Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00002135 (transcript) - C. hemisphaerica

Overview
NameTCONS_00002135
Unique NameTCONS_00002135
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1421

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00002135 ID=TCONS_00002135|Name=TCONS_00002135|organism=Clytia hemisphaerica|type=transcript|length=1421bp
CATTTATTGATGGATGGGATGGCGGTAGttttttaaaacaTATAGATACA
ACTTCAATAAACTAGAAAAATTCATCAATCATAAAATGACTGAAAGAACA
CCACAACATATGACAACATCTGCTGACCGATTCTGGTTGCGCATTACAAA
CACATTGCCTGCTAAAGAAATAGGATCAGAAGTCTCATTGGGCATAATGG
AAAAAGCAATGAACAGGAGAAGAGTTGGCATTAACGTAGGCCTCATTTTG
TTTTCATCCATTGCTGCTTTTGCGTATGGACGTCAATTCAGCAAAGAACG
AAAAAGTAGAGCTCAACAAATCGAAGAAGACCAATTCAAAtagattatta
ttttttttgaagtaTATGGAAATAAGTACAAGATTTTTAGCTACCAGACA
CAGATTGCTAGCAATTCAAAAGAATTTTAGCTGACTTTGAATGTTGGAAT
TTTCTTAAATCAACGAagtaaatcaataaaaatattatGTACTATGTGTA
ATTCAAGTTTTAAAcatattatttttcttgtatttttaaatctttaaatc
aAATGCAGAAAAATGATAACTGCGGTgtgagtttttttcttttttgtaaa
taCGGACTAATTATTTTTACATTCAGAAACTTAGAAAAcagaatatttca
aatataGACTCTGGGTTGTTTTTTTACAtccctttttctttcaaagatgc
tcaaaattaactaaaacttggttttcatAGAAATAAGCGTTCAATTATTA
TGAGCCTGACctatttccatttttttttttcagttgaaaaaattaaacta
aaaataataattattaaaaataataattactGAAATTACATATGTCTCTT
AGATCAAAGgttttaggTGCTTATCGTACTCTTTTACGCACAAGGCAGAT
AGTGTTTTCAGGCGATGCAGTCGCATTAACAAAAAGTAGAGAGAAAATAA
GAGACAGCTTCCTGGCTAATAAACATTTAACCGCATCAGAGGATATTTTA
CAACAGATTCAATGTGCTAATGAAACAAGTGATTTCTTGCTTCAAGGAGT
TGTTCAAGGGAAGTTGAACACACAAGATAACACATACAAAGTCAAAATTA
CTGAACATACAAAACTTCACgataatgtccctttaaaagaaCAGAACAAA
GTTGATctcaataattttgaaattccacaaaaattcCGCAAGAAGAAGAA
CTGAATATCATAAGATGAACAAagagaatttattttgaatgtgtaaataa
tattttatatgaatgaaaaaaaatcacttctaaaaacaaaaactttgttC
CCGTAGTCCTAAAATAGACTAAATTCTTGTTGATGGAAACTGTTGATATC
AACATCAGTTTAGTttcctcctgggttggttccaCCGCAGAAATTTTAGA
CTAGGCCCAGTTCTCAACCCC
Run BLAST on NCBI

protein sequence of TCONS_00002135-protein

>TCONS_00002135-protein ID=TCONS_00002135-protein|Name=TCONS_00002135-protein|organism=Clytia hemisphaerica|type=polypeptide|length=120bp
MSLRSKVLGAYRTLLRTRQIVFSGDAVALTKSREKIRDSFLANKHLTASE
DILQQIQCANETSDFLLQGVVQGKLNTQDNTYKVKITEHTKLHDNVPLKE
QNKVDLNNFEIPQKFRKKKN
Run BLAST on NCBI

transcript from alignment at sc0000018:340115..345714-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00002135 ID=TCONS_00002135|Name=TCONS_00002135|organism=Clytia hemisphaerica|type=transcript|length=5600bp|location=Sequence derived from alignment at sc0000018:340115..345714- (Clytia hemisphaerica)
CATTTATTGATGGATGGGATGGCGGTAGGTAAGAAGATTGATTGTGTTTT GAAAGGCTGAAGTAGTGTGAAAAGGCAGGACCCTGCCGACGCACCGGACT GTCCGGTGTATATTAATCCGGTGTATTTTTCCGGTGTTAAGAAGTATCCT TTCGTTACACCGGACACAATAAGTCAGGTGTTAGTCTGGTGTTGTGCATA CAGCCGGAATTTTGGACGCCGGACATTATGAAACAAAAATTAAGAAACAC TGGACGCACCGGAGTCATGTCCGGTGGGAAAAAAATATCCTTCTCCGACA CCGGACATCCTGTGTAGAAATTGTCCGGTGGTAGAAAATTTCATTTTACA CCTCAATTGAACGGAATTACGATCAAACCAAATCGAACGCAATCGACCGA TTGAAATTTGATTGTCGAACGCAATCGAATCTCATTCGAATATTACCGCA ATTTTCAGATTCGATTGATATTCGATTGTGTTCGATTGATGTTCGATTGC GTTCAATTGCGTTCGATCGTCGATTCATTGACCCCCGGATTGTTCATCGC ATAATTTCTACGGGAAATCAAAAGTAATTTCATTCGGCTTGTGATGTTTG AGAGCTTGGATGTTGGAAAGCTGCAAGAATAAAGCCAGACATTCTCAATC GAACGGAATCGACGATCGAACCAGTCGACCAACAATCGAACCAATCAAAT ATTACCCAGAATTTTGACGTTCGATTGCGTTCGACAATCGAATTTCAATC AGTCGATTGCGTTTGATTGAGATCGTCTGGTTAAGTCCGGTGTGCGCCGC GCCGGCAGGGTCCTGTCGTTTACTAATTGATAAAATCAATTATCGATTAA AATGGATAGCTAATTGATAATTAATCGATTGATTAAATATCAATTAAAAA CGATAATCGATAGCTAAGCGATACTCACAATTTTTCAGCACTCAATTAAA TTATCACCATAGATTTTAAATCGATAATACCGATTAGGGTGGGAAGGTGA TGGCGGACAAGATTGGAGGAAATTGTGTTTTTGAAGATGTAAAAGTTGGA TTTGAAAAATTTTGGCCGATAAGAGCAAGGGGGGGAGGGGGTCTGAAGCT TATCGGCCCAATGCATATAAAAATTTTGAAAGTTTTTTGTCAAAGACCCC TTACAAAGTTAATAATTGATATAATATTAAGCAGTTATTGGACAAAGTGG AAACCAATATGTAAAAATATTGCCAATATTTTTCATATTGGATGAGACTG CGTCCAAATAAATGGTTTATTATCTGTTCATCGCTAAAATACTTCTAGTT TTCAAACATAATTCCAATCTATGATCTATAAAGCTCGTGAATCTGGCTTC TTGGTAGTTTTTTATTCAAAAGTTTTATTTTTATTTTTATTTTGTGACGT AACGTGTCAAAAAGAAGATGCTCAATTGTCATCATTGAACTCGTTGTGTG AAGTCAATTTTTGAAATATATAGCCTCCATGGAAGCTATATATTCGAAAA TATTGGGCAGTAAAGAAGCCAATCAAATGTCGCTATTTACCCGTGTCGGA TAATAAATGATTAATATCGACATAATCAGATAATTGACAAATTGATACCT TGGCCCTATCGATTTTTAATCGATATCGATTTTTAATCGATAATATCGAT GAAACTTCTAATTGATATAATCGATATCTTATATCTGGTCGATATAATCG ATGTACTCACAATTTTTTAGGCGATTAGCTACCGTCAACTGCTCCAACTT GGGACGAGTGGTTGCAACATGGGACTTGTTGATATCTGGCCTGTATTTTT ACTTACTATTAAATCTCTTTGACAACAAATTTGTTTTGATAACTCCACCA AGTTTATCAATCATACTTCATACTTCACATAATCTGTCATAACATGTCAC GATAACTTTCACTGATAGCGCGCCCTTTTTAACTTTTGTTTTCATTCAAA ATGACCTGACGCCGAATGGAGAATTAGAGAATGACCGCCGCCTAACCGCC TTACGCCTACCGCCCACCGCCCACCGCCCACCGCCCAATGGGATTAACAA ATAGCGAGTGTGTAACTTGTCGCGCGAGAGTGACGTCAAACCCTCCATCG TTTTGCCACTAATTTGGTCTTCTTTGTTCCAGACACTTGCGCGTGTTCCA CTACGGATTTTTTCATATTTCAATTTAAAAGCCTACTCGGTGCGAAAGAG AGATTGTGTATTTTTTAATACGCGATCCATTAAACTCAAATCCAATGATT TTGGTGGAATGGCTGTCCCATGTTGCGTCAGATAGTCCCAAGTTGGAGCA GTTGATGGTATCGATTATCGTTTTTGATCGGTATTTAATCAATCGATTAA TTATCAATTAGCTATTGGATTTTAATCAATAATCGATTTTATCGATTAGT AACGTCTGGTTTTGTCTTGTGTTATTTTTAGAATGAACTAGATTTCTTGA GAATAGATTGAATTGTCCTACAGTGATAGTGATAGTATCTAGCTAGCTAG TATCCAAGAAAACTGGTGGCAAATGCCACCCCCCCTCGAGTGGAAGTTTT TCACAGGGGTGCCCCCCTCCGAAAAACAAAGGGTGCAAAAAGATGCCTTT GGTTATTAATTTTGGCGCCCCTTTGCTCTTTTACAGCTTAAATGGGTGAA TTGCAGAAAAGTCATACAATGTCCCGTCCGCAATAAAAGCACCATTTATG CTTACAAATCAACATCTAGGAACTAGAGAACCCCCTTTTCTTTGTTGTGA CATATTGAATGCCTTCTTCTGTTAAAGACATTTTTATTGCCTTCAAATAA TCTATTCTGAATTTTTAAACTGGTAAAAACTAATATGGTCCAAAAATTTG TCCTGTCCGCAAGGGCAGAAAATTCTTTTTTAATTTCTCATTTTTTGAGA CATCTTTAATGTTCTAACTGTATCAAGCCAATAAACTATAGGGAACAGCG ACCGTAGTACTGTGGTAGAGCATCCGGCTAAGGTTCGCAAGGTTGTGGGT TCAACCCCCAGCCGGGTCATACCAAAGATTCCCAAAATTGATGCCTCTCT GCTTGATGCTCAGCAACTAAGAGAAGGATCAAGGGAAAGTGGAGAAATCC AGGGAGAAAGAGTGGCGCCCTCCCCTACCTTCAGGTAGATAGCTATCAAA AGAGTAGCCTTCGGGTCGCCTCCGACTGCGGTCGCAGACTTACTTATAGG GAACTACATATGCTTTTTGCAGCAGTATATATTCCTTTTCTTGACATTAC ATGTACTGGCTATGAATTAAAAACTTTTTGTCCTATCCGCAACAAAGTGT CTATAACACTCCAAGGAAGGCTATTTAGTGAAGTTCACAAAAATGTGCTA CCGGATAACGGTAGCAGAAACTGAATCTTTTTAATTGAGTTTTTAATTGA GGCTACCTTACCACCAAGAACATTATTTAATCTGTCTTATATAATGTAAA ATTGGATTTTAAACCTTTTTTTGATGTCCTAAAAGGCATTTTGCATTTTT AAAGTCATTACTTCAGTTCCAGCCAGTGCAGTGCTATAATACTTCATACG CCTACTTGATTTTGAATGTCATTTTTTTTAGTTTTTTAAAACATATAGAT ACAACTTCAATAAACTAGAAAAATTCATCAATCATAAAATGACTGGTAAG AAAAAGATCTATTTTTTGAAATATTGTTACTTGTTGTTCATGTATAAACT TTTCTTATTTTTTCTCAATTGAGAGCATTTCTAAAATGCTACTAAAGTAA CTTACTGTATCATTAGTATATCTAATTTCTTATATATTTTATTTTTGAAA TATGTTTTTTTTTCTTCAATAATTTTCTTTTTCTTATCTTATCCATTTCA AATAGAAAGAACACCACAACATATGACAACATCTGCTGACCGATTCTGGT TGCGCATTACAAACACATTGCCTGCTAAAGAAATAGGATCAGAAGTCTCG TAAGGACAAACTTTTGTTTTCAAGTGTTAGTTGAACAACGAAACCATTGA AGTTTTTTTTTTCAAGATGCTTTTTGGCATAGACTTGGACCAAGATTTTA CAATTTAAAAGTTATTCTAAATAATGGGATCTATATTCTAATGTGCCTTC TTTCTTAAACTAGAGACTTTTTTCATGATATCTCTCAGATCGATCAATTT TCAATTTTTAGTGTAAGTAATCCAAAAATGCATCGCAAATTGCGAAATAC GATACGCTAATTCGATCCCTGTTTCTAATGAAATAGCACTTAATTATCCT GTTACGTTTTGTAATTTGTTTTATAGATTGGGCATAATGGAAAAAGCAAT GAACAGGAGAAGAGTTGGCATTAACGTAGGCCTCATTTTGTTTTCATCCA TTGCTGCTTTTGCGTATGGACGTCAATTCAGCAAAGAACGAAAAAGTAGA GCTCAACAAATCGAAGAAGACCAATTCAAATAGATTATTATTTTTTTTGA AGTATATGGAAATAAGTACAAGATTTTTAGCTACCAGACACAGATTGCTA GCAATTCAAAAGAATTTTAGCTGACTTTGAATGTTGGAATTTTCTTAAAT CAACGAAGTAAATCAATAAAAATATTATGTACTATGTGTAATTCAAGTTT TAAACATATTATTTTTCTTGTATTTTTAAATCTTTAAATCAAATGCAGAA AAATGATAACTGCGGTGTGAGTTTTTTTCTTTTTTGTAAATACGGACTAA TTATTTTTACATTCAGAAACTTAGAAAACAGAATATTTCAAATATAGACT CTGGGTTGTTTTTTTACATCCCTTTTTCTTTCAAAGATGCTCAAAATTAA CTAAAACTTGGTTTTCATAGAAATAAGCGTTCAATTATTATGAGCCTGAC CTATTTCCATTTTTTTTTTTCAGTTGAAAAAATTAAACTAAAAATAATAA TTATTAAAAATAATAATTACTGAAATTACATATGTCTCTTAGATCAAAGG TAAGATCATCATTCATCTATCATCTTTTAGGAAAACACTACTCCAGCAGA TGTATAACTTCTTATGTATTTCAATGTTTTTTTTTCAGGTTTTAGGTGCT TATCGTACTCTTTTACGCACAAGGCAGATAGTGTTTTCAGGCGATGCAGT CGCATTAACAAAAAGTAGAGAGAAAATAAGAGACAGCTTCCTGGCTAATA AACATTTAACCGCATCAGAGGATATTTTACAACAGATTCAATGTGCTAAT GAAACAAGTGATTTCTTGCTTCAAGGAGTTGTTCAAGGGAAGTTGAACAC ACAAGATAACACATACAAAGTCAAAATTACTGAACATACAAAACTTCACG ATAATGTCCCTTTAAAAGAACAGAACAAAGTTGATCTCAATAATTTTGAA ATTCCACAAAAATTCCGCAAGAAGAAGAACTGAATATCATAAGATGAACA AAGAGAATTTATTTTGAATGTGTAAATAATATTTTATATGAATGAAAAAA AATCACTTCTAAAAACAAAAACTTTGTTCCCGTAGTCCTAAAATAGACTA AATTCTTGTTGATGGAAACTGTTGATATCAACATCAGTTTAGTTTCCTCC TGGGTTGGTTCCACCGCAGAAATTTTAGACTAGGCCCAGTTCTCAACCCC

Coding sequence (CDS) from alignment at sc0000018:340115..345714-

>TCONS_00002135 ID=TCONS_00002135|Name=TCONS_00002135|organism=Clytia hemisphaerica|type=CDS|length=726bp|location=Sequence derived from alignment at sc0000018:340115..345714- (Clytia hemisphaerica)
GTTTTAGGTGCTTATCGTACTCTTTTACGCACAAGGCAGATAGTGTTTTC
AGGCGATGCAGTCGCATTAACAAAAAGTAGAGAGAAAATAAGAGACAGCT
TCCTGGCTAATAAACATTTAACCGCATCAGAGGATATTTTACAACAGATT
CAATGTGCTAATGAAACAAGTGATTTCTTGCTTCAAGGAGTTGTTCAAGG
GAAGTTGAACACACAAGATAACACATACAAAGTCAAAATTACTGAACATA
CAAAACTTCACGATAATGTCCCTTTAAAAGAACAGAACAAAGTTGATCTC
AATAATTTTGAAATTCCACAAAAATTCCGCAAGAAGAAGAACTGAATGTC
TCTTAGATCAAAGGTTTTAGGTGCTTATCGTACTCTTTTACGCACAAGGC
AGATAGTGTTTTCAGGCGATGCAGTCGCATTAACAAAAAGTAGAGAGAAA
ATAAGAGACAGCTTCCTGGCTAATAAACATTTAACCGCATCAGAGGATAT
TTTACAACAGATTCAATGTGCTAATGAAACAAGTGATTTCTTGCTTCAAG
GAGTTGTTCAAGGGAAGTTGAACACACAAGATAACACATACAAAGTCAAA
ATTACTGAACATACAAAACTTCACGATAATGTCCCTTTAAAAGAACAGAA
CAAAGTTGATCTCAATAATTTTGAAATTCCACAAAAATTCCGCAAGAAGA
AGAACTGAATGTCTCTTAGATCAAAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_001113XLOC_001113Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00002135-proteinTCONS_00002135-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00002135-exon-sc0000018-1575043694:345687..345714TCONS_00002135-exon-sc0000018-1575043694:345687..345714Clytia hemisphaericaexon
TCONS_00002135-exon-sc0000018-1575043694:342070..342133TCONS_00002135-exon-sc0000018-1575043694:342070..342133Clytia hemisphaericaexon
TCONS_00002135-exon-sc0000018-1575043694:341766..341859TCONS_00002135-exon-sc0000018-1575043694:341766..341859Clytia hemisphaericaexon
TCONS_00002135-exon-sc0000018-1575043694:340766..341438TCONS_00002135-exon-sc0000018-1575043694:340766..341438Clytia hemisphaericaexon
TCONS_00002135-exon-sc0000018-1575043694:340115..340676TCONS_00002135-exon-sc0000018-1575043694:340115..340676Clytia hemisphaericaexon
TCONS_00002135-exon-sc0000018-1510915933:345687..345714TCONS_00002135-exon-sc0000018-1510915933:345687..345714Clytia hemisphaericaexon
TCONS_00002135-exon-sc0000018-1510915933:342070..342133TCONS_00002135-exon-sc0000018-1510915933:342070..342133Clytia hemisphaericaexon
TCONS_00002135-exon-sc0000018-1510915933:341766..341859TCONS_00002135-exon-sc0000018-1510915933:341766..341859Clytia hemisphaericaexon
TCONS_00002135-exon-sc0000018-1510915933:340766..341438TCONS_00002135-exon-sc0000018-1510915933:340766..341438Clytia hemisphaericaexon
TCONS_00002135-exon-sc0000018-1510915933:340115..340676TCONS_00002135-exon-sc0000018-1510915933:340115..340676Clytia hemisphaericaexon
TCONS_00002135-exon-sc0000018-1491911889:345687..345714TCONS_00002135-exon-sc0000018-1491911889:345687..345714Clytia hemisphaericaexon
TCONS_00002135-exon-sc0000018-1491911889:342070..342133TCONS_00002135-exon-sc0000018-1491911889:342070..342133Clytia hemisphaericaexon
TCONS_00002135-exon-sc0000018-1491911889:341766..341859TCONS_00002135-exon-sc0000018-1491911889:341766..341859Clytia hemisphaericaexon
TCONS_00002135-exon-sc0000018-1491911889:340766..341438TCONS_00002135-exon-sc0000018-1491911889:340766..341438Clytia hemisphaericaexon
TCONS_00002135-exon-sc0000018-1491911889:340115..340676TCONS_00002135-exon-sc0000018-1491911889:340115..340676Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000018supercontigsc0000018:340115..345714 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
56.3681 53.253 62.6264 62.1843 55.1265 41.1366 57.7664 59.6906 61.3467 49.6133 47.7819 37.9044 19.342 15.2877 23.8425 22.9155 40.3789 37.9883 15.0294 17.0627 23.1082 22.0733 48.7238 45.293 25.3078 33.3614 32.7735 27.6315 34.648 28.8266
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR008011Complex1_LYR
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00002135 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top