Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00002070 (transcript) - C. hemisphaerica

Overview
NameTCONS_00002070
Unique NameTCONS_00002070
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1244

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00002070 ID=TCONS_00002070|Name=TCONS_00002070|organism=Clytia hemisphaerica|type=transcript|length=1244bp
TTAGGCTGACTTACAACGAGAAGGAAGATCGAATGGAAAATACTGAAGGT
GTTTTCACCAGAATTCCTGGGTTTGGAAACACATCTGGCNAAGGCATTGT
TCTTGTTTAGGCTGACTTACAACGAGAAGGAAGATCGAATGGAAAATACT
GAAGGTGTTTTCACCAGAATTCCTGGGTTTGGAAACACATCTGGCATCGA
ATGGCTGGATCCTTATGTGCATGGACCTGGTATCTACTTCTTCCCTTTGG
TGGATTCATTAACCAGATTGCTGGGTTATGAGCGTGGAAAAACTTTACGA
TCTGCTCCGTATGACTTCCGCTACCATCCTGGAGATGCTGGTGATTATTT
TGATCGtttgaagaagttgattgaAGAGACGTACATGATGAATGGAGAGA
AGAAGATTATGTTGCTTTCTCATAGCATGGGTGTTCCTTACTCCCTCAAC
TTTCTTCATCGACAAACTGAAGaatggaaagaaaaatatatcgTGGCATG
GACCACTATTTCTGGTGTATTCGGAGGTTCTATGAAAGCTGTGAAAGCGT
TCATATCTGGTGATGGATTTGGTATTCCCAAAGTGCTTGATTATCCAATC
ACATTGCGAGCTTTTCAACGAACATTCAGTAGTTTACCTTACATCCTTCC
TGATGAAAGTTTTTGGGCCAAGGATGAGGTAATCGTCAAAACGTCGAATC
GGACATACACAGTACACCAATACGACGACCTCTTCAAAGACATGGGTTAT
CCGCTAGCAAGTAAAATCTATGCAAAGACTCCTAAAGCGTGGTCAGAAAA
ACCTCCTAACgtcaaaatgttttgttttcacgGGAGTGGTAAGGACACTC
CCGGTGTTTTGAATTACCGAGAAGGATATTTTCCGAATTACACACCGGAC
ATAACAATTGATGATGGGGATGGGACGGTGAACTTGCGGAGTCTTCAAGC
GTGTCAGTTGTGGagggaaaaacaaaaacaaccaaTAATTTATGAAGAAT
TTTCTAGAGGTGAGCATAATGGTGTTTTGGGTGACGCTCGGCTCATCAGG
TCCATCATTAAAGCTCTTAGTGAAGATTGATAGTCTCATATCTTTAATAC
ATTTGTGTAAATTCATTTTAATCTATATACCGTACTTCactattatttta
acattttttgttgtttagtATTTAAAACATGTAGTATATTTTTAGTCAGT
ATTGTCTACtttttgaaaacgttttaaATGGACGGACCATTGTG
Run BLAST on NCBI

transcript from alignment at sc0000018:811203..814052+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00002070 ID=TCONS_00002070|Name=TCONS_00002070|organism=Clytia hemisphaerica|type=transcript|length=2850bp|location=Sequence derived from alignment at sc0000018:811203..814052+ (Clytia hemisphaerica)
TTAGGCTGACTTACAACGAGAAGGAAGATCGAATGGAAAATACTGAAGGT GTTTTCACCAGAATTCCTGGGTTTGGAAACACATCTGGCNAAGGCATTGT TCTTGTTTAGGCTGACTTACAACGAGAAGGAAGATCGAATGGAAAATACT GAAGGTGTTTTCACCAGAATTCCTGGGTTTGGAAACACATCTGGCATCGA ATGGCTGGATCCTTATGTGCATGGACCTGGTATCTACTTCTTCCCTTTGG TGGATTCATTAACCAGATTGCTGGGTTATGAGCGTGGAAAAACTTTACGA TCTGCTCCGTATGACTTCCGCTACCATCCTGGTAAGATGTTATTCATTTA CTTCATCTTTTCTTCTAGTTGGGAttttttaatggattttttGTATGTGA CTGTATGGTTTATTATGAGtgtcaattttcttgaaaatcatTGTTACATG ATGATACATCAAATCGGCGACcattaaattgttttaaaagaattttgtaT AAGGCTTATTTTGATATGACATTTAGATAgcaataagaaaatttgaaatt cgaaaTCTTTCAGGAGATGCTGGTGATTATTTTGATCGtttgaagaagtt gattgaAGAGACGTACATGATGAATGGAGAGAAGAAGATTATGTTGCTTT CTCATAGCATGGGTGTTCCTTACTCCCTCAACTTTCTTCATCGACAAACT GAAGaatggaaagaaaaatatatcgTGGCATGGACCACTATTTCTGGTAT GAACAGTTCCACTTTTATTTGATGTTCGCcacttttatttgaaatattga aagttCTTTCGTCTCAGACGTATTGTAAATAGGCTTTTCTAAAGCTTCAA GAATGTGCTAATTTGTTGTgtaaaaattttgctttgatcactgtattcat gatatgcaccattgcaatgtcatccgttccacccaatagctgattggttg aaagtgacgtattgactgcttttacgtcacttccaaccaatgagctattg gttccatgacgtaatgtcagaagacattgcactggtgcatatcatgaata tcatgttCATTCATAAACAAAAACAGATGAACTTATTCGTTACAGTGGCT TCTAGCTATTATAAAGATTGGCTCATACTCTTCTGCTTATTTCTTCCTCG TCTTGGTGGTCCAGGTCTTAAACATGATGACATCATAACCTTTCCCACGT GGCATTAGTGTATTACAAAGAGGATATTATTTTAGTGTTGAAGAAGGATT AACCTCGAATTTTGTTGGATCTAACCGCATGCAATGTAGCTTCCTCAAAT TTTGTAATgtaatctattcatgatatacacaattgcaatgtcttctgaca ttacatcacggacccaattagctgattggttgtaagtgacgtaaaatcag tcaatacgtcaccttcaaccaatcagctgttgggtccgtggaagacattg caatggtgcatatcatgaattcagcTTGCCTTCTCGCACATGCgtggtcg ttacttgaccttgGGTAATATTTCTCAATACACCCCTCACTAactggtca ttattgtattagtgtATATTCTTTTTAGGTGTATTCGGAGGTTCTATGAA AGCTGTGAAAGCGTTCATATCTGGTGATGGATTTGGTATTCCCAAAGTGC TTGATTATCCAATCACATTGCGAGCTTTTCAACGAACATTCAGTAGTTTA CCTTACATCCTTCCTGATGAAAGTTTTTGGGCCAAGGATGAGGTGTGTAT AGTCTTTATGCCAATAGAAATTTCAGACGGTCTTTGATTTTCACTGCTGC AAAAGAATTTACATAATTCTACTGAGCAGTCTTTGAGCTTTCTTATTTGT AGCTTTTCGGCACATCATTTCACTAGAGCACTGAATTATTCGAAGTGATA TACATCAAGTATTAATTTGCTTAGTACGACTCATTTTGTAAAAGATAGCG AGGTTAATTATTGATAGATATTTTGCGACGACGAATTTAGTTTCCCCTAA GCCTTCATTTATGCTATTTTGTACAGTTTATCCCAAAAAGAAGATAGACT TGCCCTAAAAATCAACTTTGGTGCTAGAGCGAATTTCCgctttatttttc gttttcaaagCAAAGTGTGTAGACTACGTGAGGAAAGTCTACTTTGCTTT CCTACTTACCGCGAACGAAGGGCATATGAAGCCCGTTCGTCGTCGCGAAA TATCTACCGATACTATTATGTATCACTATATGTCTTTCTCACAGATTATC TTTTTCCCTAACAATCTTTCGTACTTTCATCCAGGTAATCGTCAAAACGT CGAATCGGACATACACAGTACACCAATACGACGACCTCTTCAAAGACATG GGTTATCCGCTAGCAAGTAAAATCTATGCAAAGACTCCTAAAGCGTGGTC AGAAAAACCTCCTAACgtcaaaatgttttgttttcacgGGAGTGGTAAGG ACACTCCCGGTGTTTTGAATTACCGAGAAGGATATTTTCCGAATTACACA CCGGACATAACAATTGATGATGGGGATGGGACGGTGAACTTGCGGAGTCT TCAAGCGTGTCAGTTGTGGagggaaaaacaaaaacaaccaaTAATTTATG AAGAATTTTCTAGAGGTGAGCATAATGGTGTTTTGGGTGACGCTCGGCTC ATCAGGTCCATCATTAAAGCTCTTAGTGAAGATTGATAGTCTCATATCTT TAATACATTTGTGTAAATTCATTTTAATCTATATACCGTACTTCactatt attttaacattttttgttgtttagtATTTAAAACATGTAGTATATTTTTA GTCAGTATTGTCTACtttttgaaaacgttttaaATGGACGGACCATTGTG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_001088XLOC_001088Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00002070-exon-sc0000018-1491911889:811203..811533TCONS_00002070-exon-sc0000018-1491911889:811203..811533Clytia hemisphaericaexon
TCONS_00002070-exon-sc0000018-1510915933:811203..811533TCONS_00002070-exon-sc0000018-1510915933:811203..811533Clytia hemisphaericaexon
TCONS_00002070-exon-sc0000018-1575043694:811203..811533TCONS_00002070-exon-sc0000018-1575043694:811203..811533Clytia hemisphaericaexon
TCONS_00002070-exon-sc0000018-1491911889:811766..811948TCONS_00002070-exon-sc0000018-1491911889:811766..811948Clytia hemisphaericaexon
TCONS_00002070-exon-sc0000018-1510915933:811766..811948TCONS_00002070-exon-sc0000018-1510915933:811766..811948Clytia hemisphaericaexon
TCONS_00002070-exon-sc0000018-1575043694:811766..811948TCONS_00002070-exon-sc0000018-1575043694:811766..811948Clytia hemisphaericaexon
TCONS_00002070-exon-sc0000018-1491911889:812781..812944TCONS_00002070-exon-sc0000018-1491911889:812781..812944Clytia hemisphaericaexon
TCONS_00002070-exon-sc0000018-1510915933:812781..812944TCONS_00002070-exon-sc0000018-1510915933:812781..812944Clytia hemisphaericaexon
TCONS_00002070-exon-sc0000018-1575043694:812781..812944TCONS_00002070-exon-sc0000018-1575043694:812781..812944Clytia hemisphaericaexon
TCONS_00002070-exon-sc0000018-1491911889:813487..814052TCONS_00002070-exon-sc0000018-1491911889:813487..814052Clytia hemisphaericaexon
TCONS_00002070-exon-sc0000018-1510915933:813487..814052TCONS_00002070-exon-sc0000018-1510915933:813487..814052Clytia hemisphaericaexon
TCONS_00002070-exon-sc0000018-1575043694:813487..814052TCONS_00002070-exon-sc0000018-1575043694:813487..814052Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000018supercontigsc0000018:811203..814052 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 0 0 0 0 0 0 0 0 0.000107759 4.21391e-08 0.802838 0 0 0 0 0 0 0 1.09479 1.34459 1.78879e-07 1.61894 1.1713 0 1.02057e-05 0 0 0
Blast
BLAST of TCONS_00002070 vs. Swiss-Prot (Human)
Match: PAG15 (Group XV phospholipase A2 OS=Homo sapiens GN=PLA2G15 PE=1 SV=2)

HSP 1 Score: 195.282 bits (495), Expect = 5.659e-57
Identity = 117/322 (36.34%), Postives = 179/322 (55.59%), Query Frame = 1
Query:  106 FRLTYNEKEDRMENTEGVFTRIPGFGNTSGIEWLDPYVHGPGIYFFPLVDSLTRLLGYERGKTLRSAPYDFRYHPGDAGDYFDRLKKLIEETYMMNGEKKIMLLSHSMGVPYSLNFLHRQTEEWKEKYIVAWTTISGVFGGSMKAVKAFISGDGFGIPKVLDYPITLRAFQRTFSSLPYILPDESFWAKDEVIVKTSNRTYTVHQYDDLFKDMGYPLASKIYAKTPK-AWSEKPPNVKMFCFHGSGKDTPGVLNYREGYFPNYTPXXXXXXXXXXVNLRSLQACQLWREKQKQPIIYEEFSRGEHNGVLGDARLIRSIIKAL 1068
             RL YN+     +  +GV  R+PGFG T  +E+LDP     G YF  +V+SL    GY RG+ +R APYD+R  P + G YF  L+++IEE Y + G   ++L++HSMG  Y+L FL RQ + WK+KYI A+ ++   +GG  K ++   SGD   IP +   P+ +R  QR+  S  ++LP    W+ ++V V+T    YT+  Y   F+D+G+     +   T     +  PP V++ C +G+G  TP    Y    FP+  P I   DGDGTVNL+S   CQ W+ +Q+  ++ +E    EH  +L +A  +  + + L
Sbjct:   94 IRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGW-GYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYG-GPVVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVI--GPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYES--FPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVL 409          
The following BLAST results are available for this feature:
BLAST of TCONS_00002070 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
PAG155.659e-5736.34Group XV phospholipase A2 OS=Homo sapiens GN=PLA2G... [more]
back to top