Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00002137 (transcript) - C. hemisphaerica

Overview
NameTCONS_00002137
Unique NameTCONS_00002137
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1973

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00002137 ID=TCONS_00002137|Name=TCONS_00002137|organism=Clytia hemisphaerica|type=transcript|length=1973bp
ACTAAAAAACAGGATGGTCGAAGGGTTAAGACTCGTTATGCTCGTGTTAT
AAGgtgaagaaaaattgaaagtgaagATGGGAACTTGAACGGAATTTCTC
GAATAATACTCAAATACCAAAGATTTCTGACTAGAAGAACATCTGGAACA
CGAGAGAATATTTTATACGGCAATCATAAATTGAGTAGTATACAAATGCC
GAAAATTTGATCAACAAAACTCATTGAAACTAAGTTCATCAGACATTAAG
AACCTCAACTGTATTCAATACTATTTACAAGATGGTTGGAGCATCATTCC
GCAGAGAGTTCCATATGGCGTTTCTTCTTGGTTTATCCTTCGGCTTCTTT
ATTGCTGTCATATTTCGTGAATTGCAATCTTCGTTTTCTGAAACCAAAGA
TTTGGTCAACAAAGGACCACCATCTGGCAGAGCAATGGAAGAAGATTATG
CCATGCTATTAAGTGAAGAATATGAAGGAAAACATTTGCCACCTCCTTCC
AAACCTCAACCTGTTGATAAACCAATCATATTCAATGATCTAGATTCTAT
ACATCATAAAGGTGGTGACCGAGTTGCTAAATTACTTTCGAAGAAGGTTC
GAATTCTATGTTGGATCATGACGCAACCGAAAACATTGAAAACCAAAGCA
CAAGCTGTCAAGAACACGTGGGGAAAACGTTGTAATACACTGCTGTTCAT
GAGTTCAAAGGGTGATAAAGATTTCCCAGTAGTTGGGCTGAACGTACCAG
AAGGTCGAAAAAACTTGTGGTTGAAAACACGCGCAGCTTGGAAATATATT
TACGAGCACCATTTCTACGACGCTGATTGGTTCTTAAAAGCCGATGATGA
CTCATTTGTCGTTCTCGAAAATCTACGTTATTTCTTATCAAAGCATAATT
CAAGTCAGACTCATTATTTTGGGCGACATTTCCGCCCTTTTGGCGGCTAC
AACTCTGGTGGGGCGGGCTATGTTTTCAGTAAAGCCACCCTGATAGTATT
CAACCAAGTACTACGTGATCCAAGTGTTTGCAAACTAAAAGCAGGCGCCG
AGGATGCAGAAGTAGGCGTTTGTTTACGAATGATGGGCGTTGTGCCCGGT
GATACTAGAGACGAATTTGGGCGTGAAAGTTTCCACCCGTTTGCGCCTGA
TTATCATTTAGTACCGAATGGTATACCCACTACGAACTGGTTACATAAAT
ATAATAAACATCCGGTCAAATCGGGACCTGGATGTTGTTCAGACCATAGT
ATAGCTTTTCATTATATTCCGCCAAACCGGATGTATGTGATGGAatattt
tatttatcatttGAGGCCGTTCGGTGTGCACCACGTACACAACTGACATC
ATTCAGCCTAGTTTGCTACAAGTAGTGCTCTGAATGGTGACATTGGGTTA
TTCTAGAAATACTCTGTATTTTGTTATCGTCTCCCTTTTTACTTTACAAA
TAGTAGCTCTTATTAGAGCGTGATCAGTTCTGTTTACCAATAATCCATTT
CAACCGTGAAATTGTTCATCGGTATAGGGGGTTGTTATATTGTTCTTGGA
AGTAATAACATTCGAGAGATTCATCCCTGACGGaatatttataattttaa
aatcgaaattgaTGGGAAATTGGTTCTGTTTTCATcaccatttgaaattc
aatggaaaaatattgcattccaaaaccatccccacttgGGTTTTTGACCT
TGATCCCCCTTTGGACTTCGATAGAAATGTTATCTCCACTGTTgtgggaa
gaagttccaccggggctgtgagacatgTGTCATAAAGCTTTTAACCAATG
AGAGATTTTGGCACTGCCACTTGTGGCTTTTTATGAATATCGATCAAGTT
TATATTGTAGATATTTTTTGAATCAATTTATATAAAAGTAAAGTGACTct
atattttttagtatttttaataaattatatgaaaatataaaggaataaca
aaaatttaaaaattcatacTCTA
Run BLAST on NCBI

protein sequence of TCONS_00002137-protein

>TCONS_00002137-protein ID=TCONS_00002137-protein|Name=TCONS_00002137-protein|organism=Clytia hemisphaerica|type=polypeptide|length=354bp
MVGASFRREFHMAFLLGLSFGFFIAVIFRELQSSFSETKDLVNKGPPSGR
AMEEDYAMLLSEEYEGKHLPPPSKPQPVDKPIIFNDLDSIHHKGGDRVAK
LLSKKVRILCWIMTQPKTLKTKAQAVKNTWGKRCNTLLFMSSKGDKDFPV
VGLNVPEGRKNLWLKTRAAWKYIYEHHFYDADWFLKADDDSFVVLENLRY
FLSKHNSSQTHYFGRHFRPFGGYNSGGAGYVFSKATLIVFNQVLRDPSVC
KLKAGAEDAEVGVCLRMMGVVPGDTRDEFGRESFHPFAPDYHLVPNGIPT
TNWLHKYNKHPVKSGPGCCSDHSIAFHYIPPNRMYVMEYFIYHLRPFGVH
HVHN
Run BLAST on NCBI

transcript from alignment at sc0000018:363997..375098-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00002137 ID=TCONS_00002137|Name=TCONS_00002137|organism=Clytia hemisphaerica|type=transcript|length=11102bp|location=Sequence derived from alignment at sc0000018:363997..375098- (Clytia hemisphaerica)
ACTAAAAAACAGGATGGTCGAAGGGTTAAGACTCGTTATGCTCGTGTTAT AAGGTATGCACAATACTAGTGCTATATTCCAAACCCTGTCAATCCCCCGG GGGGGGGGGCACTCGATTTCTAAACAACGGCATGTGCCGTCAAAATATTG GCTTTCAAAATCAAACCTTTACAGTGCAACCCTTGAGCAGTGAAAAGGTA CCCTTACAGTGCATTTTACCGAACGTTTCTGACCCTTACAGTGTAGCTTG ATTTCATATCTTATTTTGCTGAATCCATCTGAAAATGAGCCTAAGATGTC GATACAATGTGCAAAACAAATTAAAATGGGTGCGAGTCAAAACTATAAAG ATACATCCGATTTTTACTGTCAGACTTGTTATTCAGCAGTCCCCAAATAT ACCCTTACAGTGTATCCAGCTAAACGAACACCTTTGTAGTGTACTCTATC AAAATACACCTTTACAGTGCATTTCAAGGGTCTCGAAAAACCTAGCCTTG AGGGTATGTGCTACCGTGGGTCGGACCATATGAGTGATCCCCCAGAGCTG TCGATACAGTAGTAAGAATTTTAAAATCATAAGATTTAGACATCGATACT GTATAGCATTGAATATGCATTTGTTTTTTTATAAAAACATCCAAAAATTT TGAAGCCTATGGATGTTCTTAACTTCTTGACTTTTGAGCCTAAAAATGTT CTTAACATATTCTTATTTTCACTATTATGAGAGTATTTTTTGTCCATTTT CCAAAGAAAATAGATGTTTTAGGGTCTACAAAGCCTTAAAATGTTCATAA CTTGTCCTTAACATTTTGGCCATCGAAGCCTTATGTTCTTATATAGTTTG TTCTTATAAAAAAATCATGTTGTGTATAGCACTGAATAAGTGTCAATGTT TATCATTGAAATTAACGTTTTTAAAGGAATACACAGGAAAGTATCTATCC TTTTCTTTTTTTCTCTTTCTTTACTCGTTAAATCTAATCCTACTTTGTCT TAACACAATGTTAAGATGACAGCTTTGTTAATTTTTTTCATTTATGTATA GGTTACCCGCTGTATTAAAGTAATCTATTTTTTAGGAGTTATTAAGTTTT TAAAATGGCTTCCAGTTCAGTCTAGTTTGGTTCTGCTTCGGTTTGGGCCT TTTACAGTTGTCCTGATGCTAAAACAGCGACAATATATTCTATTCTTTTC TAATGAATGGTGTTATTATGATCAAAGAAAAACAAGTTTTGAAAAGAATA AAATGTAACAAGACACTTTCATATATGCGTCACTTGATGGTCGGAAAATG ACTTGACTGACTTCTAGGGACTCTTGTGTATAATAACACATTCATGTCAA CGTGGTGTAATGTCTGATATGTGGAAAAGATTGTTTTATGAAATCTAAAC TTGAATACGTTGTAGTTGTTTTCAGAAGGATGGCGTTTACGAATTATAGA CTTATCAGGACTAATTCAGTAGCGTAGCCAAGGGGGGGGGCGCAAAATTT GTGTAGGAGAGTAGATTTTTATGACACAGTAATTATATTTTGTAATTATA TATCTGATAATTATAATTATAGTGTCAAAAAAATCTGCTCTCCTACACAA ATTTTGCGCCCCTCCTGTCTACGCTACTGCAATTAAGTAAGTAAGTCATC GACCACAGTCAAAGGTGACTTTGAAGGCTCCTCTTTTGATAGCTATGGTA AGAGAGGGTGACACTCTTTCTGACACTCTTTCTCCCTGGATTGCTCCACT AACCCTTAATCTTTATCTTAATTTTGGAGCATTAATCAGAAAGCATCAAG TTTTATTTTGTACTAAGTACGAAGTTTTTGGTATAATCCTGTCTGGGACA CACGACCTTGCGTCGGTGTTGAATTCTCTACGTTTGCACTACGGCCAGGC CTACACCAAAGCCTGTCTGAAATGAAACTAGTTTTGAGTTTAATTGGGTC AAATGACCTCAAATCCCAGAAGTCATTGGATTGATGTAATACACGTTTTT TTTATGAGAACATCCAAAATGTTTGAAGCCTTCGGATGTTCTTAACTTTT TCAGTTTTAAGCCTAAAAATGTTCTTAACATGTTCTTATTTTGACCGTTT TGTGGGTATTTTTGACTCTTAAAATGTTCTTAACTTGTTCTTAACATTTT GGCTATCGAAGCCTTATTTTCTTATATAGTTTGTTCTGATAAAAAAAAAC GTTTAACAACTAAAAAGAAATTTGACGTCATTTGGCCCAAACCATGTGTT TAAAGCTTGAGAATTTTTGAGTACTATAAACCTTTTTCCATGAAAGCTTT TTAGTACATAATTTTCCAACTTTGAACGTAATTTGAATGGTAGTACTGTA TTTGAGAGTGGTAAGCAGTCAAAGTGAACAATCAAAGAAAAAGTTCTTTC CTATGTGATCCTAGCCCTTTCTACACTATTCTTATTCATTGAGTGTATCA TATCAGTTAAATAGTTTTAAAGATTTTAGCGTTGTCAAAAGTGAGCCAAA TCAAATTTCTAAAGCGGCTTTGCAGAAAGCTAAGCTCTATTTTAATTTGC TTGGCTACGAAAAGCTCTTTAACACTTATATAAAATGTAGCCACAATATA TTTGCTATGATGATTTTCTTTATCACCCTTACACAACTTGTACCTATATA CAAGCTGTTATTGTAAGCAGTTACTTTTATAATCATTCTCTCGAAATAAC CATACCAGCCTTCTCCAAGGAAACGGCAAAAAGATTTCAAGTAGTAATGT CCCCGCAATGGACACGTCAAATCGCTCGGCTGAAATGGGCGTTTTTTTCT GTAAGAACATACGGTTTTGAGGCCAGAAATTTAAGAACATTCTATGAGCA TTTTAAGGCTTTTTGCGCTCTTTTACACAAAAATACCCACAAAAATGCAG AAAATAATGACATTTCAAGAGTACATTTTTAGGCTTTAAACACACAAAGT TAAGAGCACCAAAACAGACCCAAAGGGATCAAAAATCACCCTTACAAAAC TTGAAGCTGTATACAAACTGTTATAGTAAATAACTTTCCCCGAAATAGCC CTAACAGTCTTCTCCAAGGGGCCGACGGAATGATTTTGAGTAGTAAGGGC CTATTAGAAACGTCAAATCCCAAATATATACTGGTATACATTCTTTATTA GAATACACGGTTTCGAGGCCAAAAATATAAGAACATTCTAAGAAAAGTAA AGGTTTTGTGCGCTCTTGAAAATTAGGTATAATAGTCACAAGAATGCTAA AAATTATAGCATTTTGAAGCCTTTTAAAAATACATATCTGTACTAGTTTT AAGGCCGATAATGTAAATGTTGAATTTGAATACAATATTACATTGTTGTG TGAATAGGGGTTTATGAATCATATTGAAATATTTATCACGGTACACAATA AGCCTCTAAGCACATTTTCTTTCGATTGTTTGATTTCTTAATTCACAGTT AGGTACTAAATTCGTTATTGAAAAACAGTAAATTTTTGTACGGTCTGTAA ATTATTAACTTTTATGAATTAGATACATTGGCAGTGAATATTCACATGTT TGTTAAGAATTATTAAATTTTTATTGATTTTCGTATTCTGCTTTTCTTTA GGTATCATGTAATATTTTCCATACTAGCTGTGTCCTAAATGTTTTTTGGA TTTTCGTTGAAAATTAGAGTAAAATTATGGATTGAATTACCCTGGCGCAA CGATAGGCTGTGGTTTTGGTAGATTTTTTTTTGCTTTTATAAAGAAAAAT ATGGGAATATCACGCTCCCATAGGTTTGGTTGTCCTTTTTCTTATGTTCG TTTTTCATACTAATTGAAAAGGTATTTGGGAAAGAACCTCTTGCACTCCT GAACCCATGAGATTGGCCAGTTGATACATACTGTGTTTTCTGAAGAGTTC TTATTGTCTAAATCCTGACTGACTGAGGGCAACGGTAAATCACCACTTTT ACAGTCCTCGACACTATTGGCAGGATTTACGGGGATATGGCGGTACTGTT CAAGAAATGACATGTTTCCTGTCATTTAATGATTAATCTTACNAGATTTA CGAGGATATGGCGGTACTGTTAAAGAAATGACGTGTATCTACATGTTTCC TGTCATTTAATGATTAATCTTACCGGATTCTCTTTTCCATAAAGTTTGTT TTTGTTAAAAATATAAAAACGTTTAGCTAACTATAGGCGTTTATAGGCAC AAATAAAGTAGCAAATTATTTCAAAATTCAGTTATCGACCAAGTACGGCT TGAGTTAAAGATGATACTTTAAGATTTTCTCTAATTTTAATGCTCTCAGA AATATCTTTTTAAAGGCATCTATTGTTTTTTTAGGTTTTGCATTAAACTG TCAAATAAAGTGCATATTATAAGGTTTTGAGAGACTGTTCTTAAAATTAA AGGGGTTTAGACTTGAATGTTTTCTAAACAAAGTCGTATTATAAGAGTTT TGACCCTATCATAATTTCCTTCATGTTAAACGTTGTAACAAAATAAAGGT CGATATCTCGTGGTGATTTTTATTACCTTAAAGAATCTAAAATGTTGTTA GAGTATTTTCGTACAGTTTGACAAATTGTATGACTGGCCTGGTTGTTGGT CTTTGTTAACCTTTAAGTCGTATAACTTTGATCAGGTTAGAATGTTGAAC TAAATTTTGTAGTTTTTTATTTTCAATCAGTTGTTTTGCACGTGGTAATG ATATTATTGGACCTTTTTAAATGTAACATTTTCTTGATAATCAGTACATG CAACGAGATTCATTTTACATGGTATTTATCTAACTATTTTGGTGCTGCAA AAGTTTAGGGTTCATTCCCACTGGGTCTTTGTGACGCGGGGATGTTTTTA TTTATCGAATAAAATGTCACTTTAAATCTCCTTCGTTATATCATACCATA CCATTTTCAAAAGTTCTTTAAATCTTTTCTAACATTTTTATCAGTCACTC ATATCAATTAAACTCTTGTAAGATAACCGGTAAATCCTACAAACATTTCC ATTCAAGTCTTGTCATCTTGTAATCCAACTTTTACAAGTCCTCTTGACTC ATCTTTAACAATATATTGATTTTCTACCATGTACATCAAGGCGTAAGTAA ATGTAGATGAAACTATATGCAAAAGTTAAACTTTTTCTAATGCTTGGATT TCTTGCTTTTTCAAGCACGCAGTCATCAGTTGGTTTCATTAGTTAAGGTT AAGTTATTTGAGTATGTAAAAGTTGAAATTTCATATGGAAAAAAGGACTG CATAGGCGGTTTTAGACCATGTCGAACTCAGAGGAAGAGATTTGTAATTG TGATTTCATTGTATTTTAACGAGCGTTGCACTCCTTCGCATGTTTCCAAC GTACTTGCTCTATTGTCTTAACTCCGCCATTGAAAGTAATTGCGTTTTCT CAATTCTTCTAAACAGTGACTTTTAGAATGAGCATATTTTACCAGCTTTT ATTTAAATTAGTGGAATGGTTTTTAAGCTTTTTGGAACAGGCTTTCTGTA TCAGTGAAGCTTACATGTAAAACGGATAGTGCCCATCCAATTTTTAAACG GCGGCATGTGCCACCATATAATTGGTATTCGAAATCGGACCTTTACAGTG CAGCTTTTGAGCAGTGAAAAGGTATCATAAAGTGTATTTTACTGAATGTT TCTGATCCTTAAAGTGTGGTTTGATTTCATGTCTTATTTTGCTGAAGTCA CCTGGAAATGTGCATGAAGTGTCGACAAGGTGTAAAAACAAATAAAAAAT GCGAAATGGGTGCGAGTCAAAACTATAAAGATAAAGATTTCTACTGTCAG ACTTGCAATTCTGTAAGAATTATCATTCAAAATCTTTGTTATATCCTTAA ATTTTTTTTTCATTGTCCATCCAGCTAAAAAATAGACCCTTATAGCGCAC TATCAAAAGTATACCCTGCAGTACATTTTAGGGGTCTTGAAATACCTACC CTTAAGGCGGCTAACTCGATTTGAGTCCCCCCCCCGGATGTAAAAATATG TTTTTATAAGACGAGACCAATTTAATTTGTTGTTCTACGGGCGCGGCCGA CCCAGTATTTGCTGCAAACGAAAAAATAATAATATTGAATTTCCTGTGCC AGAAATTTCCAATAATAAGTAGTCATTGAAAAAATTTACACTTAAAAAAG AATTTGAAAAAAGACTCTAGAATCATGAAATCTCNGATTTATGTCTGCAG TTTAGTCTAAAATCTTCCAATCAAATTATAAGAGGCCAAACAGTGTACGC GTCACCGAGTTCAATTTCGTATTCTGTTGAAGTTTTTCATATGAATATGC TAAAATACTTCAAACTTTTCAGAAGCTTTTACGATGAAGAATTTATATTT CAATGAATTTAACAAACATTTATTCAAACAATATTTTTCTATCAACCCCC TTGAACAATTTTTCCCTATATTTTTGTTTCAAAATTATTATCCTTTTTGA TATGATTTTTGGTAAATTTCATTAGCTATTAGAAACTCTACAGTGATAAA AATTTATTGAATGTCTCTAGATCTGGCCCAATATAAAGTGTGACAGTTTG GAAATAATTACCAGGTTAGCGAGTATCTGTAACTCGAACACGCGCAGGAA ACATAAATTGTTCGAGTTAAGGAAACATTCGAGTTGTAGAGGTTCAACTT ATGGAAACTACACTGTACTAATGTCAGTAGAATACTTCTCGAAGTACCTA AATCCTTAAAGGGCCCTTAAAGTAAATGGTAACGGGAGTATTTAAAAAAC ATATTTATTGTTATTGCGATTTTCAGGCTTGACACTTAGAAATTTACTAG CATTTCTATATTATCTTATATTTAGGTGAAGAAAAATTGAAAGTGAAGAT GGGAACTTGAACGGAATTTCTCGAATAATACTCAAATACCAAAGATTTCT GACTAGAAGAACATCTGGAACACGAGAGAATATTTTATACGGCAATCATA AATTGAGTAGTATACAAATGCCGAAAATTTGATCAACAAAACTCATTGAA ACTAAGTTCATCAGACATTAAGAACCTCAACTGTATTCAATACTATTTAC AAGATGGTTGGAGCATCATTCCGCAGAGAGTTCCATATGGCGTTTCTTCT TGGTTTATCCTTCGGCTTCTTTATTGCTGTCATATTTCGTGAATTGCAAT CTTCGTTTTCTGAAACCAAAGATTTGGTCAACAAAGGACCACCATCTGGC AGGTAAGCGTTTATTCCGATTTTACCATTATATCCCAATTAGCACAGCCT TGATTAATCCTTGAGTGAAGCAGTACACCTCAGTACATTCAAGATTTGTA GTGCTATATTAGACTTAAGAAAAGAAAACGGAGGTCTATTGCAAAAGTTT ATATACAATCTCCCTGGTAGACGCTGAAGTATAGAATTTACCACCTAGCT CTTATCTTAAAGATGGTTTCCACTATCGAAGTTGTTTGACAATATTCAAC AAAGCGTCAAGAGAAAGTACCACTCCTGAGTTGGATAAATCACGATAGCC TGGATAAAAGTACCGTTGCACAATAGAAACTATAAGCGTCAATAGTCGCA AACTATCTGCCGAACCTTAAATATCTTACCTACCTCTACAAGCTCATTCA TTACGTATTATCGCATTTTCCATTCTTCCTTATCACAGGAAAAATTAAAT AAATCACCTTGTCGGGGAATGTACATGTCACACCTGAGAACATGAATGAT TTTCCCACCCTGGTGGAATTCCTGCACATTCCAAGGCGTGAAATGCTCTT TTCCCACCCTGGTGATCAGCTCAATTTTTCTTGTTGATAGCTCCAGATGA TAAGCATGCGTCCATCAGTAACGTAAATAAAACCTGGGATAGAAGAGGAG GTTGCTACCTTCATGGTTGCACGATCTAATGTAATTCTTTCTTGTAATTC TTCTGATCCAATAGAGCAATGGAAGAAGATTATGCCATGCTATTAAGTGA AGAATATGAAGGAAAACATTTGCCACCTCCTTCCAAACCTCAACCTGTTG ATAAACCAATCATATTCAATGATCTAGATTCTATACATCATAAAGGTATA TTACAGTCCCTATAACTCGAACCTTTATTACTTGGAATGTCTCCTTAACT CAAACATTATTTTGAAAGATCTTATCTTTCCTTGATTTGAAGTAAAAACT GATACAAACATCCCATCTTACAGCTTTGGTTGGACTTCTTCCCACAAGTA GGAAGAAAATTTCCATCGAAATCCCGATTGGGATAGAAATCTTATGGTTT AAAGGACAAAGTCAAAATTAATTCTTTAGTTAATGATATATGATATAGAA GGGAACATGATCTCTTATGCTAACAAAACATTAAAACAATCCAATCGAAT TTCTCAAAGTTTGTTCTCGCGCGGTGCAGAAAGAAGAAAGAAAAGTTGAT CTTTCTTTTTGTTTAAAAATGCTGTGTAATCGAATAGTAGGAGGTACGTT AAATCATGTCGTATAAGGATAGTCAAATACCAGCGAAACTTTTTTCTCAC ATTTTCAGGTGGTGACCGAGTTGCTAAATTACTTTCGAAGAAGGTTCGAA TTCTATGTTGGATCATGACGCAACCGAAAACATTGAAAACCAAAGCACAA GCTGTCAAGAACACGTGGGGAAAACGTTGTAATACACTGCTGTTCATGAG TTCAAAGGGTGATAAAGATTTCCCAGTAGTTGGGCTGAACGTACCAGAAG GTAAAATCTCATTTGATGAGAATTTTATTTCAATATATTATATATAGAGA GGTTTATCTAAAGAATCCTGCATTACTAAAAGTAACCAAAAGAACGACAA ATTTCACCATTCATAACCCCGACAGAAAGTGACCACCCTTACATATTCAT TCCTTTTTTATTATCACGGGAATTAACTACATGCGGTTTAAAAGAACGAC AAATTATGCATGCGTGTTACAATGCAGAATTCTTTAGAGGGACAGACTGA TATTATTACCTGATATTATCTGATACCATATAGGTTCTATTCTTATTTTT ATGTTTTGGACGTTAGATAGAAATTGTGTTGACGTTAGGCTTGGCTGGTA GTATCCTCTTATATGTTCTGTTATAACTTATGATAAAAATTATCTTTGTA TTATGCGCGGCCAACCTTATTTTGGGCGGGGTTGGTTTCGCTAAGCTTTT CATGGTGTTTCAATGCAGATTCTGGAGATGAGTTTGAAAAAAAAATTCAC AGTGTACAAGCCAACCCAGTTTCTTAACCACCTAGCCTGGTGTGTTGGCA AACGATATCATACTCCAGGATGCAAGTGAAATTTTTCAATCCGCGGACGT AGACGGGGGTTTGGTTATTATCAGTTAGGATTAGCGTTGGAGCTCGAGAG TCACAATATCAGGCCGAAGGCCTTCTTAGGGGCATTCGCACCCTGTGACT TAACTTTGGATCCCCTAGGGATCCTTGTAGGGGCACCGGTAGGGTTGGGA GCTTTCTTAATTAAGGTCTGTAAATTACACGTTATAAGTATTTGTGAATG ACAGCTTTTTGTCGTGTCTCGATGGCGCAAGCGGTTAGGCTGGTATGTAA ACCAAGATTGCTTGCATTTGGTGGTTCGAGCCGGGGTCGATGACCTGTTT CACCGGTACGGGCAAATTTCAGAAAAATACTTAGAAAACGGTTAGAAACA CTTGAGAACGATAGAAAATCAGGATAGAAGATAAGAAAGTAGAAAATAGG GGGAAAATAAGAGACGATGCATCCTGGAGTATGATATCGTTTGCCAACCT AGCCAACCACCTTCCAAACTTAGTCGGCGTCTCTTAGACTGTTTATTACC TGGCACGTTGGTAAAGTCAGCACTATTTAGCACTTTTTATCTGTGTTTTC TTCTAATCTTGCTTTTATTTCTTTTCATCCAGGTCGAAAAAACTTGTGGT TGAAAACACGCGCAGCTTGGAAATATATTTACGAGCACCATTTCTACGAC GCTGATTGGTTCTTAAAAGCCGATGATGACTCATTTGTCGTTCTCGAAAA TCTACGTTATTTCTTATCAAAGCATAATTCAAGTCAGACTCATTATTTTG GGCGACATTTCCGCCCTTTTGGCGGCTACAACTCTGGTGGGGCGGGCTAT GTTTTCAGTAAAGCCACCCTGATAGTATTCAACCAAGTACTACGTGATCC AAGTGTTTGCAAACTAAAAGCAGGCGCCGAGGATGCAGAAGTAGGCGTTT GTTTACGAATGATGGGCGTTGTGCCCGGTGATACTAGAGACGAATTTGGG CGTGAAAGTTTCCACCCGTTTGCGCCTGATTATCATTTAGTACCGAATGG TATACCCACTACGAACTGGTTACATAAATATAATAAACATCCGGTCAAAT CGGGACCTGGATGTTGTTCAGACCATAGTATAGCTTTTCATTATATTCCG CCAAACCGGATGTATGTGATGGAATATTTTATTTATCATTTGAGGCCGTT CGGTGTGCACCACGTACACAACTGACATCATTCAGCCTAGTTTGCTACAA GTAGTGCTCTGAATGGTGACATTGGGTTATTCTAGAAATACTCTGTATTT TGTTATCGTCTCCCTTTTTACTTTACAAATAGTAGCTCTTATTAGAGCGT GATCAGTTCTGTTTACCAATAATCCATTTCAACCGTGAAATTGTTCATCG GTATAGGGGGTTGTTATATTGTTCTTGGAAGTAATAACATTCGAGAGATT CATCCCTGACGGAATATTTATAATTTTAAAATCGAAATTGATGGGAAATT GGTTCTGTTTTCATCACCATTTGAAATTCAATGGAAAAATATTGCATTCC AAAACCATCCCCACTTGGGTTTTTGACCTTGATCCCCCTTTGGACTTCGA TAGAAATGTTATCTCCACTGTTGTGGGAAGAAGTTCCACCGGGGCTGTGA GACATGTGTCATAAAGCTTTTAACCAATGAGAGATTTTGGCACTGCCACT TGTGGCTTTTTATGAATATCGATCAAGTTTATATTGTAGATATTTTTTGA ATCAATTTATATAAAAGTAAAGTGACTCTATATTTTTTAGTATTTTTAAT AAATTATATGAAAATATAAAGGAATAACAAAAATTTAAAAATTCATACTC TA

Coding sequence (CDS) from alignment at sc0000018:363997..375098-

>TCONS_00002137 ID=TCONS_00002137|Name=TCONS_00002137|organism=Clytia hemisphaerica|type=CDS|length=4260bp|location=Sequence derived from alignment at sc0000018:363997..375098- (Clytia hemisphaerica)
GTCGAAAAAACTTGTGGTTGAAAACACGCGCAGCTTGGAAATATATTTAC
GAGCACCATTTCTACGACGCTGATTGGTTCTTAAAAGCCGATGATGACTC
ATTTGTCGTTCTCGAAAATCTACGTTATTTCTTATCAAAGCATAATTCAA
GTCAGACTCATTATTTTGGGCGACATTTCCGCCCTTTTGGCGGCTACAAC
TCTGGTGGGGCGGGCTATGTTTTCAGTAAAGCCACCCTGATAGTATTCAA
CCAAGTACTACGTGATCCAAGTGTTTGCAAACTAAAAGCAGGCGCCGAGG
ATGCAGAAGTAGGCGTTTGTTTACGAATGATGGGCGTTGTGCCCGGTGAT
ACTAGAGACGAATTTGGGCGTGAAAGTTTCCACCCGTTTGCGCCTGATTA
TCATTTAGTACCGAATGGTATACCCACTACGAACTGGTTACATAAATATA
ATAAACATCCGGTCAAATCGGGACCTGGATGTTGTTCAGACCATAGTATA
GCTTTTCATTATATTCCGCCAAACCGGATGTATGTGATGGAATATTTTAT
TTATCATTTGAGGCCGTTCGGTGTGCACCACGTACACAACTGAGTGGTGA
CCGAGTTGCTAAATTACTTTCGAAGAAGGTTCGAATTCTATGTTGGATCA
TGACGCAACCGAAAACATTGAAAACCAAAGCACAAGCTGTCAAGAACACG
TGGGGAAAACGTTGTAATACACTGCTGTTCATGAGTTCAAAGGGTGATAA
AGATTTCCCAGTAGTTGGGCTGAACGTACCAGAAGAGCAATGGAAGAAGA
TTATGCCATGCTATTAAGTGAAGAATATGAAGGAAAACATTTGCCACCTC
CTTCCAAACCTCAACCTGTTGATAAACCAATCATATTCAATGATCTAGAT
TCTATACATCATAAAGATGGTTGGAGCATCATTCCGCAGAGAGTTCCATA
TGGCGTTTCTTCTTGGTTTATCCTTCGGCTTCTTTATTGCTGTCATATTT
CGTGAATTGCAATCTTCGTTTTCTGAAACCAAAGATTTGGTCAACAAAGG
ACCACCATCTGGCAGGTCGAAAAAACTTGTGGTTGAAAACACGCGCAGCT
TGGAAATATATTTACGAGCACCATTTCTACGACGCTGATTGGTTCTTAAA
AGCCGATGATGACTCATTTGTCGTTCTCGAAAATCTACGTTATTTCTTAT
CAAAGCATAATTCAAGTCAGACTCATTATTTTGGGCGACATTTCCGCCCT
TTTGGCGGCTACAACTCTGGTGGGGCGGGCTATGTTTTCAGTAAAGCCAC
CCTGATAGTATTCAACCAAGTACTACGTGATCCAAGTGTTTGCAAACTAA
AAGCAGGCGCCGAGGATGCAGAAGTAGGCGTTTGTTTACGAATGATGGGC
GTTGTGCCCGGTGATACTAGAGACGAATTTGGGCGTGAAAGTTTCCACCC
GTTTGCGCCTGATTATCATTTAGTACCGAATGGTATACCCACTACGAACT
GGTTACATAAATATAATAAACATCCGGTCAAATCGGGACCTGGATGTTGT
TCAGACCATAGTATAGCTTTTCATTATATTCCGCCAAACCGGATGTATGT
GATGGAATATTTTATTTATCATTTGAGGCCGTTCGGTGTGCACCACGTAC
ACAACTGAGTGGTGACCGAGTTGCTAAATTACTTTCGAAGAAGGTTCGAA
TTCTATGTTGGATCATGACGCAACCGAAAACATTGAAAACCAAAGCACAA
GCTGTCAAGAACACGTGGGGAAAACGTTGTAATACACTGCTGTTCATGAG
TTCAAAGGGTGATAAAGATTTCCCAGTAGTTGGGCTGAACGTACCAGAAG
AGCAATGGAAGAAGATTATGCCATGCTATTAAGTGAAGAATATGAAGGAA
AACATTTGCCACCTCCTTCCAAACCTCAACCTGTTGATAAACCAATCATA
TTCAATGATCTAGATTCTATACATCATAAAGATGGTTGGAGCATCATTCC
GCAGAGAGTTCCATATGGCGTTTCTTCTTGGTTTATCCTTCGGCTTCTTT
ATTGCTGTCATATTTCGTGAATTGCAATCTTCGTTTTCTGAAACCAAAGA
TTTGGTCAACAAAGGACCACCATCTGGCAGGTCGAAAAAACTTGTGGTTG
AAAACACGCGCAGCTTGGAAATATATTTACGAGCACCATTTCTACGACGC
TGATTGGTTCTTAAAAGCCGATGATGACTCATTTGTCGTTCTCGAAAATC
TACGTTATTTCTTATCAAAGCATAATTCAAGTCAGACTCATTATTTTGGG
CGACATTTCCGCCCTTTTGGCGGCTACAACTCTGGTGGGGCGGGCTATGT
TTTCAGTAAAGCCACCCTGATAGTATTCAACCAAGTACTACGTGATCCAA
GTGTTTGCAAACTAAAAGCAGGCGCCGAGGATGCAGAAGTAGGCGTTTGT
TTACGAATGATGGGCGTTGTGCCCGGTGATACTAGAGACGAATTTGGGCG
TGAAAGTTTCCACCCGTTTGCGCCTGATTATCATTTAGTACCGAATGGTA
TACCCACTACGAACTGGTTACATAAATATAATAAACATCCGGTCAAATCG
GGACCTGGATGTTGTTCAGACCATAGTATAGCTTTTCATTATATTCCGCC
AAACCGGATGTATGTGATGGAATATTTTATTTATCATTTGAGGCCGTTCG
GTGTGCACCACGTACACAACTGAGTGGTGACCGAGTTGCTAAATTACTTT
CGAAGAAGGTTCGAATTCTATGTTGGATCATGACGCAACCGAAAACATTG
AAAACCAAAGCACAAGCTGTCAAGAACACGTGGGGAAAACGTTGTAATAC
ACTGCTGTTCATGAGTTCAAAGGGTGATAAAGATTTCCCAGTAGTTGGGC
TGAACGTACCAGAAGAGCAATGGAAGAAGATTATGCCATGCTATTAAGTG
AAGAATATGAAGGAAAACATTTGCCACCTCCTTCCAAACCTCAACCTGTT
GATAAACCAATCATATTCAATGATCTAGATTCTATACATCATAAAGATGG
TTGGAGCATCATTCCGCAGAGAGTTCCATATGGCGTTTCTTCTTGGTTTA
TCCTTCGGCTTCTTTATTGCTGTCATATTTCGTGAATTGCAATCTTCGTT
TTCTGAAACCAAAGATTTGGTCAACAAAGGACCACCATCTGGCAGGTCGA
AAAAACTTGTGGTTGAAAACACGCGCAGCTTGGAAATATATTTACGAGCA
CCATTTCTACGACGCTGATTGGTTCTTAAAAGCCGATGATGACTCATTTG
TCGTTCTCGAAAATCTACGTTATTTCTTATCAAAGCATAATTCAAGTCAG
ACTCATTATTTTGGGCGACATTTCCGCCCTTTTGGCGGCTACAACTCTGG
TGGGGCGGGCTATGTTTTCAGTAAAGCCACCCTGATAGTATTCAACCAAG
TACTACGTGATCCAAGTGTTTGCAAACTAAAAGCAGGCGCCGAGGATGCA
GAAGTAGGCGTTTGTTTACGAATGATGGGCGTTGTGCCCGGTGATACTAG
AGACGAATTTGGGCGTGAAAGTTTCCACCCGTTTGCGCCTGATTATCATT
TAGTACCGAATGGTATACCCACTACGAACTGGTTACATAAATATAATAAA
CATCCGGTCAAATCGGGACCTGGATGTTGTTCAGACCATAGTATAGCTTT
TCATTATATTCCGCCAAACCGGATGTATGTGATGGAATATTTTATTTATC
ATTTGAGGCCGTTCGGTGTGCACCACGTACACAACTGAGTGGTGACCGAG
TTGCTAAATTACTTTCGAAGAAGGTTCGAATTCTATGTTGGATCATGACG
CAACCGAAAACATTGAAAACCAAAGCACAAGCTGTCAAGAACACGTGGGG
AAAACGTTGTAATACACTGCTGTTCATGAGTTCAAAGGGTGATAAAGATT
TCCCAGTAGTTGGGCTGAACGTACCAGAAGAGCAATGGAAGAAGATTATG
CCATGCTATTAAGTGAAGAATATGAAGGAAAACATTTGCCACCTCCTTCC
AAACCTCAACCTGTTGATAAACCAATCATATTCAATGATCTAGATTCTAT
ACATCATAAAGATGGTTGGAGCATCATTCCGCAGAGAGTTCCATATGGCG
TTTCTTCTTGGTTTATCCTTCGGCTTCTTTATTGCTGTCATATTTCGTGA
ATTGCAATCTTCGTTTTCTGAAACCAAAGATTTGGTCAACAAAGGACCAC
CATCTGGCAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_001114XLOC_001114Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00002137-exon-sc0000018-1575043694:375046..375098TCONS_00002137-exon-sc0000018-1575043694:375046..375098Clytia hemisphaericaexon
TCONS_00002137-exon-sc0000018-1575043694:367897..368273TCONS_00002137-exon-sc0000018-1575043694:367897..368273Clytia hemisphaericaexon
TCONS_00002137-exon-sc0000018-1575043694:367054..367184TCONS_00002137-exon-sc0000018-1575043694:367054..367184Clytia hemisphaericaexon
TCONS_00002137-exon-sc0000018-1575043694:366399..366590TCONS_00002137-exon-sc0000018-1575043694:366399..366590Clytia hemisphaericaexon
TCONS_00002137-exon-sc0000018-1575043694:363997..365216TCONS_00002137-exon-sc0000018-1575043694:363997..365216Clytia hemisphaericaexon
TCONS_00002137-exon-sc0000018-1510915933:375046..375098TCONS_00002137-exon-sc0000018-1510915933:375046..375098Clytia hemisphaericaexon
TCONS_00002137-exon-sc0000018-1510915933:367897..368273TCONS_00002137-exon-sc0000018-1510915933:367897..368273Clytia hemisphaericaexon
TCONS_00002137-exon-sc0000018-1510915933:367054..367184TCONS_00002137-exon-sc0000018-1510915933:367054..367184Clytia hemisphaericaexon
TCONS_00002137-exon-sc0000018-1510915933:366399..366590TCONS_00002137-exon-sc0000018-1510915933:366399..366590Clytia hemisphaericaexon
TCONS_00002137-exon-sc0000018-1510915933:363997..365216TCONS_00002137-exon-sc0000018-1510915933:363997..365216Clytia hemisphaericaexon
TCONS_00002137-exon-sc0000018-1491911889:375046..375098TCONS_00002137-exon-sc0000018-1491911889:375046..375098Clytia hemisphaericaexon
TCONS_00002137-exon-sc0000018-1491911889:367897..368273TCONS_00002137-exon-sc0000018-1491911889:367897..368273Clytia hemisphaericaexon
TCONS_00002137-exon-sc0000018-1491911889:367054..367184TCONS_00002137-exon-sc0000018-1491911889:367054..367184Clytia hemisphaericaexon
TCONS_00002137-exon-sc0000018-1491911889:366399..366590TCONS_00002137-exon-sc0000018-1491911889:366399..366590Clytia hemisphaericaexon
TCONS_00002137-exon-sc0000018-1491911889:363997..365216TCONS_00002137-exon-sc0000018-1491911889:363997..365216Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00002137-proteinTCONS_00002137-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000018supercontigsc0000018:363997..375098 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
1.73282 4.40071e-08 0.441057 2.11649 2.38912 0.164943 6.22208 0.000216633 3.24868 9.59125 4.68118 4.09854 7.94248 5.32616 4.08727 4.78877 13.4929 8.74503 7.01589 7.41345 9.27449 6.15516 4.35108 5.68373 1.87841 0 1.6924 2.29567 9.56711 5.4704
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR003378Fringe-like
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane
Vocabulary: Molecular Function
TermDefinition
GO:0016757transferase activity, transferring glycosyl groups
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0016020 membrane
molecular_function GO:0016757 transferase activity, transferring glycosyl groups
Blast
BLAST of TCONS_00002137 vs. Swiss-Prot (Human)
Match: C1GLT (Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Homo sapiens GN=C1GALT1 PE=1 SV=1)

HSP 1 Score: 285.804 bits (730), Expect = 3.146e-89
Identity = 146/340 (42.94%), Postives = 205/340 (60.29%), Query Frame = 3
Query:  315 MAFLLGLSFGFFI-AVIFRELQSSFSETKDLVNKGPPSGRAMEEDYAMLLSEEYEGKHLXXXXXXXXXXXXIIFNDLDSIHHKGGDRVAKLLSKKVRILCWIMTQPKTLKTKAQAVKNTWGKRCNTLLFMSSKGDKDFPVVGLNVPEGRKNLWLKTRAAWKYIYEHHFYDADWFLKADDDSFVVLENLRYFLSKHNSSQTHYFGRHFRPF--GGYNSGGAGYVFSKATLIVFNQVLRDPSVCKLKAGAEDAEVGVCLRMMGVVPGDTRDEFGRESFHPFAPDYHLVPNGIPTTNWLHKYNKHPVKSGPGCCSDHSIAFHYIPPNRMYVMEYFIYHLRPFG 1325
            + FL G + GF + + +F  L     +T+  V    P  R  +++    L    EG+              + FN   S H      +A+ L +KVRILCW+MT P+ L+ KA+ VK TW +RCN +LFMSS+ +KDFP VGL   EGR  L+ KT  A++Y++EH+  DADWFLKADDD++V+L+NLR+ LSK++  +  YFGR F+P+   GY SGGAGYV SK  L  F    +    C   +  ED  +G C+ +M V  GD+RD  G+E+FHPF P++HL+   +P T W   YN +P   GPGCCSD +++FHY+    MY +EY +YHLRP+G
Sbjct:   10 LTFLCGSAIGFLLCSQLFSILLGEKVDTQPNVLHNDPHARHSDDNGQNHL----EGQ--------------MNFNADSSQHKDENTDIAENLYQKVRILCWVMTGPQNLEKKAKHVKATWAQRCNKVLFMSSEENKDFPAVGLKTKEGRDQLYWKTIKAFQYVHEHYLEDADWFLKADDDTYVILDNLRWLLSKYDPEEPIYFGRRFKPYVKQGYMSGGAGYVLSKEALKRFVDAFKTDK-CTHSSSIEDLALGRCMEIMNVEAGDSRDTIGKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGCCSDLAVSFHYVDSTTMYELEYLVYHLRPYG 330          
The following BLAST results are available for this feature:
BLAST of TCONS_00002137 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
C1GLT3.146e-8942.94Glycoprotein-N-acetylgalactosamine 3-beta-galactos... [more]
back to top