCAAACAGAT
CGTACAACATCTTCTTAAACTTGGTCGGTGAACGAGTCGTGCCCAGACTC
TTCAAAAGGACCAATCACAGTGGGAGTCTGCTTGAACGCGTCCAATTATG
ACAATGTTTTGATCATGGGCCCTCCTGCTGATCAACCTCAGAATAAATGA
CGCCGGCTCCTTTACAACCAAATTGTCAACGGAGGAAAATAACAAGTTGA
TAAGCTATGGTGGCAACGCGCGTCCGATTCTGTTGGAAAAAATGTCCGAA
ATTTTAAGACGGGGATTGGACGAAAGAATAACGAGTCTATTTATGAAACC
CTCGCCTCTGGTTCAGTTGCGATATGAAGCTCAGCAATCGTTGGCGTTAT
TGGACAGTACTGAAGAAGGCTCCTTTGAATTACTTTTCATCAAAACCAAA
TCCTTCCTTCAAACCGTCGATCATATGTTCAGCTGCCATCTTTAAAAGAC
TTTCACGGTGTATATCCGGTTGTTTTTGTGGACTCAAGTGGTCACCTCAA
CCTTTGCTCGTCACTCGATACCATCTCCTATCAAATGGTACATCTGATTG
GTCGAAGGAAGGAATCACTTTGAATAAAGATACCAATGAAGATGAAAAGG
GTAATGTACCATTTAATGGGTTTTGTTGTTCAATGTTGCTGGTGTATTTG
TTGTCAGTACGAAAGATTTCTGCACACATGAGCTCCTATCAAATGTTTCG
ACTTACTCTTCACTTCATTGAGTTTCCAACAGCAGATTACAACAATGGAG
TTCTGGAGGACATGTTATACGAAGATCACTTACGATTGTTGTACTCTACT
CTCAAAGAATGTCCTGGTATGAGTGAAGCCATCCTACTCCTCAAAACGTG
GCTCAAACAACGAAGTTACAAGGGAAAGTTGGGAAAAAATTTAACGTTGT
GCTTCACCTAGCTACACCCGAAGGGCATTTCAAGTTGTCACGGTTTTTAC
CGCTGAAAAATAACATAAGACATAATTGGTATCACGGCTATGAACAGGAT
ACAACAGAAGAAATTGGCTGTGTTACATGGAAAAGATTATCTGAACTATC
GTTATTACTACAAACGAGCTATATATCTTTCATGGTTGGCTTATTACTTG
AAAGATTGGGAACACACAGAAGATCTCTCCTTTACCTGTGGAACAAATAT
CTTCAAACCAACTTTGAAAATTAATTTGAAAGATGAAAGGAAAATTTTGT
TTTCACACTCCCTCTGAAATAAAAGTTGTTGGTAGCTTTTTATTGAAAAC
TATGATCAAAGCGAATCATTCAATTGACATTGCTGTACAAATGCCACAGA
TCACAACAAACGAAGAAACAATGCTAAAAACGAACACTAAAGCCATCATC
CAAGACTTTTCAATCCTGGGTCAAGGTTTAGTAAAGAATATACAAGTAGT
GAATCAAGTGTAAATAATGAACGCAAAATACAAACATGTCGAAGAAGATG
TCGCACAAAAGAAAAAGAAAAAACAGAAAGCTAAAGATACAAAGGAACTT
TTCAATGATACCGCTATGTTCTTTTGCGATCAATACGGGGGAAGTCAAAT
TGGTGTGGTGTGGAAACGAAACAAACTCGCTGCTCAACCTTTCAAACAAT
TATTTCGTCCTTCCACAAAAGATTATGATATCGTTATTGAGTTGGATAAA
AACCATGTGCCGAAACTACCTTTCATCCAATCTTCAAAAAGTGTCCACAA
ATCGTCTGATGTGAAATTAGCATCAATGGTGTCGAACAATGTATCGAATG
AAGTCCTCCCTGTTGTCGACTTTGACCCTGCTCGCTCGTTCCTCGACCAA
TTACAGGTGGTGAAACGGTTATCGTTGCTCGCTCAAGCGGCTTTGGCACT
AGTGGAAAGCGATGGTTTTGAATTTACACAACAAACTATAATGGCGAAAG
CATGGAAGCATTGAAAGAACGTTTCACAAACTCCAGAGATCATCTTCCAC
ACATGGTTGTCATGACTCCCTATGATGTAGATGGTACCTTATGGACAAAA
CAACAACCCTCACCGCAGTTCATCTCTTTGTGGATTTGTTCGATTCTTGG
ATCATATAGCGACCTTCGATTGGAATGCAAACCCTTTGATTGTCAACCTC
AATAGCGAAATCAAAATTTGAACGGTCAATTCGGTGCATTTTCGCTGACG
TGTCGCCTGGCGAAGAGGTGGATGAGTAGTCAGATGTTGTCCAATCATTT
CTATGAAGAGTTGATCGAGTTGTTGGTCGCCTCCGTCTTTCTCTCACCAA
ACCCACCTAAAACGGCTACGTTTTTCGTTTGTCGGTCATCCATTACCGAG
AAATGGTTTTACATAAAGAAAATGTAGCCTTGGGAAAATCAAAAACTTCC
CATGACATCCAGGCTAAGAAGTTGGAAATGGAAATTGTGAAAAAGCCCCT
CCATAACTCCCTCATTCACAGCTTATATCCAGTTTGAAGGGAGCGGTCAA
TGGCCTGATAATTTAGAAGCAATCCAACACATACGCGCTGCTTTCCACAT
CAAAGTTGCAGAATGCATACGTCAGCAACTTCATTTCCCTGCAAAAGCGA
CTCCAAGGTGGATCGATGTGATGAAACCATTGACTGCTCGACAATACGAA
GTCAAGGAGCAATCAAAAGGTCAAGATTTTCTGGTACCCAGTAACGCAAA
AAGATCACCGCTTTGGTGTCCTGTAATAAAAGGCATTGTGCAATCTATCC
TTCATCCATCGATTACCATGGCAACTCGTTCGATTTCATTCTCTCTTCGA
ACACGTCATCGTTCGAGCACGCGTCAGCCAATCAGAAGAAAGCCACAATA
CCACGTGGTTGTGGTGAAGAAGAGAGCACTCACGTGATCAAAACATTTGA
AGAATTGAGTCGTCAGCTACGTGGTTTGAGTGAATTACCTTTAGTCGTCA
ACAATATACATGCAGTGGACCCATTGCTTAGGATGACAGAGGCGAAAGAG
TTCCGCGCATTTTGGGGCGAGAAATCAGAATTGAGGCGTTTTCAAGATGG
CAGTATCAACGAGGCGGTAGTTTGGCCATCATCCAATTCCAGCCAGAAAA
AAATGGTCTGCAAACAGATCGTACAACATCTTCTTAAACTTGGTCGGTGA
ACGAGTCGTGCCCAGACTCTTCAAAAGGACCAATCACAGTGGGAGTCTGC
TTGAACGCGTCCAATTATGACAATGTTTTGATCATGGGCCCTCCTGCTGA
TCAACCTCAGAATAAATGACGCCGGCTCCTTTACAACCAAATTGTCAACG
GAGGAAAATAACAAGTTGATAAGCTATGGTGGCAACGCGCGTCCGATTCT
GTTGGAAAAAATGTCCGAAATTTTAAGACGGGGATTGGACGAAAGAATAA
CGAGTCTATTTATGAAACCCTCGCCTCTGGTTCAGTTGCGATATGAAGCT
CAGCAATCGTTGGCGTTATTGGACAGTACTGAAGAAGGCTCCTTTGAATT
ACTTTTCATCAAAACCAAATCCTTCCTTCAAACCGTCGATCATATGTTCA
GCTGCCATCTTTAAAAGACTTTCACGGTGTATATCCGGTTGTTTTTGTGG
ACTCAAGTGGTCACCTCAACCTTTGCTCGTCACTCGATACCATCTCCTAT
CAAATGGTACATCTGATTGGTCGAAGGAAGGAATCACTTTGAATAAAGAT
ACCAATGAAGATGAAAAGGGTAATGTACCATTTAATGGGTTTTGTTGTTC
AATGTTGCTGGTGTATTTGTTGTCAGTACGAAAGATTTCTGCACACATGA
GCTCCTATCAAATGTTTCGACTTACTCTTCACTTCATTGAGTTTCCAACA
GCAGATTACAACAATGGAGTTCTGGAGGACATGTTATACGAAGATCACTT
ACGATTGTTGTACTCTACTCTCAAAGAATGTCCTGGTATGAGTGAAGCCA
TCCTACTCCTCAAAACGTGGCTCAAACAACGAAGTTACAAGGGAAAGTTG
GGAAAAAATTTAACGTTGTGCTTCACCTAGCTACACCCGAAGGGCATTTC
AAGTTGTCACGGTTTTTACCGCTGAAAAATAACATAAGACATAATTGGTA
TCACGGCTATGAACAGGATACAACAGAAGAAATTGGCTGTGTTACATGGA
AAAGATTATCTGAACTATCGTTATTACTACAAACGAGCTATATATCTTTC
ATGGTTGGCTTATTACTTGAAAGATTGGGAACACACAGAAGATCTCTCCT
TTACCTGTGGAACAAATATCTTCAAACCAACTTTGAAAATTAATTTGAAA
GATGAAAGGAAAATTTTGTTTTCACACTCCCTCTGAAATAAAAGTTGTTG
GTAGCTTTTTATTGAAAACTATGATCAAAGCGAATCATTCAATTGACATT
GCTGTACAAATGCCACAGATCACAACAAACGAAGAAACAATGCTAAAAAC
GAACACTAAAGCCATCATCCAAGACTTTTCAATCCTGGGTCAAGGTTTAG
TAAAGAATATACAAGTAGTGAATCAAGTGTAAATAATGAACGCAAAATAC
AAACATGTCGAAGAAGATGTCGCACAAAAGAAAAAGAAAAAACAGAAAGC
TAAAGATACAAAGGAACTTTTCAATGATACCGCTATGTTCTTTTGCGATC
AATACGGGGGAAGTCAAATTGGTGTGGTGTGGAAACGAAACAAACTCGCT
GCTCAACCTTTCAAACAATTATTTCGTCCTTCCACAAAAGATTATGATAT
CGTTATTGAGTTGGATAAAAACCATGTGCCGAAACTACCTTTCATCCAAT
CTTCAAAAAGTGTCCACAAATCGTCTGATGTGAAATTAGCATCAATGGTG
TCGAACAATGTATCGAATGAAGTCCTCCCTGTTGTCGACTTTGACCCTGC
TCGCTCGTTCCTCGACCAATTACAGGTGGTGAAACGGTTATCGTTGCTCG
CTCAAGCGGCTTTGGCACTAGTGGAAAGCGATGGTTTTGAATTTACACAA
CAAACTATAATGGCGAAAGCATGGAAGCATTGAAAGAACGTTTCACAAAC
TCCAGAGATCATCTTCCACACATGGTTGTCATGACTCCCTATGATGTAGA
TGGTACCTTATGGACAAAACAACAACCCTCACCGCAGTTCATCTCTTTGT
GGATTTGTTCGATTCTTGGATCATATAGCGACCTTCGATTGGAATGCAAA
CCCTTTGATTGTCAACCTCAATAGCGAAATCAAAATTTGAACGGTCAATT
CGGTGCATTTTCGCTGACGTGTCGCCTGGCGAAGAGGTGGATGAGTAGTC
AGATGTTGTCCAATCATTTCTATGAAGAGTTGATCGAGTTGTTGGTCGCC
TCCGTCTTTCTCTCACCAAACCCACCTAAAACGGCTACGTTTTTCGTTTG
TCGGTCATCCATTACCGAGAAATGGTTTTACATAAAGAAAATGTAGCCTT
GGGAAAATCAAAAACTTCCCATGACATCCAGGCTAAGAAGTTGGAAATGG
AAATTGTGAAAAAGCCCCTCCATAACTCCCTCATTCACAGCTTATATCCA
GTTTGAAGGGAGCGGTCAATGGCCTGATAATTTAGAAGCAATCCAACACA
TACGCGCTGCTTTCCACATCAAAGTTGCAGAATGCATACGTCAGCAACTT
CATTTCCCTGCAAAAGCGACTCCAAGGTGGATCGATGTGATGAAACCATT
GACTGCTCGACAATACGAAGTCAAGGAGCAATCAAAAGGTCAAGATTTTC
TGGTACCCAGTAACGCAAAAAGATCACCGCTTTGGTGTCCTGTAATAAAA
GGCATTGTGCAATCTATCCTTCATCCATCGATTACCATGGCAACTCGTTC
GATTTCATTCTCTCTTCGAACACGTCATCGTTCGAGCACGCGTCAGCCAA
TCAGAAGAAAGCCACAATACCACGTGGTTGTGGTGAAGAAGAGAGCACTC
ACGTGATCAAAACATTTGAAGAATTGAGTCGTCAGCTACGTGGTTTGAGT
GAATTACCTTTAGTCGTCAACAATATACATGCAGTGGACCCATTGCTTAG
GATGACAGAGGCGAAAGAGTTCCGCGCATTTTGGGGCGAGAAATCAGAAT
TGAGGCGTTTTCAAGATGGCAGTATCAACGAGGCGGTAGTTTGGCCATCA
TCCAATTCCAGCCAGAAAAAAATGGTCTGCAAACAGATCGTACAACATCT
TCTTAAACTTGGTCGGTGAACGAGTCGTGCCCAGACTCTTCAAAAGGACC
AATCACAGTGGGAGTCTGCTTGAACGCGTCCAATTATGACAATGTTTTGA
TCATGGGCCCTCCTGCTGATCAACCTCAGAATAAATGACGCCGGCTCCTT
TACAACCAAATTGTCAACGGAGGAAAATAACAAGTTGATAAGCTATGGTG
GCAACGCGCGTCCGATTCTGTTGGAAAAAATGTCCGAAATTTTAAGACGG
GGATTGGACGAAAGAATAACGAGTCTATTTATGAAACCCTCGCCTCTGGT
TCAGTTGCGATATGAAGCTCAGCAATCGTTGGCGTTATTGGACAGTACTG
AAGAAGGCTCCTTTGAATTACTTTTCATCAAAACCAAATCCTTCCTTCAA
ACCGTCGATCATATGTTCAGCTGCCATCTTTAAAAGACTTTCACGGTGTA
TATCCGGTTGTTTTTGTGGACTCAAGTGGTCACCTCAACCTTTGCTCGTC
ACTCGATACCATCTCCTATCAAATGGTACATCTGATTGGTCGAAGGAAGG
AATCACTTTGAATAAAGATACCAATGAAGATGAAAAGGGTAATGTACCAT
TTAATGGGTTTTGTTGTTCAATGTTGCTGGTGTATTTGTTGTCAGTACGA
AAGATTTCTGCACACATGAGCTCCTATCAAATGTTTCGACTTACTCTTCA
CTTCATTGAGTTTCCAACAGCAGATTACAACAATGGAGTTCTGGAGGACA
TGTTATACGAAGATCACTTACGATTGTTGTACTCTACTCTCAAAGAATGT
CCTGGTATGAGTGAAGCCATCCTACTCCTCAAAACGTGGCTCAAACAACG
AAGTTACAAGGGAAAGTTGGGAAAAAATTTAACGTTGTGCTTCACCTAGC
TACACCCGAAGGGCATTTCAAGTTGTCACGGTTTTTACCGCTGAAAAATA
ACATAAGACATAATTGGTATCACGGCTATGAACAGGATACAACAGAAGAA
ATTGGCTGTGTTACATGGAAAAGATTATCTGAACTATCGTTATTACTACA
AACGAGCTATATATCTTTCATGGTTGGCTTATTACTTGAAAGATTGGGAA
CACACAGAAGATCTCTCCTTTACCTGTGGAACAAATATCTTCAAACCAAC
TTTGAAAATTAATTTGAAAGATGAAAGGAAAATTTTGTTTTCACACTCCC
TCTGAAATAAAAGTTGTTGGTAGCTTTTTATTGAAAACTATGATCAAAGC
GAATCATTCAATTGACATTGCTGTACAAATGCCACAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_001124XLOC_001124Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00002157-proteinTCONS_00002157-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00002157-exon-sc0000018-1575043694:791724..792515TCONS_00002157-exon-sc0000018-1575043694:791724..792515Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1575043694:791361..791483TCONS_00002157-exon-sc0000018-1575043694:791361..791483Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1575043694:791031..791150TCONS_00002157-exon-sc0000018-1575043694:791031..791150Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1575043694:790519..790775TCONS_00002157-exon-sc0000018-1575043694:790519..790775Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1575043694:790102..790267TCONS_00002157-exon-sc0000018-1575043694:790102..790267Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1575043694:789725..789868TCONS_00002157-exon-sc0000018-1575043694:789725..789868Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1575043694:789231..789382TCONS_00002157-exon-sc0000018-1575043694:789231..789382Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1575043694:788702..788822TCONS_00002157-exon-sc0000018-1575043694:788702..788822Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1575043694:784010..784071TCONS_00002157-exon-sc0000018-1575043694:784010..784071Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1575043694:783755..783859TCONS_00002157-exon-sc0000018-1575043694:783755..783859Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1575043694:783086..783201TCONS_00002157-exon-sc0000018-1575043694:783086..783201Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1575043694:781284..781458TCONS_00002157-exon-sc0000018-1575043694:781284..781458Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1575043694:780909..781028TCONS_00002157-exon-sc0000018-1575043694:780909..781028Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1575043694:775384..775532TCONS_00002157-exon-sc0000018-1575043694:775384..775532Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1575043694:774748..775006TCONS_00002157-exon-sc0000018-1575043694:774748..775006Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1575043694:774494..774599TCONS_00002157-exon-sc0000018-1575043694:774494..774599Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1575043694:773389..773543TCONS_00002157-exon-sc0000018-1575043694:773389..773543Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1575043694:772735..772895TCONS_00002157-exon-sc0000018-1575043694:772735..772895Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1575043694:772405..772548TCONS_00002157-exon-sc0000018-1575043694:772405..772548Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1575043694:771529..771626TCONS_00002157-exon-sc0000018-1575043694:771529..771626Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1575043694:770291..770415TCONS_00002157-exon-sc0000018-1575043694:770291..770415Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1575043694:769937..770023TCONS_00002157-exon-sc0000018-1575043694:769937..770023Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1575043694:769498..769707TCONS_00002157-exon-sc0000018-1575043694:769498..769707Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1575043694:765532..765633TCONS_00002157-exon-sc0000018-1575043694:765532..765633Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1575043694:765000..765080TCONS_00002157-exon-sc0000018-1575043694:765000..765080Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1575043694:762016..764570TCONS_00002157-exon-sc0000018-1575043694:762016..764570Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1510915933:791724..792515TCONS_00002157-exon-sc0000018-1510915933:791724..792515Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1510915933:791361..791483TCONS_00002157-exon-sc0000018-1510915933:791361..791483Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1510915933:791031..791150TCONS_00002157-exon-sc0000018-1510915933:791031..791150Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1510915933:790519..790775TCONS_00002157-exon-sc0000018-1510915933:790519..790775Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1510915933:790102..790267TCONS_00002157-exon-sc0000018-1510915933:790102..790267Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1510915933:789725..789868TCONS_00002157-exon-sc0000018-1510915933:789725..789868Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1510915933:789231..789382TCONS_00002157-exon-sc0000018-1510915933:789231..789382Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1510915933:788702..788822TCONS_00002157-exon-sc0000018-1510915933:788702..788822Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1510915933:784010..784071TCONS_00002157-exon-sc0000018-1510915933:784010..784071Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1510915933:783755..783859TCONS_00002157-exon-sc0000018-1510915933:783755..783859Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1510915933:783086..783201TCONS_00002157-exon-sc0000018-1510915933:783086..783201Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1510915933:781284..781458TCONS_00002157-exon-sc0000018-1510915933:781284..781458Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1510915933:780909..781028TCONS_00002157-exon-sc0000018-1510915933:780909..781028Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1510915933:775384..775532TCONS_00002157-exon-sc0000018-1510915933:775384..775532Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1510915933:774748..775006TCONS_00002157-exon-sc0000018-1510915933:774748..775006Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1510915933:774494..774599TCONS_00002157-exon-sc0000018-1510915933:774494..774599Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1510915933:773389..773543TCONS_00002157-exon-sc0000018-1510915933:773389..773543Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1510915933:772735..772895TCONS_00002157-exon-sc0000018-1510915933:772735..772895Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1510915933:772405..772548TCONS_00002157-exon-sc0000018-1510915933:772405..772548Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1510915933:771529..771626TCONS_00002157-exon-sc0000018-1510915933:771529..771626Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1510915933:770291..770415TCONS_00002157-exon-sc0000018-1510915933:770291..770415Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1510915933:769937..770023TCONS_00002157-exon-sc0000018-1510915933:769937..770023Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1510915933:769498..769707TCONS_00002157-exon-sc0000018-1510915933:769498..769707Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1510915933:765532..765633TCONS_00002157-exon-sc0000018-1510915933:765532..765633Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1510915933:765000..765080TCONS_00002157-exon-sc0000018-1510915933:765000..765080Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1510915933:762016..764570TCONS_00002157-exon-sc0000018-1510915933:762016..764570Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1491911889:791724..792515TCONS_00002157-exon-sc0000018-1491911889:791724..792515Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1491911889:791361..791483TCONS_00002157-exon-sc0000018-1491911889:791361..791483Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1491911889:791031..791150TCONS_00002157-exon-sc0000018-1491911889:791031..791150Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1491911889:790519..790775TCONS_00002157-exon-sc0000018-1491911889:790519..790775Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1491911889:790102..790267TCONS_00002157-exon-sc0000018-1491911889:790102..790267Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1491911889:789725..789868TCONS_00002157-exon-sc0000018-1491911889:789725..789868Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1491911889:789231..789382TCONS_00002157-exon-sc0000018-1491911889:789231..789382Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1491911889:788702..788822TCONS_00002157-exon-sc0000018-1491911889:788702..788822Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1491911889:784010..784071TCONS_00002157-exon-sc0000018-1491911889:784010..784071Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1491911889:783755..783859TCONS_00002157-exon-sc0000018-1491911889:783755..783859Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1491911889:783086..783201TCONS_00002157-exon-sc0000018-1491911889:783086..783201Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1491911889:781284..781458TCONS_00002157-exon-sc0000018-1491911889:781284..781458Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1491911889:780909..781028TCONS_00002157-exon-sc0000018-1491911889:780909..781028Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1491911889:775384..775532TCONS_00002157-exon-sc0000018-1491911889:775384..775532Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1491911889:774748..775006TCONS_00002157-exon-sc0000018-1491911889:774748..775006Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1491911889:774494..774599TCONS_00002157-exon-sc0000018-1491911889:774494..774599Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1491911889:773389..773543TCONS_00002157-exon-sc0000018-1491911889:773389..773543Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1491911889:772735..772895TCONS_00002157-exon-sc0000018-1491911889:772735..772895Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1491911889:772405..772548TCONS_00002157-exon-sc0000018-1491911889:772405..772548Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1491911889:771529..771626TCONS_00002157-exon-sc0000018-1491911889:771529..771626Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1491911889:770291..770415TCONS_00002157-exon-sc0000018-1491911889:770291..770415Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1491911889:769937..770023TCONS_00002157-exon-sc0000018-1491911889:769937..770023Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1491911889:769498..769707TCONS_00002157-exon-sc0000018-1491911889:769498..769707Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1491911889:765532..765633TCONS_00002157-exon-sc0000018-1491911889:765532..765633Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1491911889:765000..765080TCONS_00002157-exon-sc0000018-1491911889:765000..765080Clytia hemisphaericaexon
TCONS_00002157-exon-sc0000018-1491911889:762016..764570TCONS_00002157-exon-sc0000018-1491911889:762016..764570Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000018supercontigsc0000018:762016..792515 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
18.7945 15.0715 41.8828 43.428 20.8532 17.2245 20.1927 23.1862 12.8095 15.3708 14.1031 10.9438 15.5073 17.1814 12.4355 16.3886 15.3534 15.0692 6.01487 7.71319 17.3606 17.8861 16.1883 17.1104 14.5743 17.4684 6.50912 5.61157 12.0952 12.6278
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR035082Nrap_D1
Blast
BLAST of TCONS_00002157 vs. Swiss-Prot (Human)
Match: NOL6 (Nucleolar protein 6 OS=Homo sapiens GN=NOL6 PE=1 SV=2)

HSP 1 Score: 636.721 bits (1641), Expect = 0.000e+0
Identity = 378/1034 (36.56%), Postives = 570/1034 (55.13%), Query Frame = 3
Query: 1176 MKGKFCFHTPSEIKVVGSFLLKTMIKANHSIDIAVQMPQAVLHGKDYLNYRYYYKRAIYLSWLAYYLKDWE--HTEDLSFTCGTNIFKPTLKINLKGKVGKKFNVVLHLATPEGHFKLSRFLPLKNNIRHNWYHGYEQDTTEEIEFPTADYNNGVLEDMLYEDHLRLLYSTLKECPGMSEAILLLKTWLKQRSY-KGNVPFNGFCCSMLLVYLLSVRKISAHMSSYQMFRLTLHFIGTSDWSKEGITLNKDTNEDEKLPSLKDFHGVYPVVFVDSSGHLNLCSSLDTISYQMLRYEAQQSLALLDSTEEGSFELLFIKTKSFLQTVDHMFRIN-----DAGSFTTKLSTEENNKLISYGGNARPILLEKMSEILRRGLDERITSLFMKPSPLVQWSVNESCP---DSSKGPITVGVCLNASNYDNVLIMGPPADQPQAKEFRAFWGEKSELRRFQDGSINEAVVWPSSNSSQKKMVCKQIVQHLLKLHCAIYPSSIDYHGNSFDFILSS--NTSSFEHASANQKKATIPRGCGEEESTHVIKTFEELSRQLRGLSELPLVVNNIHAVDPLLRMTE---PLTAR-QYEVKEQSKGQDFLVPSNAKRSPLWCPVIKAYIQFEGSGQWPDNLEAIQHIRAAFHIKVAECIRQQLHFPAKATPRWIDVMKNGYVFRLSVIHYREMVLHKENVALGKSKTSHDIQAK-KLEMEIVKKPLHNSLIHSLNGQFGAFSLTCRLAKRWMSSQMLSNHFYEELIELLVASVFLSP---NPPNSSLCGFVRFLDHIATFDWNANPLIVNLNSEIKSESMEALKERFTNSRDHLPHMVVMTPYDVDGTLWTKQQPSPQVVKRXXXXXXXXXXXVESDGFE-FTQQTIMQLFRPSTKDYDIVIELDKNHVPKLPFIQXXXXXXXXXXXXLASMVSNNVSNEVLPVVDFDPARSFLDQLQELFNDTAMFFCDQYGGSQIGVVWKRNKLAAQPFKIMNAKYKHVEEDVXXXXXXXXXXXDTKITTNEETMLKTNTKAIIQDFSILGQGL 4211
            +KG F F  P+++ VVGS+LL T I+ + ++D+A+ MP+ +L  KD LN RY+ KRA+YL+ LA++L       +   S+T G ++ KP+L +  +GK  +   V LH   P   F+  R LP KNN+R  WY G         E PT  YN  VL+D + E HL+LL + L    G+ + + LLK WL+QR   KG   F GF  SML+V+L+S RKI   MS YQ+ R  L F+ T+D +  GI+L    + D  LP+L DFH  + VVF+DSSGHLNLC+ +   +Y  +++EA+ S+ LLDS  +  F LL +  K  ++  DH+  +       A     KL  E  +     GG+     L  ++ +L +GL  R+  L     P+ +W +++  P   DS    +T+G+ L      +VL +GP ADQP+A +FR FWG +SELRRFQDG+I EAVVW +++ SQK+++  Q+V HLL LH  I  + + Y G   D ++     TSS                 GEE     ++ +++LSR L GL  LPL V+ +    P+LR TE   P   R  +   E  + +  L+P   K  P +   +      EGSGQWP + EA+Q +RAAF +++AE + QQ     +AT    DV+K+G+VFR+ V + RE  + KE  +     +  D  A  +LE +  + PL  S +H L  Q  AFS   RLAKRW+ +Q+L   F +E ++L+ A++FL P    PP+S   GF+RFL  ++TFDW  NPL VNLN+E+  E    ++  F  +R  LP MV++TP D   ++WT+  PS Q++++L +LA  AL ++E    +      I  +FRP    YD++I L   H+P+       ++V   +      ++S    + ++PV+ +DP + +L QL+E F D A+FF DQ+GG  IGV+WK      QPFK  + K + V                  ++   E ++  N +AI++DF++LG+GL
Sbjct:  148 VKGCFRFLPPAQVTVVGSYLLGTCIRPDINVDVALTMPREILQDKDGLNQRYFRKRALYLAHLAHHLAQDPLFGSVCFSYTNGCHL-KPSLLLRPRGKDERLVTVRLHPCPPPDFFRPCRLLPTKNNVRSAWYRGQSPAGDGSPEPPTPRYNTWVLQDTVLESHLQLLSTILSSAQGLKDGVALLKVWLRQRELDKGQGGFTGFLVSMLVVFLVSTRKIHTTMSGYQVLRSVLQFLATTDLTVNGISLC--LSSDPSLPALADFHQAFSVVFLDSSGHLNLCADVTASTYHQVQHEARLSMMLLDSRADDGFHLLLMTPKPMIRAFDHVLHLRPLSRLQAACHRLKLWPELQDN----GGDYVSAALGPLTTLLEQGLGARLNLLAHSRPPVPEWDISQDPPKHKDSGT--LTLGLLLRPEGLTSVLELGPEADQPEAAKFRQFWGSRSELRRFQDGAIREAVVWEAASMSQKRLIPHQVVTHLLALHADIPETCVHYVGGPLDALIQGLKETSS----------------TGEEALVAAVRCYDDLSRLLWGLEGLPLTVSAVQGAHPVLRYTEVFPPTPVRPAFSFYETLRERSSLLPRLDKPCPAYVEPMTVVCHLEGSGQWPQDAEAVQRVRAAFQLRLAELLTQQHGLQCRATATHTDVLKDGFVFRIRVAYQREPQILKEVQSPEGMISLRDTAASLRLERDTRQLPLLTSALHGLQQQHPAFSGVARLAKRWVRAQLLGEGFADESLDLVAAALFLHPEPFTPPSSPQVGFLRFLFLVSTFDWKNNPLFVNLNNELTVEEQVEIRSGFLAARAQLPVMVIVTPQDRKNSVWTQDGPSAQILQQLVVLAAEALPMLEKQLMDPRGPGDIRTVFRPPLDIYDVLIRLSPRHIPR-----HRQAVDSPAASFCRGLLSQPGPSSLMPVLGYDPPQLYLTQLREAFGDLALFFYDQHGGEVIGVLWKPTSFQPQPFKASSTKGRMV------------------MSRGGELVMVPNVEAILEDFAVLGEGL 1133          
The following BLAST results are available for this feature:
BLAST of TCONS_00002157 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
NOL60.000e+036.56Nucleolar protein 6 OS=Homo sapiens GN=NOL6 PE=1 S... [more]
back to top