Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00002071 (transcript) - C. hemisphaerica

Overview
NameTCONS_00002071
Unique NameTCONS_00002071
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1311

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00002071 ID=TCONS_00002071|Name=TCONS_00002071|organism=Clytia hemisphaerica|type=transcript|length=1311bp
TTAGGCTGACTTACAACGAGAAGGAAGATCGAATGGAAAATACTGAAGGT
GTTTTCACCAGAATTCCTGGGTTTGGAAACACATCTGGCNAAGGCATTGT
TCTTGTTTAGGCTGACTTACAACGAGAAGGAAGATCGAATGGAAAATACT
GAAGGTGTTTTCACCAGAATTCCTGGGTTTGGAAACACATCTGGCATCGA
ATGGCTGGATCCTTATGTGCATGGACCTGGTATCTACTTCTTCCCTTTGG
TGGATTCATTAACCAGATTGCTGGGTTATGAGCGTGGAAAAACTTTACGA
TCTGCTCCGTATGACTTCCGCTACCATCCTGGAGATGCTGGTGATTATTT
TGATCGtttgaagaagttgattgaAGAGACGTACATGATGAATGGAGAGA
AGAAGATTATGTTGCTTTCTCATAGCATGGGTGTTCCTTACTCCCTCAAC
TTTCTTCATCGACAAACTGAAGaatggaaagaaaaatatatcgTGGCATG
GACCACTATTTCTGGTGTATTCGGAGGTTCTATGAAAGCTGTGAAAGCGT
TCATATCTGGTGATGGATTTGGTATTCCCAAAGTGCTTGATTATCCAATC
ACATTGCGAGCTTTTCAACGAACATTCAGTAGTTTACCTTACATCCTTCC
TGATGAAAGTTTTTGGGCCAAGGATGAGGTAATCGTCAAAACGTCGAATC
GGACATACACAGTACACCAATACGACGACCTCTTCAAAGACATGGGTTAT
CCTCTAGCAAGTAAAATCTATGCAAAGACTCCTAAAGCGTGGTCAGAAAA
ACCTCCTAACgtcaaaatgttttgttttcacgGGAGTGGTAAGGACACTC
CCGGTGTTTTGAATTACCGAGAAGGATATTTTCCGAATTACACACCGGAC
ATAACAATTGATGATGGGGATGGGACGGTGAACTTGCGGAGTCTTCAAGC
GTGTCAGTTGTGGagggaaaaacaaaaacaaccaaTAATTTATGAAGAAT
TTTCTAGAGGTGAGCATAATGGTGTTTTGGGTGACGCTCGGCTCATCAGG
TCCATCATTAAAGCTCTTAGTGAAGATTGATAGTCTCATATCTTTAATAC
ATTTGTGTAAATTCATTTTAATCTATATACCGTACTTCactattatttta
acattttttgttgtttagtATTTAAAACATGTAGTATATTTTTAGTCAGT
ATTGTCTACtttttgaaaacgttttaaATGGACGGACCATTGTGTAAATA
AGCAGGAATTTTCTAtcatagaaaaatatatttttaaacgaACTTTCCAA
AGTTTTCTCTC
Run BLAST on NCBI

protein sequence of TCONS_00002071-protein

>TCONS_00002071-protein ID=TCONS_00002071-protein|Name=TCONS_00002071-protein|organism=Clytia hemisphaerica|type=polypeptide|length=313bp
MENTEGVFTRIPGFGNTSGIEWLDPYVHGPGIYFFPLVDSLTRLLGYERG
KTLRSAPYDFRYHPGDAGDYFDRLKKLIEETYMMNGEKKIMLLSHSMGVP
YSLNFLHRQTEEWKEKYIVAWTTISGVFGGSMKAVKAFISGDGFGIPKVL
DYPITLRAFQRTFSSLPYILPDESFWAKDEVIVKTSNRTYTVHQYDDLFK
DMGYPLASKIYAKTPKAWSEKPPNVKMFCFHGSGKDTPGVLNYREGYFPN
YTPDITIDDGDGTVNLRSLQACQLWREKQKQPIIYEEFSRGEHNGVLGDA
RLIRSIIKALSED
Run BLAST on NCBI

transcript from alignment at sc0000018:811203..816885+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00002071 ID=TCONS_00002071|Name=TCONS_00002071|organism=Clytia hemisphaerica|type=transcript|length=5683bp|location=Sequence derived from alignment at sc0000018:811203..816885+ (Clytia hemisphaerica)
TTAGGCTGACTTACAACGAGAAGGAAGATCGAATGGAAAATACTGAAGGT GTTTTCACCAGAATTCCTGGGTTTGGAAACACATCTGGCNAAGGCATTGT TCTTGTTTAGGCTGACTTACAACGAGAAGGAAGATCGAATGGAAAATACT GAAGGTGTTTTCACCAGAATTCCTGGGTTTGGAAACACATCTGGCATCGA ATGGCTGGATCCTTATGTGCATGGACCTGGTATCTACTTCTTCCCTTTGG TGGATTCATTAACCAGATTGCTGGGTTATGAGCGTGGAAAAACTTTACGA TCTGCTCCGTATGACTTCCGCTACCATCCTGGTAAGATGTTATTCATTTA CTTCATCTTTTCTTCTAGTTGGGAttttttaatggattttttGTATGTGA CTGTATGGTTTATTATGAGtgtcaattttcttgaaaatcatTGTTACATG ATGATACATCAAATCGGCGACcattaaattgttttaaaagaattttgtaT AAGGCTTATTTTGATATGACATTTAGATAgcaataagaaaatttgaaatt cgaaaTCTTTCAGGAGATGCTGGTGATTATTTTGATCGtttgaagaagtt gattgaAGAGACGTACATGATGAATGGAGAGAAGAAGATTATGTTGCTTT CTCATAGCATGGGTGTTCCTTACTCCCTCAACTTTCTTCATCGACAAACT GAAGaatggaaagaaaaatatatcgTGGCATGGACCACTATTTCTGGTAT GAACAGTTCCACTTTTATTTGATGTTCGCcacttttatttgaaatattga aagttCTTTCGTCTCAGACGTATTGTAAATAGGCTTTTCTAAAGCTTCAA GAATGTGCTAATTTGTTGTgtaaaaattttgctttgatcactgtattcat gatatgcaccattgcaatgtcatccgttccacccaatagctgattggttg aaagtgacgtattgactgcttttacgtcacttccaaccaatgagctattg gttccatgacgtaatgtcagaagacattgcactggtgcatatcatgaata tcatgttCATTCATAAACAAAAACAGATGAACTTATTCGTTACAGTGGCT TCTAGCTATTATAAAGATTGGCTCATACTCTTCTGCTTATTTCTTCCTCG TCTTGGTGGTCCAGGTCTTAAACATGATGACATCATAACCTTTCCCACGT GGCATTAGTGTATTACAAAGAGGATATTATTTTAGTGTTGAAGAAGGATT AACCTCGAATTTTGTTGGATCTAACCGCATGCAATGTAGCTTCCTCAAAT TTTGTAATgtaatctattcatgatatacacaattgcaatgtcttctgaca ttacatcacggacccaattagctgattggttgtaagtgacgtaaaatcag tcaatacgtcaccttcaaccaatcagctgttgggtccgtggaagacattg caatggtgcatatcatgaattcagcTTGCCTTCTCGCACATGCgtggtcg ttacttgaccttgGGTAATATTTCTCAATACACCCCTCACTAactggtca ttattgtattagtgtATATTCTTTTTAGGTGTATTCGGAGGTTCTATGAA AGCTGTGAAAGCGTTCATATCTGGTGATGGATTTGGTATTCCCAAAGTGC TTGATTATCCAATCACATTGCGAGCTTTTCAACGAACATTCAGTAGTTTA CCTTACATCCTTCCTGATGAAAGTTTTTGGGCCAAGGATGAGGTGTGTAT AGTCTTTATGCCAATAGAAATTTCAGACGGTCTTTGATTTTCACTGCTGC AAAAGAATTTACATAATTCTACTGAGCAGTCTTTGAGCTTTCTTATTTGT AGCTTTTCGGCACATCATTTCACTAGAGCACTGAATTATTCGAAGTGATA TACATCAAGTATTAATTTGCTTAGTACGACTCATTTTGTAAAAGATAGCG AGGTTAATTATTGATAGATATTTTGCGACGACGAATTTAGTTTCCCCTAA GCCTTCATTTATGCTATTTTGTACAGTTTATCCCAAAAAGAAGATAGACT TGCCCTAAAAATCAACTTTGGTGCTAGAGCGAATTTCCgctttatttttc gttttcaaagCAAAGTGTGTAGACTACGTGAGGAAAGTCTACTTTGCTTT CCTACTTACCGCGAACGAAGGGCATATGAAGCCCGTTCGTCGTCGCGAAA TATCTACCGATACTATTATGTATCACTATATGTCTTTCTCACAGATTATC TTTTTCCCTAACAATCTTTCGTACTTTCATCCAGGTAATCGTCAAAACGT CGAATCGGACATACACAGTACACCAATACGACGACCTCTTCAAAGACATG GGTTATCCGCTAGCAAGTAAAATCTATGCAAAGACTCCTAAAGCGTGGTC AGAAAAACCTCCTAACgtcaaaatgttttgttttcacgGGAGTGGTAAGG ACACTCCCGGTGTTTTGAATTACCGAGAAGGATATTTTCCGAATTACACA CCGGACATAACAATTGATGATGGGGATGGGACGGTGAACTTGCGGAGTCT TCAAGCGTGTCAGTTGTGGagggaaaaacaaaaacaaccaaTAATTTATG AAGAATTTTCTAGAGGTGAGCATAATGGTGTTTTGGGTGACGCTCGGCTC ATCAGGTCCATCATTAAAGCTCTTAGTGAAGATTGATAGTCTCATATCTT TAATACATTTGTGTAAATTCATTTTAATCTATATACCGTACTTCactatt attttaacattttttgttgtttagtATTTAAAACATGTAGTATATTTTTA GTCAGTATTGTCTACtttttgaaaacgttttaaATGGACGGACCATTGTG TAAATAAGCAGGAATTTTCTAtcatagaaaaatatatttttaaacgaACT TTCCAAAGTTTTCTCTCAACTAAAGTTTTTATTCGTCATAAGTTATTAAA TACTCAGAAGATTTGAATTGTGACATGCATTTTCCAACAACACTGAacgt aattttcaaaataaacattttgttgactaaaaatttgttttgaatagAAG AACAAAGTATTGCACGAAAGTCACATAAGCTGCCTCCTTCATTGTCAAAA ATTATATACGGTCTAAAGgtttggggacacgagaagtttttttcgcgttg gtgcaatgcaacatgctccatcccaacAACATNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNctg gtgcatatcatgaatatcatgttCATTCATAAACAAAAACAGATGAACTT ATTCGTTACAGTGGCTTCTAGCTATTATAAAGATTGGCTCATACTCTTCT GCTTATTTCTTCCTCGTCTTGGTGGTCCAGGTCTTAAACATGATGACATC ATAACCTTTCCCACGTGGCATTAGTGTATTACAAAGAGGATATTATTTTA GTGTTGAAGAAGGATTAACCTCGAATTTTGTTGGATCTAACCGCATGCAA TGTAGCTTCCTCAAATTTTGTAATgtaatctattcatgatatacacaatt gcaatgtcttctgacattacatcacggacccaattagctgattggttgta agtgacgtaaaatcagtcaatacgtcaccttcaaccaatcagctgttggg tcctcggaagacattgcaatggtgcatatcatgaattcagcTTGCCTTCT CGCACATGCgtggtcgttacttgaccttgGGTAATATTTCTCAACACACC CCTCACTAactggtcattattgtattagtgtATATTCTTTTTAGGTGTAT TCGGAGGTTCTATGAAAGCTGTGAAAGCGTTCATATCTGGTGATGGATTT GGTATTCCCAAAGTGCTTGATTATCCAATCACATTGCGAGCTTTTCAACG AACATTCAGTAGTTTACCTTACATCCTTCCTGATGAAAGTTTTTGGGCCA AGGATGAGGTGTGTATAGTCTTTATGCCAATAGAAATTTCAGACGGTCTT TGATTTTCACTGCTGCAAAAGAATTTACATAATTCTACTGAGCAGTCTTT GAGCTTTCTTATTTGTAGCTTTTCGGCACATCATTTCACTAGAGCACTGA ATTATTCGAAGTGATATACATCAAGTATTAATTTGCTTAGTACGACTCAT TTTGTAAAAGATGGCGAGGTTAATTATTGATAGATATTTTGCGACGACGA ATTTAGTTTCCCCTAAGCCTTCATTTATGCTATTTTGTACAGTTTATCCC AAAAAGAAGATAGACTTGCCCTAAAAATCAACTTTGGTGCTAGAGCGAAT TTCCgttttatttttcgttttcaaagCAAAGTGTGTAGACTACGTGAGGA AAGCCTACCTTACTTTCCTACTTAGCGCGAACGAAGGCCATGTGAAGCCC GTTCGTCGTCGCGAAATATCTACCGATACTATTATGTATCACTATATGTC TTTCTCACAGATTATCTTTTTCCCTAACAACCTTTCGTACTTTCATCCAG GTCATCGTGAAAACGTCGAATCGGACATACACAGTACACCAATACGACGA CCTCTTCAAAGACATGGGTTATCCTCTAGCAAGTAAAATCTATGCAAAGA CTCCTAAAGCGTGGTCAGAAAAACCTCCTAACgtcaaaatgttttgtttt cacgGGAGTGGTAAGGACACTCCCGGTGTTTTGAATTACCGAGAAGGATA TTTTCCGAATTACACACCGGACATAACAATTGATGATGGGGATGGGACGG TGAACTTGCGGAGTCTTCAAGCGTGTCAGTTGTGGagggaaaaacaaaaa caaccaaTAATTTATGAAGAATTTTCTAGAGGTGAGCATAATGGTGTTTT GGGTGACGCTCGGCTCATCAGGTCCATCATTAAAGCTCTTAGTGAAGATT GATAGTCTCATATCTTTAATACATTTGTGTAAATTCATTTTAATCTATAT ACCGTACTTCactattattttaacattttttgttgtttagtATTTAAAAC ATGTAGTATATTTTTAGTCAGTATTGTCTACtttttgaaaacgttttaaA TGGACGGACCATTGTGTAAATAAGCAGGAATTTTCTAtcatagaaaaata tatttttaaacgaACTTTCCAAAGTTTTCTCTC

Coding sequence (CDS) from alignment at sc0000018:811203..816885+

>TCONS_00002071 ID=TCONS_00002071|Name=TCONS_00002071|organism=Clytia hemisphaerica|type=CDS|length=4710bp|location=Sequence derived from alignment at sc0000018:811203..816885+ (Clytia hemisphaerica)
ATGGAAAATACTGAAGGTGTTTTCACCAGAATTCCTGGGTTTGGAAACAC
ATCTGGCATCGAATGGCTGGATCCTTATGTGCATGGACCTGGTATCTACT
TCTTCCCTTTGGTGGATTCATTAACCAGATTGCTGGGTTATGAGCGTGGA
AAAACTTTACGATCTGCTCCGTATGACTTCCGCTACCATCCTGGAGATGC
TGGTGATTATTTTGATCGtttgaagaagttgattgaAGAGACGTACATGA
TGAATGGAGAGAAGAAGATTATGTTGCTTTCTCATAGCATGGGTGTTCCT
TACTCCCTCAACTTTCTTCATCGACAAACTGAAGaatggaaagaaaaata
tatcgTGGCATGGACCACTATTTCTGGTGTATTCGGAGGTTCTATGAAAG
CTGTGAAAGCGTTCATATCTGGTGATGGATTTGGTATTCCCAAAGTGCTT
GATTATCCAATCACATTGCGAGCTTTTCAACGAACATTCAGTAGTTTACC
TTACATCCTTCCTGATGAAAGTTTTTGGGCCAAGGATGAGGTAATCGTCA
AAACGTCGAATCGGACATACACAGTACACCAATACGACGACCTCTTCAAA
GACATGGGTTATCCTCTAGCAAGTAAAATCTATGCAAAGACTCCTAAAGC
GTGGTCAGAAAAACCTCCTAACgtcaaaatgttttgttttcacgGGAGTG
GTAAGGACACTCCCGGTGTTTTGAATTACCGAGAAGGATATTTTCCGAAT
TACACACCGGACATAACAATTGATGATGGGGATGGGACGGTGAACTTGCG
GAGTCTTCAAGCGTGTCAGTTGTGGagggaaaaacaaaaacaaccaaTAA
TTTATGAAGAATTTTCTAGAGGTGAGCATAATGGTGTTTTGGGTGACGCT
CGGCTCATCAGGTCCATCATTAAAGCTCTTAGTGAAGATTGAATGGAAAA
TACTGAAGGTGTTTTCACCAGAATTCCTGGGTTTGGAAACACATCTGGCA
TCGAATGGCTGGATCCTTATGTGCATGGACCTGGTATCTACTTCTTCCCT
TTGGTGGATTCATTAACCAGATTGCTGGGTTATGAGCGTGGAAAAACTTT
ACGATCTGCTCCGTATGACTTCCGCTACCATCCTGGAGATGCTGGTGATT
ATTTTGATCGtttgaagaagttgattgaAGAGACGTACATGATGAATGGA
GAGAAGAAGATTATGTTGCTTTCTCATAGCATGGGTGTTCCTTACTCCCT
CAACTTTCTTCATCGACAAACTGAAGaatggaaagaaaaatatatcgTGG
CATGGACCACTATTTCTGGTGTATTCGGAGGTTCTATGAAAGCTGTGAAA
GCGTTCATATCTGGTGATGGATTTGGTATTCCCAAAGTGCTTGATTATCC
AATCACATTGCGAGCTTTTCAACGAACATTCAGTAGTTTACCTTACATCC
TTCCTGATGAAAGTTTTTGGGCCAAGGATGAGGTAATCGTCAAAACGTCG
AATCGGACATACACAGTACACCAATACGACGACCTCTTCAAAGACATGGG
TTATCCTCTAGCAAGTAAAATCTATGCAAAGACTCCTAAAGCGTGGTCAG
AAAAACCTCCTAACgtcaaaatgttttgttttcacgGGAGTGGTAAGGAC
ACTCCCGGTGTTTTGAATTACCGAGAAGGATATTTTCCGAATTACACACC
GGACATAACAATTGATGATGGGGATGGGACGGTGAACTTGCGGAGTCTTC
AAGCGTGTCAGTTGTGGagggaaaaacaaaaacaaccaaTAATTTATGAA
GAATTTTCTAGAGGTGAGCATAATGGTGTTTTGGGTGACGCTCGGCTCAT
CAGGTCCATCATTAAAGCTCTTAGTGAAGATTGAATGGAAAATACTGAAG
GTGTTTTCACCAGAATTCCTGGGTTTGGAAACACATCTGGCATCGAATGG
CTGGATCCTTATGTGCATGGACCTGGTATCTACTTCTTCCCTTTGGTGGA
TTCATTAACCAGATTGCTGGGTTATGAGCGTGGAAAAACTTTACGATCTG
CTCCGTATGACTTCCGCTACCATCCTGGAGATGCTGGTGATTATTTTGAT
CGtttgaagaagttgattgaAGAGACGTACATGATGAATGGAGAGAAGAA
GATTATGTTGCTTTCTCATAGCATGGGTGTTCCTTACTCCCTCAACTTTC
TTCATCGACAAACTGAAGaatggaaagaaaaatatatcgTGGCATGGACC
ACTATTTCTGGTGTATTCGGAGGTTCTATGAAAGCTGTGAAAGCGTTCAT
ATCTGGTGATGGATTTGGTATTCCCAAAGTGCTTGATTATCCAATCACAT
TGCGAGCTTTTCAACGAACATTCAGTAGTTTACCTTACATCCTTCCTGAT
GAAAGTTTTTGGGCCAAGGATGAGGTAATCGTCAAAACGTCGAATCGGAC
ATACACAGTACACCAATACGACGACCTCTTCAAAGACATGGGTTATCCTC
TAGCAAGTAAAATCTATGCAAAGACTCCTAAAGCGTGGTCAGAAAAACCT
CCTAACgtcaaaatgttttgttttcacgGGAGTGGTAAGGACACTCCCGG
TGTTTTGAATTACCGAGAAGGATATTTTCCGAATTACACACCGGACATAA
CAATTGATGATGGGGATGGGACGGTGAACTTGCGGAGTCTTCAAGCGTGT
CAGTTGTGGagggaaaaacaaaaacaaccaaTAATTTATGAAGAATTTTC
TAGAGGTGAGCATAATGGTGTTTTGGGTGACGCTCGGCTCATCAGGTCCA
TCATTAAAGCTCTTAGTGAAGATTGAATGGAAAATACTGAAGGTGTTTTC
ACCAGAATTCCTGGGTTTGGAAACACATCTGGCATCGAATGGCTGGATCC
TTATGTGCATGGACCTGGTATCTACTTCTTCCCTTTGGTGGATTCATTAA
CCAGATTGCTGGGTTATGAGCGTGGAAAAACTTTACGATCTGCTCCGTAT
GACTTCCGCTACCATCCTGGAGATGCTGGTGATTATTTTGATCGtttgaa
gaagttgattgaAGAGACGTACATGATGAATGGAGAGAAGAAGATTATGT
TGCTTTCTCATAGCATGGGTGTTCCTTACTCCCTCAACTTTCTTCATCGA
CAAACTGAAGaatggaaagaaaaatatatcgTGGCATGGACCACTATTTC
TGGTGTATTCGGAGGTTCTATGAAAGCTGTGAAAGCGTTCATATCTGGTG
ATGGATTTGGTATTCCCAAAGTGCTTGATTATCCAATCACATTGCGAGCT
TTTCAACGAACATTCAGTAGTTTACCTTACATCCTTCCTGATGAAAGTTT
TTGGGCCAAGGATGAGGTAATCGTCAAAACGTCGAATCGGACATACACAG
TACACCAATACGACGACCTCTTCAAAGACATGGGTTATCCTCTAGCAAGT
AAAATCTATGCAAAGACTCCTAAAGCGTGGTCAGAAAAACCTCCTAACgt
caaaatgttttgttttcacgGGAGTGGTAAGGACACTCCCGGTGTTTTGA
ATTACCGAGAAGGATATTTTCCGAATTACACACCGGACATAACAATTGAT
GATGGGGATGGGACGGTGAACTTGCGGAGTCTTCAAGCGTGTCAGTTGTG
GagggaaaaacaaaaacaaccaaTAATTTATGAAGAATTTTCTAGAGGTG
AGCATAATGGTGTTTTGGGTGACGCTCGGCTCATCAGGTCCATCATTAAA
GCTCTTAGTGAAGATTGAATGGAAAATACTGAAGGTGTTTTCACCAGAAT
TCCTGGGTTTGGAAACACATCTGGCATCGAATGGCTGGATCCTTATGTGC
ATGGACCTGGTATCTACTTCTTCCCTTTGGTGGATTCATTAACCAGATTG
CTGGGTTATGAGCGTGGAAAAACTTTACGATCTGCTCCGTATGACTTCCG
CTACCATCCTGGAGATGCTGGTGATTATTTTGATCGtttgaagaagttga
ttgaAGAGACGTACATGATGAATGGAGAGAAGAAGATTATGTTGCTTTCT
CATAGCATGGGTGTTCCTTACTCCCTCAACTTTCTTCATCGACAAACTGA
AGaatggaaagaaaaatatatcgTGGCATGGACCACTATTTCTGGTGTAT
TCGGAGGTTCTATGAAAGCTGTGAAAGCGTTCATATCTGGTGATGGATTT
GGTATTCCCAAAGTGCTTGATTATCCAATCACATTGCGAGCTTTTCAACG
AACATTCAGTAGTTTACCTTACATCCTTCCTGATGAAAGTTTTTGGGCCA
AGGATGAGGTAATCGTCAAAACGTCGAATCGGACATACACAGTACACCAA
TACGACGACCTCTTCAAAGACATGGGTTATCCTCTAGCAAGTAAAATCTA
TGCAAAGACTCCTAAAGCGTGGTCAGAAAAACCTCCTAACgtcaaaatgt
tttgttttcacgGGAGTGGTAAGGACACTCCCGGTGTTTTGAATTACCGA
GAAGGATATTTTCCGAATTACACACCGGACATAACAATTGATGATGGGGA
TGGGACGGTGAACTTGCGGAGTCTTCAAGCGTGTCAGTTGTGGagggaaa
aacaaaaacaaccaaTAATTTATGAAGAATTTTCTAGAGGTGAGCATAAT
GGTGTTTTGGGTGACGCTCGGCTCATCAGGTCCATCATTAAAGCTCTTAG
TGAAGATTGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_001088XLOC_001088Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00002071-proteinTCONS_00002071-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00002071-exon-sc0000018-1491911889:811203..811533TCONS_00002071-exon-sc0000018-1491911889:811203..811533Clytia hemisphaericaexon
TCONS_00002071-exon-sc0000018-1510915933:811203..811533TCONS_00002071-exon-sc0000018-1510915933:811203..811533Clytia hemisphaericaexon
TCONS_00002071-exon-sc0000018-1575043694:811203..811533TCONS_00002071-exon-sc0000018-1575043694:811203..811533Clytia hemisphaericaexon
TCONS_00002071-exon-sc0000018-1491911889:811766..811948TCONS_00002071-exon-sc0000018-1491911889:811766..811948Clytia hemisphaericaexon
TCONS_00002071-exon-sc0000018-1510915933:811766..811948TCONS_00002071-exon-sc0000018-1510915933:811766..811948Clytia hemisphaericaexon
TCONS_00002071-exon-sc0000018-1575043694:811766..811948TCONS_00002071-exon-sc0000018-1575043694:811766..811948Clytia hemisphaericaexon
TCONS_00002071-exon-sc0000018-1491911889:812781..812944TCONS_00002071-exon-sc0000018-1491911889:812781..812944Clytia hemisphaericaexon
TCONS_00002071-exon-sc0000018-1510915933:812781..812944TCONS_00002071-exon-sc0000018-1510915933:812781..812944Clytia hemisphaericaexon
TCONS_00002071-exon-sc0000018-1575043694:812781..812944TCONS_00002071-exon-sc0000018-1575043694:812781..812944Clytia hemisphaericaexon
TCONS_00002071-exon-sc0000018-1491911889:813487..813512TCONS_00002071-exon-sc0000018-1491911889:813487..813512Clytia hemisphaericaexon
TCONS_00002071-exon-sc0000018-1510915933:813487..813512TCONS_00002071-exon-sc0000018-1510915933:813487..813512Clytia hemisphaericaexon
TCONS_00002071-exon-sc0000018-1575043694:813487..813512TCONS_00002071-exon-sc0000018-1575043694:813487..813512Clytia hemisphaericaexon
TCONS_00002071-exon-sc0000018-1491911889:816279..816885TCONS_00002071-exon-sc0000018-1491911889:816279..816885Clytia hemisphaericaexon
TCONS_00002071-exon-sc0000018-1510915933:816279..816885TCONS_00002071-exon-sc0000018-1510915933:816279..816885Clytia hemisphaericaexon
TCONS_00002071-exon-sc0000018-1575043694:816279..816885TCONS_00002071-exon-sc0000018-1575043694:816279..816885Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000018supercontigsc0000018:811203..816885 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
19.6084 18.1685 22.2424 23.2024 17.8136 15.9887 18.1766 18.6775 22.5945 16.9253 19.8021 14.6446 11.9355 14.3076 6.81938 7.84416 13.4119 13.484 18.5 25.2506 13.8002 17.4676 21.4556 11.6876 30.486 33.7308 13.036 9.812 4.66046 7.34238
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR003386LACT/PDAT_acylTrfase
IPR029058AB_hydrolase
Vocabulary: Molecular Function
TermDefinition
GO:0008374O-acyltransferase activity
Vocabulary: Biological Process
TermDefinition
GO:0006629lipid metabolic process
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006629 lipid metabolic process
molecular_function GO:0008374 O-acyltransferase activity
Blast
BLAST of TCONS_00002071 vs. Swiss-Prot (Human)
Match: PAG15 (Group XV phospholipase A2 OS=Homo sapiens GN=PLA2G15 PE=1 SV=2)

HSP 1 Score: 195.282 bits (495), Expect = 9.866e-57
Identity = 117/322 (36.34%), Postives = 179/322 (55.59%), Query Frame = 1
Query:  106 FRLTYNEKEDRMENTEGVFTRIPGFGNTSGIEWLDPYVHGPGIYFFPLVDSLTRLLGYERGKTLRSAPYDFRYHPGDAGDYFDRLKKLIEETYMMNGEKKIMLLSHSMGVPYSLNFLHRQTEEWKEKYIVAWTTISGVFGGSMKAVKAFISGDGFGIPKVLDYPITLRAFQRTFSSLPYILPDESFWAKDEVIVKTSNRTYTVHQYDDLFKDMGYPLASKIYAKTPK-AWSEKPPNVKMFCFHGSGKDTPGVLNYREGYFPNYTPXXXXXXXXXXVNLRSLQACQLWREKQKQPIIYEEFSRGEHNGVLGDARLIRSIIKAL 1068
             RL YN+     +  +GV  R+PGFG T  +E+LDP     G YF  +V+SL    GY RG+ +R APYD+R  P + G YF  L+++IEE Y + G   ++L++HSMG  Y+L FL RQ + WK+KYI A+ ++   +GG  K ++   SGD   IP +   P+ +R  QR+  S  ++LP    W+ ++V V+T    YT+  Y   F+D+G+     +   T     +  PP V++ C +G+G  TP    Y    FP+  P I   DGDGTVNL+S   CQ W+ +Q+  ++ +E    EH  +L +A  +  + + L
Sbjct:   94 IRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGW-GYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYG-GPVVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVI--GPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYES--FPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVL 409          
The following BLAST results are available for this feature:
BLAST of TCONS_00002071 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
PAG159.866e-5736.34Group XV phospholipase A2 OS=Homo sapiens GN=PLA2G... [more]
back to top