Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00002059 (transcript) - C. hemisphaerica

Overview
NameTCONS_00002059
Unique NameTCONS_00002059
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2602

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00002059 ID=TCONS_00002059|Name=TCONS_00002059|organism=Clytia hemisphaerica|type=transcript|length=2602bp
ttgagaataagggattgcaaatctgttaatcgtgtttgtttctcattttt
gattatatccttcaactccaagtagttttattgttatttagatttttaat
tttttttttcaaaatggcgacctcgccaaatgctcctagtctacttgact
ggactcagcgtcataaaaaattatcaaaaagcaaagttcagccagaagta
gactctagtctaggggtcatgtaaaaattcaaaacaaaaaaggggGAGTA
TTTTTCTTTACTTGGCTCTCTCCCCGAGTTGATTTTAACAGGATAACAGA
ACAAAATGGCGGACCGACTAAGGGATGAACTCAATGATTCTaaagaagag
gaagaagaaaaCTTTTGGAAGCAAATTTTACGAGAAGTATCAGCAAAATC
ATCTAGAAGATTTCCTTCTTGCAAAAGAATCTTGGTGTTAGGGAACGATG
GAACAGGTAAAACAAGTCTGGTCATGAAATTGAGGAGGTCTGGGGACGAT
TTATTGCGTGGTTCAGGATTGGAATATACCTACCTTGATGTGGATGACGA
AGAACGAGATGaacACACCAGGCTCAGTGTTTGGATACAATCAGGAGAAG
CACACATCAAGGACCTCATGAAATATGTCATCACCAAGGAATCTATACAC
CATTCTCTCATCTTATTATGCATTGATATCTCGAAACCATGGAACATGCT
TGACCAACTGGAAAACCATGTCAATATTTTACGTCAGCACTTACACACTT
TAAATATTTCGGCAAAAATTTTAAACGAACTCGAAAAACAAGTTCTTCGA
GATTTTCACATGTACAAATACAATGACGAGGAAAACAAACGGTTGAGTTC
CAACATGGAGCAAGACGAACAAGAGATGAACCAACTAGCAGAAAATATGA
TCGTTGATAATATTGGTCTCCCTATCGTCGTTGCTGTCACTAAGACGGAC
AACATGTCTTCCCTCGAACAAGAACACGACTACCGTGAAGAACATTTCga
tttcatccaaaaaaatCTACGAAAATTCTGCCTCAAATGCGGGGCATCAT
TAATATATACTTCGACCAAAGAGAATTGCAACACATCCGTTTTATATAAA
TATCTACTACATCGATTATACAACTTCCCCTTAAAAGATCCAGCACAAAT
CGTAGAGAAAGATGCCATTTATATtCCTGCAGGATGGGACAATCAGAGCA
AAATCAACATTCTAGACGAGCACATCAAAACTTTCGACGCAAACGAAACA
TTCAAAGATAGAATCGTCAAACCCGTCACACGAAAGtACGTCAACCAAGa
aaaagaagtcgttgcagaGGACGAACAGAAATTCTTGGAAGCGCAAATgG
CGATCCTAAGCAAAGAACCAGCACCTTCTTCATCCGCTCAAAGAGGTCCA
CCATCGCAGGACGCCAGAGCTTCCGCCCGAATGCAGGGCCATTCTCCAGG
ACAACGAGCAACCGGCCTCCCCCGACCAGCAGCCATGCCCAACATGAAGG
GAAAGCCTGACCCAACAAAAGGTGGTGCTGCTGGACAAAATTCATCAGAG
ACGGTCCTCGCCAATTTCTTCAACAGCTTATTGAATAAAAACTCAACCGG
AAAGCCAGGTGGTCCGCCCGGCAAAGGTGCCCCTCCAGCGAGCGGTGCAG
CAAATCGAAGCGACGTTCAAGCAGAACTAGAGAAGATGTCaagaaaaacc
atcaaaaaagaagaaaaatgaaaggctCTAGAATTACTAATTTTAATTAA
TAATTGATTATTTAAATGAATAATAAATTTAATAGcactttttctctaaa
atagccAAGACTGTGTTTTCTAAGAAAATATAAGCCAACTTAGTGTTGCT
TGCTGGTGGTACGTGGAACTAGATGTAATCTAGGCTAACGAAAGCCAATG
GAGCTGTCCCTCGGTATTTGTTCTTTGTCCAGAACATTGCAGACAGTTGT
TTCAGCCTGGAATGCAAGAGATTTTTAAAAGCTGGTTATTTTTGTTACCA
TTTATTATAAATAATAGAATTTCCcaaatattttgtttgactACAATTTT
TCATTTCCATTTTAGGTATTTATTAATATTTTCATGTTCTCGTCAGCATG
ACATCAAAGTAATGAAAATTGAGATTGAGGCTTTTTATAAACTCATTGAA
AGTGTTTctgttatatttttgttttgtcatACTTGAAGTATTTGGGGGAA
CATtcgttcattttttttatttcacagaaatctttttttgaacatcttca
tttttatattatGTAGACAATACTGTTGAAGAACACAAAGTGAATGAATT
TAATCCAATAACACCCCCTTTGTAACAGACTAAGCACCTCCCTGCTTCTT
ATCGGAAATTCTCTAAAAATGACCTCCTGCACCAGCTTCTTCATCTGACT
AAAAGATTCTCACTGAGTTTCTGGGACAGTGGTAGCAATCAGGTTGTGTT
CTTCAACAGTAGAAATAGCAATATAAAAACAATATATTGTATCGTAGTAT
TTTCGtgtacaataaaaaaatatctgaaaataaagaaaagtcaTTTAGAC
ACGAAATCATGctctttgaaattatttttgatgtatcaaaaagaaaaagg
aa
Run BLAST on NCBI

protein sequence of TCONS_00002059-protein

>TCONS_00002059-protein ID=TCONS_00002059-protein|Name=TCONS_00002059-protein|organism=Clytia hemisphaerica|type=polypeptide|length=471bp
MADRLRDELNDSKEEEEENFWKQILREVSAKSSRRFPSCKRILVLGNDGT
GKTSLVMKLRRSGDDLLRGSGLEYTYLDVDDEERDEHTRLSVWIQSGEAH
IKDLMKYVITKESIHHSLILLCIDISKPWNMLDQLENHVNILRQHLHTLN
ISAKILNELEKQVLRDFHMYKYNDEENKRLSSNMEQDEQEMNQLAENMIV
DNIGLPIVVAVTKTDNMSSLEQEHDYREEHFDFIQKNLRKFCLKCGASLI
YTSTKENCNTSVLYKYLLHRLYNFPLKDPAQIVEKDAIYIPAGWDNQSKI
NILDEHIKTFDANETFKDRIVKPVTRKYVNQEKEVVAEDEQKFLEAQMAI
LSKEPAPSSSAQRGPPSQDARASARMQGHSPGQRATGLPRPAAMPNMKGK
PDPTKGGAAGQNSSETVLANFFNSLLNKNSTGKPGGPPGKGAPPASGAAN
RSDVQAELEKMSRKTIKKEEK
Run BLAST on NCBI

transcript from alignment at sc0000018:698064..722166+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00002059 ID=TCONS_00002059|Name=TCONS_00002059|organism=Clytia hemisphaerica|type=transcript|length=24103bp|location=Sequence derived from alignment at sc0000018:698064..722166+ (Clytia hemisphaerica)
ttgagaataagggattgcaaatctgttaatcgtgtttgtttctcattttt gattatatccttcaactccaagtagttttattgttatttagatttttaat tttttttttcaaaatggcgacctcgccaaatgctcctagtctacttgact ggactcagcgtcataaaaaattatcaaaaagcaaagttcagccagaagta gactctagtctaggggtcatgtaaaaattcaaaacaaaaaaggggGAGTA TTTTTCTTTACTTGGCTCTCTCCCCGAGTTGATTTTAACAGGATAACAGA ACAAAATGGCGGACCGACTAAGGGATGAACTCAATGATTCTaaagaagag gaagaagaaaaCTTTTGGTAAGACTTTCTTTggctttatattttttgaat aatctTACTCTTAATAATTCAACTCTTCAGCTAAAATTTTTGACTACCAT CCCTttctgacacccttttttagagccGGCAATTATAGCTAGGAGGGTTA GAATCGCTGCAGACAAAATGTCAATTGAATATAAAACCTTACCAAGTGCc ctgtatagaccttttttcaaagaggacgtcctgttgaataattatgtagt ccagccataaaaacaatgatagagccatgcataattactgtatcatgcat attgtaataattatgcatggttttatcattgtttttctgcacgaccctcg acatgaaccgagaattctcgggcctcttcgggccatgttcgggccgggag tccctatcaattcttttggcccgaacatgacccgagtcattcgggccatg ttcgggccatgttaaatgttaaattgattcagcatgtccagtcaNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNtaacctttcacagtactaaagtgcgcatttttac ctaccatttttaccgggcctctgcaatggagtaccgtgaaatggcgagac tcctaaacggtgtattaagagaaaccaagtttttctcaaagaaaatgtta aaaaaattcagtctgAAATTtatacacgcctgtttaaatcatgttttcaa aaatacacctttcccgtaattcgtaaaactaatgcgcgcgcattattttg atgctctccaccgtttggtctctggaggtaaacaaatccgtttttgcctg cgtccccttagggaaagttggtttttttgagcttttcttaagttctgttg aacaaaatcccctcaaattttagtatgttcaatctattcatgatatcata ccaccctgaaaatattttgccaaaagaaggtcgctgtcaaaagttagagg ctcaaatcccactttccctaacccctcgcaggcaaacacgcgttttttac ctcccaaacaattttatacacaacggtggagcgcacattttcccgggcca tttctgagaaatttgaattacgggaaaggtgtattggcccgagtgtggcc cgtgcgtggcccgcgtgtggcccaaattctcgggccatactcgggcttta cgcgaattccaataaaagttttggcccgagaattctcgggccatgtcgag ggtcgtttttctgctggactacataattatttaacagggtggcctctttg aaaaaaggtctatcactGTAGGTCCACATCCTCCAGTCAGGAAAATCCCT CAATTgtggtatactgcaattgcggtagttttcaTTCGTCGTGATCAGGC CACACGGCCGTTAGAGTATGTCGCGCGGCCAGTACGGCACGCCACATAGC CAGTATGGCACATCAcagtttcaaaataaatgttAAAATCGGCAGGGTCG TTGGTTAGCATACAACAAAAGCTTATAGAGTCAAGTCACCAGTGCACAAA CGGCCCCAGTGCACGAACAAgcgtctttgaacttgaaaaaaacaaccaaa aacaaacttatATACAActtcctttgtgcagcagaatcctGAAACTATCC CTTGCAATcactccaaaaattaaaataaacggagcactagaacaatacca aaccgattttgaacgaggccaagtaaaaaatcacgaaattcgggattttt gtaaacatggcCGATTgcgagagaaaatgttttttataagaaaatttgcg caagaagagttctgaaaatgactttccttttttaaaaacctgttatcttc catcacacaaaatttcattgaaacatgttagCTCATTAATNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNtcaatagaaacatatcaccagtagttgat ataaaaaaggttccagtccgcgaacgatccgaacaccatattcaaaatga agacattgcaatgtcaaaacattcgaaagcgctggcgatctcaattaaaa aagaaggcACTACATTGCTGCGCTTTTCAATGAgcacaaaacttgaaaaa gaaaacaaaaaaatggacgacaagaaaatatttacaaaaataaacaggtt agtaaaacgctaaagttcttataaaaaagatattttttggtgaaaaagcg cgtggttttgaaaagttcaaatacccctgtatcatctcggaagagagtta aagtgttacctgcgagcagagctctaatttgttctttcaaaagatcgttc GCGCACTGGTTCCTCGTTCGCGGACTTGGTCCAAATAGCGCTCGCTTTAA Cgacttattattccaagaagaagccttcaaataaagtgaaaacaaactga aagaaggacttcaagctTGTTTACGAGATGGTCAAAAAGGATTTATGTAA AAACAAAAAGTAAGTgagaaaagagaaaaataagtttgccgttcgtgcac tgggcacCCCCCTCTAaccagtcagggaaatccctcaattgcggtatact gcaattgaaGTAGTTTTCATTCCTGgttagcctacaaaggcttataatgg ctacatatagtgctggtcgacaaagattaacaaacatcgactgtaaaaAA TTGTACGAGAAGAAAGcctttctttattaaaagaatctgatctacgaaaa aaatattttgtctgtgcgttaaaaagatatgatcaattatgtacaaaagt TGCCTGTTTTCTCAATtaatcttgaattctgtttcttgaatatactgcaa ttgcggtatatgaaaaatgtaaaagtgacatttataccgcaattgcagta aaaaattactaccgcaatgagggatttccctgactgataACGGCTACATA TAGTGATGGTcgacaaagaaaaacaaacatccagttagggaaaccatcca ggatcctgccattctataagccagcaaaaactaaatgacacttataaact taagtttcttactattttccatcgaaaacatccaaaaacattgctacttc ccgaAGCCGgggaccaaaacaaattatcttccaaaaTTAGGGCGCCCTTT TGggtctattgttaaggccatctaaaatgatGGAAAGAGTTGCGGGAAGA CAAAGACGTCCGCTACTTCGAGGGcagtaacgccaaaacgcccaatatga tcttccaacagaaggcgagtaaGTTGCCGCGCtggttacgtcatgcactc cactgcagcgcacaacgaagcgtgtttcaacgaatatcattaattagaat agaatatcttatgtgcttaccttcagtaaactttgagtgcttcattgaaa atgaagaaggtaagaagataaaaaatacgctggataattttcattgtaac agtttggtcgaAATaatcgctgaaagtttgaaaaagtttttccgatgcaa aaaaaaatttcagccaattaaaagcacagtgtgcttatacttactatgtt tgctacattgtCTAGGCTAAAGAAAGTGCGCAAAGACACTAACATTTTTA ATGagtgatgttatgatttttttgattgcagccgcgtacaggaactcgcc aaatgttcctaactgacatcgactgtaaaaaattgcagtataaatgtcac ttttacatttttcatataccTCAATTTGCAGTATATGCAAGAAACAGAgt tcaagattcaaggagaaaacaggcaatttttgtacataattaaTCATAAC ATAGTTTGGACTTAAACtggtatatcaagattacagaatttcgagtacgg gccgattttacttttgttttgagtggtttcgttttcgatttcaagccaac atcttagcaacagggtgctcgcccatagttacaggggtttgtgcaaaaaa ctaaacatagaaaattttccaaatcccccatttcgattaaagcaatgagt ttcacttttttgcacctattgcaaatgaaaatatttaagattttaaataa attttaaataatttaaagGGTGGGgctgcaaggcactgagaggccacggg tgccaaaaagaagggccgtttgaaatgtggcaacctcattggttaaaatt tgataaacagctgcgaaggagcgctgggaagcaatcagtagaagagacca ctttcttttttgttgcagattttgatataagCTTCTCTCAGGGATTGCTT GTCAATctacatgtacacatgtgttgtgtcaacttatcagcattgtattg ttgtagaggaaaagataaaagaggtaagactagcctactttctaatcctg atataggagttaaATTTTAGACTGCCTCCCCTTTTTTAaagggggatgac accttctgaaaaaatgaagaaggggaGCGTGATaggaaattttcatgaaa aagggggATGTCCAAAATTCTTGTggaatttttaaaggttgggcaGTATA GACCAAAACTcctaccatcaactgctctaacttgggactatctgacaaaa catgggacggcaattccgccaccatttcaccaaacctctaaactcatttg atttgatttaatgaacgacatattacaaaatacacaatttctctttcgca ctgagtaggcttttaaatcgaagtATGAAAataatctgtagtggaacaca cacaAGTGTCTGTGAACGATGAAGAACAAGTTAGAGGCAAAACGTTGGAG CAATTGACGTCActtgcgcggcaagttacacactggCTATTTGTTAATCC TATCGAgcggtaggcggttaggcgTTCTCTAACTCTCCAATCAACGTCCG GTCATTttgtatgaaaacaaaaaaagttaaaagggcgtgctatcagtgaa agttatcgtgacatgttatgacagaaagtatgattgataaacttgttaga gttatcaaaacaaatttgttgtcaaagagatttaacagtaagtgaaaata caggccagatgaTATCAACAGTCCTATGTtatgaccaatcgtcccaagtt agagcagttatTACGgtatatcaaaattttgggatTTGGAGTGTGGgcca attttactttcgttttcagtggtttcgatttcaagccaacatcttagcaa catgGTGCTCGCCTGTGTTttcccatagttacaggggtttttgcaaaaaa ccaaacatagaaagttttccaatCCCCCTATTTCAattgaaccaataaaa aatgaaacttttccatgtttcacttttttgcaccagatttaaaaattctt cttttattcaatgattttttacggcactttgttgacaatctaactctcgc atcaaattcccgttttcttcagaaaattgaagatgagaaaaaacccagag gtaagactagcctagtttttaatcctgatataggagtttaagcttagact gttggatgatgccaagaagggggtatcatttaagaagggggagTTAGACC CCTTTCCACACTATCAGAACAAAAGAACACCAGcttggtagattctaccc cctggGGCTAGTAGTTAAATATCATACACTGAATCCCCcagttattcaaa atttgcctaacaaaaagattttttattcaaGTTCTTTTTGCAATCActtt ttttcatgcaaagtaTCTTCTctcaaaaaaatggtaaaaataaattCCCA TTGGGAAATGGGCCAAAGCTGACAGTCCTTTCAAATTCTCAAATTCCTAA TTTCAAACTGAAACCTTTGTAACCCATTTACCAGGGTTTTGACAACAAGA AGcattgaatttatttttctttattgaacAAGAAATTGTACCCTTTAAAG CTTTCAAGGACTACCTTTTGATCAACAGAAAATCTGATCGGGCTGGTCGG AATTGAAAAAACTAGTGGTTTTAAGTTTTGTTTAAAGTGATCAACTATAT GTGGATCCTCAAGATGGAAAAAAacgtttcattactttttgtttttgttg ccaATCTGTCAAGCTCATTTCAAAATCTAGATGGGTCTCTGTATACTGaa gattcttttttttaagttgCCTAGAAACCTAAAGTTCTTTTCAATATGAT AATCAGATATTTTGGTATCTACTAggagggggtggaggattctaGGGGGG TGTGGTGTCAAGATTTTTTCCCACCCTCAGAGGGGGGtctcaaaaaattt catgtaACCCATTTACCAGGGTTTgtccaattttcattcattaataTAGA TTTCAAatgtacactctttttttataagcgtacttaggctcaaattcggt aaaaaattaacaaaatgacCATACTGAAATGCAAAATGATTTGTGCAGCC TTTTtaaaacgctgacctttttagggttattttaaccctattcgtactat aAAAATAACCCCccgctctttctgttcggaagtcaaactattggtaatag ctcctgaaataatagagctttggccgtgaaattttctgtaaattcctaac ttttattttgcttcaaaataaaaaaaaatttgacacctaaatattttcac accttgagcatgatgacatttcTGACAGTAAGGTGTCACAAAAATTGACA CTTTTCCAATACAAATTTATTTTAATgtcaaatatatcgtttaaaccgta atttattgaatatttaggataaaataagcattttaaactcaggcaactat tttctaaagcctttgttagaatacaatagctttttataagaacaatggaa aatttcggtttttgctcactttgggcatgatgagtgacgtcatcaaaaaa tttttttgtcaaaagttaccttacgtgacaaggatcttgtgtgccaaatt tcatccaaaaagacacactagatcaaaagttaagtggtggtacaggaaaa gccccccccccctagttctgaaccgcccctaaaagcctagtttgaatagg gttaaagctgtttgagctttcttagaccaaagattttTGCCTGGGGCggc aaattacaaagaaaacttaCATTCTTTGAGCTGAATTGAAAATTCTAAAT CTTCATGAACCCAATGAAAATCAACAAACCGAAgtctaagcatataaata agcataaatcaagggtgaaaatgagattttgcttaGCATATTCAGCCTCG AACTGATTTtcctgtatgcttataaaaaaaaagagtgtaccaGCTGCTAT TATTGCAGCTTCAAATCATCCAttttgagaaaacattttaagTGGCCTAT ATTAGGAAGGGAGGgatgtcaaaatatattgaccAGTTAGGGAGGGGCAT GAAATGTTCTTgtttttgtctgttttagaAGTTTTGATTTGTGAGTTTAT AGCTCTAAAAAAGGAAAGAGGATATTACCAAAAGTTTTCTGTAgtgtttt tgtaaaatttttcacGATGAAAATATATGAATAAATGGTACAAAAGCAGT GAATGATATATTTTAGagcttattattttttactttctctTTTTATCATC TACTTTTCAATTTGGTGATACAATCAACattttataatttgaatttgTCA TTTAGGAAGCAAATTTTACGAGAAGTATCAGCAAAATCATCTAGAAGATT TCCTTCTTGCAAAAGAATCTTGGTGTTAGGTTTgtatttatattcattta aactCTTAATATGTCAACGGTTGGTTATTGGTTTTGTTAACAAAGGCATT CAAAATTTCCTCCCCGTAATGTCTTCGAATACCAAGGACAGAGTTTTAAG AAAACaagtcaagaaaacaaaaagcatatggaaaaaatatttttagatac tgTCTTAAATGCCTTAACCTTAAAAGACGATCACCTAAATTCTTTATCTG GGCTATTTTAACCTTTTAatcaaaacttcaaactttgtaGGGAACGATGG AACAGGTAAAACAAGTCTGGTCATGAAATTGAGGAGGTCTGGGGACGATT TATTGCGTGGTTCAGGATTGGAATATACCTACCTTGATGTGGATGACGAA GAACGAGATGGTATACTTCTAcatagttcggaagggggtcactacccccc cttccctagagctacccccctaccctaggttcttcccccttttaaaattt gatgctacccccctcaaaattttaaaatcctacaaaagaaaatagaacaC ACTGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGGGGGGTGCGAACTATGT TCTATTCTatgaattttgattttgttctGTTCTCTTATAAGAACCAGTGA AATTAGGCTTTGACCTGGCCGTTCTcaatttttgtggtttttcaGGCTTT ACTAAATGACCATAAATTTTTCTTAGGTTAAAAGcttacttttaaaaaaa gtctttaaataccaatttttttgactttttttttgcgttttattcttatg aaatattgttcttttaaataaaaaagcgtgtatttgtaGTTGTCTATTTC AATTAAAAGTTTGTAGGTTGAAATCAAATTTCACTACAAGATTGTAAGCG ATATCACTGCCTTTCTTTTACACCAACGATGCAGAAACACGGACAACTCA CTCTCTtcatacttaatttttttcagaacACACCAGGCTCAGTGTTTGGA TACAATCAGGAGAAGCACACATCAAGGACCTCATGAAATATGTCATCACC AAGGAATCTATACACCATTCTCTCATCTTATTATGCATTGATATCTCGAA ACCATGGAACATGCTTGACCAACTGGAAAACCATGTCAATATTTTACGTC AGCACTTACACACTTTAAATATTTCGGCAAAAATTTTAAACGAACTCGAA AAACAAGGTATGGTTcgatttcaatataaaaaaatttatcatcaaaatga aaaatatgagcaatctgattggctaaaagcGCGTACAtaaaatgctgtat ttcatattgtacctTACATATACAAGACTGCGTTcaaaaaaggggtctgg taagcgggagatcattattttgtacaattttatgATAAGAAAGGTTTCCT CTTCGCTTCCAATACACAACAACTTATCAAAAGAGTTCATGAAAAGAAtc ttttgatctttttaatgaccattcaattcttttgtcgaatgttttgatgt tgatttcatctaaataaaagtaaaagaaaaaatattggaagggaaaaaca aaacaaagaaaaagagacaCAAATGGAGAGAGAAAAGTTCTTGATATTTG TCAAGTTGATGATAAACCAGTTTTTACTCGTACaatatacagtatgtggc ccccaaaacctcgatcaaattatttaaaatttctctcaaatctagaggaa aagaggttttacaaaaaattttgctgcatgaaaaactttaacatctctac tttatttcccggaagttctttttcaaaattttgaatttcagcaatatttt tcaatcgcttcaAGATAGATAAgctttttctaatggcccccaaaacgttg cgttacagtatacccctggttgttaAAACGTAGGTTTGGGGCCCCaaaaa cgtaggtgtagttaaaatcaaattattaagccaaTGGTAATTAATATAAT AGGGGGAGAagctatgaacatatttgtattttcccttaaatttaagaccc gatggatgtaaaatttatgatttctaTAAAATacttcaagattttcgatg atgcaaagtcAAAAccgaaaaattggaaattttcaaaattacaattttga tttaacaacgtcttaatcaagtttctgaaaaccaatctcttttgaaaata gtcccattcatgtatggaatatgcagtgagaattttagaaaaacagctta actgaaactgaaaatatcaagctatttttctcctatattttgcaaaaaaa tgacagaatttgtcgtttttgctgattcagcgaaaaattttatatacacg tttttttttttataagaacaaactatataagaacataaggcttcgaggcc cataaatttaagaacattctaagaacattctaaggctttggagacttaaa aacatgcattttcttaagaaattacatcaaaatgctcaaaaaatgctgaa aataagaacattttaagaacgtttttaggcttcaaatccaaaaaactaag aacatccgaaggcttaaaaaatttttgacgttcttataaaaaaaaaaacg tgtataatgttaattttttgtaatAAATTTTAAGTCAAGCTGGTAGGAAT GGAATGTCGAGAtcttttgctgtttctcatatttagaattttcggtttta tcaatgctgattatAGGGCCTGTTAATATCGCTACGCGGAAACTGTGGAA TGTGGAAACCAAAGTAAAAGATCAATTATGTTTACAGaagatttttcttc ctttaattttgaaaagtaaataaaaacctCGATTGATCACGAAATATAAA GGCCTATCTTgacgggagtttctaaacatcgaccagaaatggcgaccacg accagcgaccacgaccggcgaccagataaatttgggttatcgaatttttc ctctttctgcACCGTAGAGTCTCtcttatgatcatttatttatcgaattg aagagtaaagctcacccctgtctcacctacagtgattataaagtcacgtg caaaacgtgtagagccgccatttcaacgctcttggagcttgaatagaggg tcaatttctatccttttatattttcggcatcaaattaattagtagtaaaa tttgtgctggaatttatttaggaagctttatatttgatcatcagatcatt attttgtcaaaataagtcattttgacaatgtaaggacaatagaatAATTG ATGAGATTGTTATCTCTAAAACTGGTCTTCCCAGCTTTTTCCTACTGACT ATATATATATTCaaactaaaggcatctcatttcggtacaattaaaatatt tggtgtaataaagtttacaggcatcacacttaattgccctgtcaatattt ttgtcaaaaagtgtcactttgtctagaaaatgactggtaacgtcaaaaGG GGCAGGTGTGAAAAGAGCTCACACCATACGCGTTTAAAAAGACagagaga aaaagaaagaaaaagtatcAGACGATCGTGTTCAATTAACGCATCAATAG ctctatttatttaatttgatcACCCAATGAATATTTTACGCTATATATTT TACCCatctctaaagtcacagatgtatcttgattttctgaaaggcattag gtgtagaaagtttcctagaCCCCATTTCCatgacttattttcaatatcca aggagctagagtgagttacatgcaatttttatcttattttggtgttgaaa tatcTCCTTCAGAcacaaatatgttattttgaatttgtctcGAACCATCA AAagcatgctcatttttaagtatagccatgattctttcaaaataaacaaa aatcgtctaattctgataaatctacaggtcaggatcctcattttaatgac gacctacgttttgggggccgtctccgttttgggggccatatactgtagga tatatttttctcgttcagagttttctattttttcctcACTTAAAAGCTCg gaaaatatgacgaaaaatctAAGCTCGAAAAATATATATCCCATATTTTA CTCTGTACCGTGTGATAACTATTGCTTAAATCTCCTGATCTACAGCTTTC AGAATAATTCACTAAAGCTTTAGTATATCACCAATAATCCATAGTGAATC GAGCTTTTTTGATTTGTAAGATAAAGTGGGTCATGTAACTGTGCGAGTGC TCGcgattaaaaaaaaaggattgcttgcgcaaatcgaatgttttcttaGC GGAAGTTTCGcaattttaattaaaatattAGTTAATAATAAATTTACTTA CTTAATTTAGTTACTCTCTTTTTAGAGGGTGTAAAATATTAGTTGAGCTA GCAACAAAGACTCGATTCTCAACTGTATGAAAACTTCTACCGTTTCAGTT CTTCGAGATTTTCACATGTACAAATACAATGACGAGGAAAACAAACGGTT GAGTTCCAACATGGAGCAAGACGAACAAGAGATGAACCAACTAGCAGAAA ATATGATCGTTGATAATATTGGTCTCCCTATCGTCGTTGCTGTCACTAAG GTTCCTTTTTACTACGTCTGCTTTTATGTGCTAAGCTGTTTCTTTAAAGA ACTCATTCATGCATGATATAGTTTTTATGCTCATGTGCCATATCTAAATG CAGGAAAGATACAAATCTTAATTTTGAATACCTTAAAATTGGAGAAAATA CAATAAGCCTAAATGTTACTTTGGGATTCAGATAAGATTTTATAGAATTG GAAAGAAAGTGGAATCAATTGCTTTTAAATATGACCCGCATGTACAGTTG GTATCATTTAACAAGTGTTCATAAATACCACTATCTCACAGCCTCCTATa gaatttgtttttgaaatccCAGTGAGAATGAAATATTGTttcaaagctca aaaaacctAAGTTGGGATACTTTTAGAGTTTCCATTCAATTTCAAATGGA GattaaatcaaagtcaattatCCAGTTGGGCTGGATTTGTAGGGTACTTT ACCACCGGGGgatgaaattttggccaaattttccagtgggccAAGGGTCA TCATGTAGGGGTGTTTATAAGGCATATGTAGTAATATTGTAAGTTATTTT ATGATTTGTTGAATGAATaacttgatttattttttacctACAGACGGACA ACATGTCTTCCCTCGAACAAGAACACGACTACCGTGAAGAACATTTCgat ttcatccaaaaaaatCTACGAAAATTCTGCCTCAAATGTATGTCgaactt tctgtttttttttcttatactcCTTCATATTATGCCATTCACGTTGAAAC TTGATACCTTTGAACCCATCCACCCAGTTAAATTCAAGATTGAAAAGCTT TATCCAGGCTTGATTCACTGTAGTACATTAGTGTCTTATAATCCTCTTAT AATTTCTTTCAGGCGGGGCATCATTAATATATACTTCGACCAAAGAGAAT TGCAACACATCCGTTTTATATAAATATCTACTACATCGATTATACAACTT CCCCTTAAAAGATCCAGCACAAATCGTAGAGAAAGATGCCATTTATATGT AAGAAAAGTTACCTCTGTGTGTAGTCTCAAAATCAACCCTGACTTCTTTC TGCTGATGTTGTTAGCTGTCAGACTCTGGAGTGATTCGTCATACAgtaaa aacaatattttgtctattttttgatggatttcatatttaatgtttctata ttttttgtcttttagtCCTGCAGGATGGGACAATCAGAGCAAAATCAACA TTCTAGACGAGCACATCAAAACTTTCGACGCAAACGAAACATTCAAAGAT AGAATCGTCAAACCCGTCACACGAAAGGTATTATGTTTAAACTTTTCTTT CGTCGTTTTTATTCCcgaattaagggctctgaccatagtgaatttttcat aattgccgtgtttaaaatgtgttttctgactgatgtaaccaacaaaacta tggcatgttatacattttctgtNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNaatctgaaaattcaaaaattgcattaaaaaa atttgatgaagaagaaaatgaagacttttgtgaggaagagtatttcaact ttgaagagcttagttccGGCGAAgaataaacattttgaaaaaattttcgc agtagatggtgtatcttttaccgaacaattaAAATtgttgcggaaaattt ttgtaaatgcttttttgtctcgaaatcttcaaaatagtggttttccatca attttttatctggattttgcttaaaaaaacagtcataacttttgacacat ctttttagaaaaattttccgcataatttaaaatagttcaattctttgcag acagtgtaaagaaattttgaaacaaaaaagttaattacccattaaaacta agcattttttgtaaaagagggtgatgcaacatattattaaNCTCTGTGTG TAGTCTCAAAATCAACCCTGACTTCTTTCTGCTGATGTTGTTAGCTGTCA GATTCTGGAGTGATTCGTCATACAGTAAAAACAACATTTGTTCTATTTTT CAATGGatttcatatttcatttttctatattttttgtcTTTCAGTCCTGC AGGATGGGACAATCAGAGCAAAATCAACATTCTAGACGAACACATCAAAA CTTTCGACGCAAACGAAACATTCAAAGATAGAATCGTCAAACCCGTCACA CGAAAGGTATTAAAATGTTTAAACTTTTCTTTCGTCGTTTTTAATCCTGA ATTAAGCTAGGGCTGGTGACTTTGGTGTGTATCATTGTGAAGAAATCCAA AAGAGCCTCTTTGCCGATGTCCCGCATCGCATTGTCATATTCATCTATCA ACGACGTATATGGTTCAAATTTACGGCGTCAAGTTTCTCAGGATCGAATG ACGTACAACGTCTGTATCTGATAGCACGTCAAGTAATAACTTTCGACGTC AACCAACCTTGGTTGTTTACTCGAACCCAATCCCTTTTCATGTTGTATTC GGCGTaggaaatcaaaagaaaaatgacatCCAAATACAcaagaaataaat attttttttctttttcacagtACGTCAACCAAGaaaaagaagtcgttgca gaGGACGAACAGAAATTCTTGGAAGCGCAAATggtaattataaaaatttt atttttgtttatcaaatcatatTGTTTCTAAAAGCTCGGTTATCTCATTT CCATACCTCTGATCATTTGCAGTAGAATATTTAAGAGCGGTTtatacaaa attttcaactatAAACCATATacacaggaaaatttttttgattcccTAGG CTATGGAAATGTATATGTGCAACAGCTCCCtagttatggaaatgaaattt cccGATCTTATGACTACCTAGGGATGTTAAATTTCCCTAATATTGAAAAG TGCTTTTTTTGAGCGAAACCCAATAAAACCCGATAGGGTTACCCATATTC ACGAATTAAATCCTGATTTATagaaagctggtaaaataattaaatgtatt cgatcattgtgtgagcattggttcgatagctctcattcgttctgacatgt actagactagtaaaccacgtcgttgtatttcgctgcagattaaacttggA ATAGGATCTATTTTcttatatgttcactgaatacaacgACTAGTTCCAAA TGGCGCTATTTACTAAATAAACGGTGGAGTGCTTTTCATACCGCGGCGGA GTGCTCACTAAAAACAGTGCACTCACTCTCACAGAttagaataaaaaagt aaacaaaactcggtactttttatgctttattattatttatttttttcaca tcataattattttttgaatttaatattataaaagaaggtgagtaCAATGG AATATCAGTCAATTTAGgagctttttttttgaaaaaattgaaagttcttt CTCCCATAATTATCATGCATAATGCACTAACAAGATATATACCAACAACA AGACAAGGAGTTATTcacaaaaaatatgatatttttgtCTGAATGAAAAG AATATGAACTGGACTGTACCTACCAGCTATAGGTAccccaaaacaaaaat attcatatatggggaaaaatctttttcaaacaggggggggtacagccgca gggtactaacccatagccgggtggtggtgtctaatttggaaattcaaaaa agttagtacccagTACTAATTTTGGGGTGGGGGTGGGTATATCTCCAATT ttaagttagtacccggtaccaATTTTAGGGTGGGGTGggtatcatttcaa tttttcttcaagtNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNTTGGCAAGTTTTAAGGGTGGTGTCTTCTATTTTCCTTGGTAAT TTTAAAGCCGGTACCCGTTACTAAAAAGGGGTtgggggtccctttttcct taaaaaaaagtaagtacccggtactaaaaaggggtgggggtcccttttcc ttaaaaaaaagtaagtacccggtactaaaaagggggtggtggtacctaag acaatttttcttaaaaatcaggttagtaccctatgggttagtaccctgcg gNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNaaaaagaaaaatgtttt caaaaaagcaacagcttttacaaaacataaaattatatgTATTTGTTCAT ATTGACCttcaattttgctataaaaatgaTATAGCTACATAAAATTACTT CTAAAtccaagtagattttttttttaattggcaaaaatccaatcaaaatt ttcgttaaaactgtaagtttgaaaaactttgacgtATAAATTTCAGTCTG AACTTGTTCAACAACACCAGGGGACAACACAAAATGACAAGGTAGAAGTC TGCCGGGGGGNTGACGTATAAATTTCAGTCTGAACTTGTTCAACAACACC AGGGGACAACACAAAATGACAAGGTAGAAGTCTGCCGAGGGGCACTGAAC TTGGTAActgacggggacgtgccgctggagtttgaaaagtggaccctgtg agAGGTGAAtgtttagtaaatttgggacccattcagaacgaaaaatgatt tgatcgaaaaaatcaaaatattttcccactTCAACCCTGTAAATTGGCAA AAGTGACTTAAAGtagacaaaaaattcaaatatttccaccctaaaaaTTG tatacatcttgaaaattagtaccGTGAGAtttggtaacttgcatcagtgg aggctaacatgcatagccctcaaatgaaagacctggctggtcattaaaat acaactacggagctccgctcgcagctctactctaccatttttgttttgat ttaactttgtattttaatgaccagtcaggtctttcatttgagagctatgc atgttagcctccacggatgcaagttacccaatcgcACGGTAAATTTTGGG ACCCTATCAGATATCTCTAGAgtctgaaaaagggaccctgatcaGCGGCA TGTCCCGTACTTAATTTTGCCGAAGTGCCCCCCCCTGGAAATCTGCCAGT AGTGAAAACCCAAAACATCCTCGTACATCTAACATTTAGAGTCAAAGGTA GTGAATTCCAGCTAAACGACGGGCATCCGAAAGCCCAGGAAATCAGTCAT CTCAATGtaaaatgttgttattttcattcACAAATAGAACCAAGATGTGT CTCAGTGGTCAGCTTGTCAGAATATTGTTTCCGCACAAAAAGCAGtcaat ttttaaattccaaattacGCCACTTcacttttcatcatttccacAACATA TTGCACAATATCAGTATTGCACCAccaaaaatgttatataaatACCATAC TTTCCATTATAATTTTTGAGGATTTCTGTAGCCATTTTGGAGTTACATTC TCTGGGATAAGGTCATCAGGTTTAACTTGTACCCTTGTATCCATAGAAAA AAGCAGTGATCTGTTACCCAATGAATGTGAGCATATTAACATATTGAACA TTCCCTGCATGTAGTCATGGAAGCTCAGCTGTGTCATAATGTCATAAATA TTGCACTTGTACTAGAGATTTACCAGCGTACCAagccaacaaaatttaaa agatcCCAGTGTTAAAACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNtctcccgcggcaatttctattttttataagaactctttatt attataagcactattcccgcgttcctgtgtccaaggaaagacagacgctt gctagtctagacatgtacttgcgctactttgagaatcccggcacttttgt cacaacagtggagcactagagagccaacttaatgacctcaaacccgtctc accgatccactgagcccttgcgacgcaagtccattgcgaacgaatgaggc cgcccaggcgggacgcctcacctttagtgttgtgttacacactgatcgaa tACACCCTTATAATGGTTTGCTTTACATACGACTCGAAACCTTTTGAGTA AAAAATCACTTGTTACGCATGCGTAATACAAGTTAGGGAAATCAATTTTC CCtaacctaaaaaaaaaattcccgaaCTTAGGCTCTAATTTCTGacagtt taaaatttttgattgaattgtcttatttgaaggtttgaaaaataagttct gATTTAATTAATTGTTTAAAGGATACACTCAAATTAAAGAGTTTGGGAAA TCGAATTTCCCAATCTGGGACATTTTATTTCACTAATTTAAGAAATCACA TTTCCCGATCCAGAGAAAGAATAGAATACAGCAAGCAAGGTCACAATTCG TGATATTTCCTTTCCCTAGCTTGTAGAAAGTAATCATTTTCAAAACTCGT GATCTCTCTTTTCCCGACTCATCCATAATCAGTTTAGAAAAACTTGGGAT TTTTAATTTCCCGATGCAATTCTGAATGGGCAACTAGAATGTTNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNTGGGCAACTAGaatgttaaaaatattagttttccA CATGTGGAAATCCGTTTTCACTAACACATTGGTAATACACTTCCAGCATG GGAAAATAGATTTCCTTAGTTTCCTTACTTTCCCGAACTTAAAATTCTCG ACTAATGTGATCGAATAAAAAACCACATCTGAAAATGAACAATCCCTAGG CTAgggaatcaataattttttcctgtgataggAACGTCATAAAATAATAA GTTGTTTtaatttattcatatttcttTGTTATTTTATTCTCAGGCGATCC TAAGCAAAGAACCAGCACCTTCTTCATCCGCTCAAAGAGGTCCACCATCG CAGGTAAGTTGAAATTTACTCACCTGATATTTCCACTATTGAGTATCTGT TAATCTCttgagaaaaaggaaaaacattaGTTGTTATTCCTCGACTTAGT AGAGGATGTAAATGACCATCAGgaacaattttattttctaaaaacttTTC TCAATTTGGCTTACAGGACGCCAGAGCTTCCGCCCGAATGCAGGGCCATT CTCCAGGACAACGAGCAACCGGCCTCCCCCGACCAGCAGCCATGCCCAAC ATGAAGGGAAAGGTATGTTCTTTTTTGTTAATGGGTGTAAACAGAACATT CATTCCTATGTATAGGTACTCttaagttccaaataaacggcccccggctt gttaatttttcgNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNcccccctg tttattaatttttaggaatatttgggttttcagaagtacaatttccaacc tcCCCGGCAATTAGGGGCCCCCCGCCTTTTAttgaaatctcgaaaatttt ccccccgtttctttggaacctaagagtacttacTATCCGATACTTTAAAA AGGGACACTTAGTCCAAAGTTGAAATTAGGACGCCTTCAACCACAGTTCA GAATCAAActggatcaaaagaagaaaaatcttcAATAGTTCAGAACTTTT ATATATTTTAGACTTCCTCGAGGCTTATTTTTCCGTTTCTGTCTAGACAG AGGACTCTAAGAGCTTAGGTTACATCATTATTCATCTTATCTTGCCTTTC TTGTAGCCTGACCCAACAAAAGGTGGTGCTGCTGGACAAAATTCATCAGA GACGGTCCTCGCCAATTTCTTCAACAGCTTATTGAATAAAAACTCAACCG GAAAGCCAGGTGGTCCGCCCGGCAAAGGTGCCCCTCCAGCGAGCGGTGCA GCAAATCGAAGCGACGTTCAAGCAGAACTAGAGAAGATGTCaagaaaaac catcaaaaaagaagaaaaatgaaaggctCTAGAATTACTAATTTTAATTA ATAATTGATTATTTAAATGAATAATAAATTTAATAGcactttttctctaa aatagccAAGACTGTGTTTTCTAAGAAAATATAAGCCAACTTAGTGTTGC TTGCTGGTGGTACGTGGAACTAGATGTAATCTAGGCTAACGAAAGCCAAT GGAGCTGTCCCTCGGTATTTGTTCTTTGTCCAGAACATTGCAGACAGTTG TTTCAGCCTGGAATGCAAGAGATTTTTAAAAGCTGGTTATTTTTGTTACC ATTTATTATAAATAATAGAATTTCCcaaatattttgtttgactACAATTT TTCATTTCCATTTTAGGTATTTATTAATATTTTCATGTTCTCGTCAGCAT GACATCAAAGTAATGAAAATTGAGATTGAGGCTTTTTATAAACTCATTGA AAGTGTTTctgttatatttttgttttgtcatACTTGAAGTATTTGGGGGA ACATtcgttcattttttttatttcacagaaatctttttttgaacatcttc atttttatattatGTAGACAATACTGTTGAAGAACACAAAGTGAATGAAT TTAATCCAATAACACCCCCTTTGTAACAGACTAAGCACCTCCCTGCTTCT TATCGGAAATTCTCTAAAAATGACCTCCTGCACCAGCTTCTTCATCTGAC TAAAAGATTCTCACTGAGTTTCTGGGACAGTGGTAGCAATCAGGTTGTGT TCTTCAACAGTAGAAATAGCAATATAAAAACAATATATTGTATCGTAGTA TTTTCGtgtacaataaaaaaatatctgaaaataaagaaaagtcaTTTAGA CACGAAATCATGctctttgaaattatttttgatgtatcaaaaagaaaaag gaa

Coding sequence (CDS) from alignment at sc0000018:698064..722166+

>TCONS_00002059 ID=TCONS_00002059|Name=TCONS_00002059|organism=Clytia hemisphaerica|type=CDS|length=18408bp|location=Sequence derived from alignment at sc0000018:698064..722166+ (Clytia hemisphaerica)
ATGGCGGACCGACTAAGGGATGAACTCAATGATTCTaaagaagaggaaga
agaaaaCTTTTGGAAGCAAATTTTACGAGAAGTATCAGCAAAATCATCTA
GAAGATTTCCTTCTTGCAAAAGAATCTTGGTGTTAGGGAACGATGGAACA
GGTAAAACAAGTCTGGTCATGAAATTGAGGAGGTCTGGGGACGATTTATT
GCGTGGTTCAGGATTGGAATATACCTACCTTGATGTGGATGACGAAGAAC
GAGATGaacACACCAGGCTCAGTGTTTGGATACAATCAGGAGAAGCACAC
ATCAAGGACCTCATGAAATATGTCATCACCAAGGAATCTATACACCATTC
TCTCATCTTATTATGCATTGATATCTCGAAACCATGGAACATGCTTGACC
AACTGGAAAACCATGTCAATATTTTACGTCAGCACTTACACACTTTAAAT
ATTTCGGCAAAAATTTTAAACGAACTCGAAAAACAAGTTCTTCGAGATTT
TCACATGTACAAATACAATGACGAGGAAAACAAACGGTTGAGTTCCAACA
TGGAGCAAGACGAACAAGAGATGAACCAACTAGCAGAAAATATGATCGTT
GATAATATTGGTCTCCCTATCGTCGTTGCTGTCACTAAGACGGACAACAT
GTCTTCCCTCGAACAAGAACACGACTACCGTGAAGAACATTTCgatttca
tccaaaaaaatCTACGAAAATTCTGCCTCAAATGCGGGGCATCATTAATA
TATACTTCGACCAAAGAGAATTGCAACACATCCGTTTTATATAAATATCT
ACTACATCGATTATACAACTTCCCCTTAAAAGATCCAGCACAAATCGTAG
AGAAAGATGCCATTTATATtCCTGCAGGATGGGACAATCAGAGCAAAATC
AACATTCTAGACGAGCACATCAAAACTTTCGACGCAAACGAAACATTCAA
AGATAGAATCGTCAAACCCGTCACACGAAAGtACGTCAACCAAGaaaaag
aagtcgttgcagaGGACGAACAGAAATTCTTGGAAGCGCAAATgGCGATC
CTAAGCAAAGAACCAGCACCTTCTTCATCCGCTCAAAGAGGTCCACCATC
GCAGGACGCCAGAGCTTCCGCCCGAATGCAGGGCCATTCTCCAGGACAAC
GAGCAACCGGCCTCCCCCGACCAGCAGCCATGCCCAACATGAAGGGAAAG
CCTGACCCAACAAAAGGTGGTGCTGCTGGACAAAATTCATCAGAGACGGT
CCTCGCCAATTTCTTCAACAGCTTATTGAATAAAAACTCAACCGGAAAGC
CAGGTGGTCCGCCCGGCAAAGGTGCCCCTCCAGCGAGCGGTGCAGCAAAT
CGAAGCGACGTTCAAGCAGAACTAGAGAAGATGTCaagaaaaaccatcaa
aaaagaagaaaaatgaATGGCGGACCGACTAAGGGATGAACTCAATGATT
CTaaagaagaggaagaagaaaaCTTTTGGAAGCAAATTTTACGAGAAGTA
TCAGCAAAATCATCTAGAAGATTTCCTTCTTGCAAAAGAATCTTGGTGTT
AGGGAACGATGGAACAGGTAAAACAAGTCTGGTCATGAAATTGAGGAGGT
CTGGGGACGATTTATTGCGTGGTTCAGGATTGGAATATACCTACCTTGAT
GTGGATGACGAAGAACGAGATGaacACACCAGGCTCAGTGTTTGGATACA
ATCAGGAGAAGCACACATCAAGGACCTCATGAAATATGTCATCACCAAGG
AATCTATACACCATTCTCTCATCTTATTATGCATTGATATCTCGAAACCA
TGGAACATGCTTGACCAACTGGAAAACCATGTCAATATTTTACGTCAGCA
CTTACACACTTTAAATATTTCGGCAAAAATTTTAAACGAACTCGAAAAAC
AAGTTCTTCGAGATTTTCACATGTACAAATACAATGACGAGGAAAACAAA
CGGTTGAGTTCCAACATGGAGCAAGACGAACAAGAGATGAACCAACTAGC
AGAAAATATGATCGTTGATAATATTGGTCTCCCTATCGTCGTTGCTGTCA
CTAAGACGGACAACATGTCTTCCCTCGAACAAGAACACGACTACCGTGAA
GAACATTTCgatttcatccaaaaaaatCTACGAAAATTCTGCCTCAAATG
CGGGGCATCATTAATATATACTTCGACCAAAGAGAATTGCAACACATCCG
TTTTATATAAATATCTACTACATCGATTATACAACTTCCCCTTAAAAGAT
CCAGCACAAATCGTAGAGAAAGATGCCATTTATATtCCTGCAGGATGGGA
CAATCAGAGCAAAATCAACATTCTAGACGAGCACATCAAAACTTTCGACG
CAAACGAAACATTCAAAGATAGAATCGTCAAACCCGTCACACGAAAGtAC
GTCAACCAAGaaaaagaagtcgttgcagaGGACGAACAGAAATTCTTGGA
AGCGCAAATgGCGATCCTAAGCAAAGAACCAGCACCTTCTTCATCCGCTC
AAAGAGGTCCACCATCGCAGGACGCCAGAGCTTCCGCCCGAATGCAGGGC
CATTCTCCAGGACAACGAGCAACCGGCCTCCCCCGACCAGCAGCCATGCC
CAACATGAAGGGAAAGCCTGACCCAACAAAAGGTGGTGCTGCTGGACAAA
ATTCATCAGAGACGGTCCTCGCCAATTTCTTCAACAGCTTATTGAATAAA
AACTCAACCGGAAAGCCAGGTGGTCCGCCCGGCAAAGGTGCCCCTCCAGC
GAGCGGTGCAGCAAATCGAAGCGACGTTCAAGCAGAACTAGAGAAGATGT
CaagaaaaaccatcaaaaaagaagaaaaatgaATGGCGGACCGACTAAGG
GATGAACTCAATGATTCTaaagaagaggaagaagaaaaCTTTTGGAAGCA
AATTTTACGAGAAGTATCAGCAAAATCATCTAGAAGATTTCCTTCTTGCA
AAAGAATCTTGGTGTTAGGGAACGATGGAACAGGTAAAACAAGTCTGGTC
ATGAAATTGAGGAGGTCTGGGGACGATTTATTGCGTGGTTCAGGATTGGA
ATATACCTACCTTGATGTGGATGACGAAGAACGAGATGaacACACCAGGC
TCAGTGTTTGGATACAATCAGGAGAAGCACACATCAAGGACCTCATGAAA
TATGTCATCACCAAGGAATCTATACACCATTCTCTCATCTTATTATGCAT
TGATATCTCGAAACCATGGAACATGCTTGACCAACTGGAAAACCATGTCA
ATATTTTACGTCAGCACTTACACACTTTAAATATTTCGGCAAAAATTTTA
AACGAACTCGAAAAACAAGTTCTTCGAGATTTTCACATGTACAAATACAA
TGACGAGGAAAACAAACGGTTGAGTTCCAACATGGAGCAAGACGAACAAG
AGATGAACCAACTAGCAGAAAATATGATCGTTGATAATATTGGTCTCCCT
ATCGTCGTTGCTGTCACTAAGACGGACAACATGTCTTCCCTCGAACAAGA
ACACGACTACCGTGAAGAACATTTCgatttcatccaaaaaaatCTACGAA
AATTCTGCCTCAAATGCGGGGCATCATTAATATATACTTCGACCAAAGAG
AATTGCAACACATCCGTTTTATATAAATATCTACTACATCGATTATACAA
CTTCCCCTTAAAAGATCCAGCACAAATCGTAGAGAAAGATGCCATTTATA
TtCCTGCAGGATGGGACAATCAGAGCAAAATCAACATTCTAGACGAGCAC
ATCAAAACTTTCGACGCAAACGAAACATTCAAAGATAGAATCGTCAAACC
CGTCACACGAAAGtACGTCAACCAAGaaaaagaagtcgttgcagaGGACG
AACAGAAATTCTTGGAAGCGCAAATgGCGATCCTAAGCAAAGAACCAGCA
CCTTCTTCATCCGCTCAAAGAGGTCCACCATCGCAGGACGCCAGAGCTTC
CGCCCGAATGCAGGGCCATTCTCCAGGACAACGAGCAACCGGCCTCCCCC
GACCAGCAGCCATGCCCAACATGAAGGGAAAGCCTGACCCAACAAAAGGT
GGTGCTGCTGGACAAAATTCATCAGAGACGGTCCTCGCCAATTTCTTCAA
CAGCTTATTGAATAAAAACTCAACCGGAAAGCCAGGTGGTCCGCCCGGCA
AAGGTGCCCCTCCAGCGAGCGGTGCAGCAAATCGAAGCGACGTTCAAGCA
GAACTAGAGAAGATGTCaagaaaaaccatcaaaaaagaagaaaaatgaAT
GGCGGACCGACTAAGGGATGAACTCAATGATTCTaaagaagaggaagaag
aaaaCTTTTGGAAGCAAATTTTACGAGAAGTATCAGCAAAATCATCTAGA
AGATTTCCTTCTTGCAAAAGAATCTTGGTGTTAGGGAACGATGGAACAGG
TAAAACAAGTCTGGTCATGAAATTGAGGAGGTCTGGGGACGATTTATTGC
GTGGTTCAGGATTGGAATATACCTACCTTGATGTGGATGACGAAGAACGA
GATGaacACACCAGGCTCAGTGTTTGGATACAATCAGGAGAAGCACACAT
CAAGGACCTCATGAAATATGTCATCACCAAGGAATCTATACACCATTCTC
TCATCTTATTATGCATTGATATCTCGAAACCATGGAACATGCTTGACCAA
CTGGAAAACCATGTCAATATTTTACGTCAGCACTTACACACTTTAAATAT
TTCGGCAAAAATTTTAAACGAACTCGAAAAACAAGTTCTTCGAGATTTTC
ACATGTACAAATACAATGACGAGGAAAACAAACGGTTGAGTTCCAACATG
GAGCAAGACGAACAAGAGATGAACCAACTAGCAGAAAATATGATCGTTGA
TAATATTGGTCTCCCTATCGTCGTTGCTGTCACTAAGACGGACAACATGT
CTTCCCTCGAACAAGAACACGACTACCGTGAAGAACATTTCgatttcatc
caaaaaaatCTACGAAAATTCTGCCTCAAATGCGGGGCATCATTAATATA
TACTTCGACCAAAGAGAATTGCAACACATCCGTTTTATATAAATATCTAC
TACATCGATTATACAACTTCCCCTTAAAAGATCCAGCACAAATCGTAGAG
AAAGATGCCATTTATATtCCTGCAGGATGGGACAATCAGAGCAAAATCAA
CATTCTAGACGAGCACATCAAAACTTTCGACGCAAACGAAACATTCAAAG
ATAGAATCGTCAAACCCGTCACACGAAAGtACGTCAACCAAGaaaaagaa
gtcgttgcagaGGACGAACAGAAATTCTTGGAAGCGCAAATgGCGATCCT
AAGCAAAGAACCAGCACCTTCTTCATCCGCTCAAAGAGGTCCACCATCGC
AGGACGCCAGAGCTTCCGCCCGAATGCAGGGCCATTCTCCAGGACAACGA
GCAACCGGCCTCCCCCGACCAGCAGCCATGCCCAACATGAAGGGAAAGCC
TGACCCAACAAAAGGTGGTGCTGCTGGACAAAATTCATCAGAGACGGTCC
TCGCCAATTTCTTCAACAGCTTATTGAATAAAAACTCAACCGGAAAGCCA
GGTGGTCCGCCCGGCAAAGGTGCCCCTCCAGCGAGCGGTGCAGCAAATCG
AAGCGACGTTCAAGCAGAACTAGAGAAGATGTCaagaaaaaccatcaaaa
aagaagaaaaatgaATGGCGGACCGACTAAGGGATGAACTCAATGATTCT
aaagaagaggaagaagaaaaCTTTTGGAAGCAAATTTTACGAGAAGTATC
AGCAAAATCATCTAGAAGATTTCCTTCTTGCAAAAGAATCTTGGTGTTAG
GGAACGATGGAACAGGTAAAACAAGTCTGGTCATGAAATTGAGGAGGTCT
GGGGACGATTTATTGCGTGGTTCAGGATTGGAATATACCTACCTTGATGT
GGATGACGAAGAACGAGATGaacACACCAGGCTCAGTGTTTGGATACAAT
CAGGAGAAGCACACATCAAGGACCTCATGAAATATGTCATCACCAAGGAA
TCTATACACCATTCTCTCATCTTATTATGCATTGATATCTCGAAACCATG
GAACATGCTTGACCAACTGGAAAACCATGTCAATATTTTACGTCAGCACT
TACACACTTTAAATATTTCGGCAAAAATTTTAAACGAACTCGAAAAACAA
GTTCTTCGAGATTTTCACATGTACAAATACAATGACGAGGAAAACAAACG
GTTGAGTTCCAACATGGAGCAAGACGAACAAGAGATGAACCAACTAGCAG
AAAATATGATCGTTGATAATATTGGTCTCCCTATCGTCGTTGCTGTCACT
AAGACGGACAACATGTCTTCCCTCGAACAAGAACACGACTACCGTGAAGA
ACATTTCgatttcatccaaaaaaatCTACGAAAATTCTGCCTCAAATGCG
GGGCATCATTAATATATACTTCGACCAAAGAGAATTGCAACACATCCGTT
TTATATAAATATCTACTACATCGATTATACAACTTCCCCTTAAAAGATCC
AGCACAAATCGTAGAGAAAGATGCCATTTATATtCCTGCAGGATGGGACA
ATCAGAGCAAAATCAACATTCTAGACGAGCACATCAAAACTTTCGACGCA
AACGAAACATTCAAAGATAGAATCGTCAAACCCGTCACACGAAAGtACGT
CAACCAAGaaaaagaagtcgttgcagaGGACGAACAGAAATTCTTGGAAG
CGCAAATgGCGATCCTAAGCAAAGAACCAGCACCTTCTTCATCCGCTCAA
AGAGGTCCACCATCGCAGGACGCCAGAGCTTCCGCCCGAATGCAGGGCCA
TTCTCCAGGACAACGAGCAACCGGCCTCCCCCGACCAGCAGCCATGCCCA
ACATGAAGGGAAAGCCTGACCCAACAAAAGGTGGTGCTGCTGGACAAAAT
TCATCAGAGACGGTCCTCGCCAATTTCTTCAACAGCTTATTGAATAAAAA
CTCAACCGGAAAGCCAGGTGGTCCGCCCGGCAAAGGTGCCCCTCCAGCGA
GCGGTGCAGCAAATCGAAGCGACGTTCAAGCAGAACTAGAGAAGATGTCa
agaaaaaccatcaaaaaagaagaaaaatgaATGGCGGACCGACTAAGGGA
TGAACTCAATGATTCTaaagaagaggaagaagaaaaCTTTTGGAAGCAAA
TTTTACGAGAAGTATCAGCAAAATCATCTAGAAGATTTCCTTCTTGCAAA
AGAATCTTGGTGTTAGGGAACGATGGAACAGGTAAAACAAGTCTGGTCAT
GAAATTGAGGAGGTCTGGGGACGATTTATTGCGTGGTTCAGGATTGGAAT
ATACCTACCTTGATGTGGATGACGAAGAACGAGATGaacACACCAGGCTC
AGTGTTTGGATACAATCAGGAGAAGCACACATCAAGGACCTCATGAAATA
TGTCATCACCAAGGAATCTATACACCATTCTCTCATCTTATTATGCATTG
ATATCTCGAAACCATGGAACATGCTTGACCAACTGGAAAACCATGTCAAT
ATTTTACGTCAGCACTTACACACTTTAAATATTTCGGCAAAAATTTTAAA
CGAACTCGAAAAACAAGTTCTTCGAGATTTTCACATGTACAAATACAATG
ACGAGGAAAACAAACGGTTGAGTTCCAACATGGAGCAAGACGAACAAGAG
ATGAACCAACTAGCAGAAAATATGATCGTTGATAATATTGGTCTCCCTAT
CGTCGTTGCTGTCACTAAGACGGACAACATGTCTTCCCTCGAACAAGAAC
ACGACTACCGTGAAGAACATTTCgatttcatccaaaaaaatCTACGAAAA
TTCTGCCTCAAATGCGGGGCATCATTAATATATACTTCGACCAAAGAGAA
TTGCAACACATCCGTTTTATATAAATATCTACTACATCGATTATACAACT
TCCCCTTAAAAGATCCAGCACAAATCGTAGAGAAAGATGCCATTTATATt
CCTGCAGGATGGGACAATCAGAGCAAAATCAACATTCTAGACGAGCACAT
CAAAACTTTCGACGCAAACGAAACATTCAAAGATAGAATCGTCAAACCCG
TCACACGAAAGtACGTCAACCAAGaaaaagaagtcgttgcagaGGACGAA
CAGAAATTCTTGGAAGCGCAAATgGCGATCCTAAGCAAAGAACCAGCACC
TTCTTCATCCGCTCAAAGAGGTCCACCATCGCAGGACGCCAGAGCTTCCG
CCCGAATGCAGGGCCATTCTCCAGGACAACGAGCAACCGGCCTCCCCCGA
CCAGCAGCCATGCCCAACATGAAGGGAAAGCCTGACCCAACAAAAGGTGG
TGCTGCTGGACAAAATTCATCAGAGACGGTCCTCGCCAATTTCTTCAACA
GCTTATTGAATAAAAACTCAACCGGAAAGCCAGGTGGTCCGCCCGGCAAA
GGTGCCCCTCCAGCGAGCGGTGCAGCAAATCGAAGCGACGTTCAAGCAGA
ACTAGAGAAGATGTCaagaaaaaccatcaaaaaagaagaaaaatgaATGG
CGGACCGACTAAGGGATGAACTCAATGATTCTaaagaagaggaagaagaa
aaCTTTTGGAAGCAAATTTTACGAGAAGTATCAGCAAAATCATCTAGAAG
ATTTCCTTCTTGCAAAAGAATCTTGGTGTTAGGGAACGATGGAACAGGTA
AAACAAGTCTGGTCATGAAATTGAGGAGGTCTGGGGACGATTTATTGCGT
GGTTCAGGATTGGAATATACCTACCTTGATGTGGATGACGAAGAACGAGA
TGaacACACCAGGCTCAGTGTTTGGATACAATCAGGAGAAGCACACATCA
AGGACCTCATGAAATATGTCATCACCAAGGAATCTATACACCATTCTCTC
ATCTTATTATGCATTGATATCTCGAAACCATGGAACATGCTTGACCAACT
GGAAAACCATGTCAATATTTTACGTCAGCACTTACACACTTTAAATATTT
CGGCAAAAATTTTAAACGAACTCGAAAAACAAGTTCTTCGAGATTTTCAC
ATGTACAAATACAATGACGAGGAAAACAAACGGTTGAGTTCCAACATGGA
GCAAGACGAACAAGAGATGAACCAACTAGCAGAAAATATGATCGTTGATA
ATATTGGTCTCCCTATCGTCGTTGCTGTCACTAAGACGGACAACATGTCT
TCCCTCGAACAAGAACACGACTACCGTGAAGAACATTTCgatttcatcca
aaaaaatCTACGAAAATTCTGCCTCAAATGCGGGGCATCATTAATATATA
CTTCGACCAAAGAGAATTGCAACACATCCGTTTTATATAAATATCTACTA
CATCGATTATACAACTTCCCCTTAAAAGATCCAGCACAAATCGTAGAGAA
AGATGCCATTTATATtCCTGCAGGATGGGACAATCAGAGCAAAATCAACA
TTCTAGACGAGCACATCAAAACTTTCGACGCAAACGAAACATTCAAAGAT
AGAATCGTCAAACCCGTCACACGAAAGtACGTCAACCAAGaaaaagaagt
cgttgcagaGGACGAACAGAAATTCTTGGAAGCGCAAATgGCGATCCTAA
GCAAAGAACCAGCACCTTCTTCATCCGCTCAAAGAGGTCCACCATCGCAG
GACGCCAGAGCTTCCGCCCGAATGCAGGGCCATTCTCCAGGACAACGAGC
AACCGGCCTCCCCCGACCAGCAGCCATGCCCAACATGAAGGGAAAGCCTG
ACCCAACAAAAGGTGGTGCTGCTGGACAAAATTCATCAGAGACGGTCCTC
GCCAATTTCTTCAACAGCTTATTGAATAAAAACTCAACCGGAAAGCCAGG
TGGTCCGCCCGGCAAAGGTGCCCCTCCAGCGAGCGGTGCAGCAAATCGAA
GCGACGTTCAAGCAGAACTAGAGAAGATGTCaagaaaaaccatcaaaaaa
gaagaaaaatgaATGGCGGACCGACTAAGGGATGAACTCAATGATTCTaa
agaagaggaagaagaaaaCTTTTGGAAGCAAATTTTACGAGAAGTATCAG
CAAAATCATCTAGAAGATTTCCTTCTTGCAAAAGAATCTTGGTGTTAGGG
AACGATGGAACAGGTAAAACAAGTCTGGTCATGAAATTGAGGAGGTCTGG
GGACGATTTATTGCGTGGTTCAGGATTGGAATATACCTACCTTGATGTGG
ATGACGAAGAACGAGATGaacACACCAGGCTCAGTGTTTGGATACAATCA
GGAGAAGCACACATCAAGGACCTCATGAAATATGTCATCACCAAGGAATC
TATACACCATTCTCTCATCTTATTATGCATTGATATCTCGAAACCATGGA
ACATGCTTGACCAACTGGAAAACCATGTCAATATTTTACGTCAGCACTTA
CACACTTTAAATATTTCGGCAAAAATTTTAAACGAACTCGAAAAACAAGT
TCTTCGAGATTTTCACATGTACAAATACAATGACGAGGAAAACAAACGGT
TGAGTTCCAACATGGAGCAAGACGAACAAGAGATGAACCAACTAGCAGAA
AATATGATCGTTGATAATATTGGTCTCCCTATCGTCGTTGCTGTCACTAA
GACGGACAACATGTCTTCCCTCGAACAAGAACACGACTACCGTGAAGAAC
ATTTCgatttcatccaaaaaaatCTACGAAAATTCTGCCTCAAATGCGGG
GCATCATTAATATATACTTCGACCAAAGAGAATTGCAACACATCCGTTTT
ATATAAATATCTACTACATCGATTATACAACTTCCCCTTAAAAGATCCAG
CACAAATCGTAGAGAAAGATGCCATTTATATtCCTGCAGGATGGGACAAT
CAGAGCAAAATCAACATTCTAGACGAGCACATCAAAACTTTCGACGCAAA
CGAAACATTCAAAGATAGAATCGTCAAACCCGTCACACGAAAGtACGTCA
ACCAAGaaaaagaagtcgttgcagaGGACGAACAGAAATTCTTGGAAGCG
CAAATgGCGATCCTAAGCAAAGAACCAGCACCTTCTTCATCCGCTCAAAG
AGGTCCACCATCGCAGGACGCCAGAGCTTCCGCCCGAATGCAGGGCCATT
CTCCAGGACAACGAGCAACCGGCCTCCCCCGACCAGCAGCCATGCCCAAC
ATGAAGGGAAAGCCTGACCCAACAAAAGGTGGTGCTGCTGGACAAAATTC
ATCAGAGACGGTCCTCGCCAATTTCTTCAACAGCTTATTGAATAAAAACT
CAACCGGAAAGCCAGGTGGTCCGCCCGGCAAAGGTGCCCCTCCAGCGAGC
GGTGCAGCAAATCGAAGCGACGTTCAAGCAGAACTAGAGAAGATGTCaag
aaaaaccatcaaaaaagaagaaaaatgaATGGCGGACCGACTAAGGGATG
AACTCAATGATTCTaaagaagaggaagaagaaaaCTTTTGGAAGCAAATT
TTACGAGAAGTATCAGCAAAATCATCTAGAAGATTTCCTTCTTGCAAAAG
AATCTTGGTGTTAGGGAACGATGGAACAGGTAAAACAAGTCTGGTCATGA
AATTGAGGAGGTCTGGGGACGATTTATTGCGTGGTTCAGGATTGGAATAT
ACCTACCTTGATGTGGATGACGAAGAACGAGATGaacACACCAGGCTCAG
TGTTTGGATACAATCAGGAGAAGCACACATCAAGGACCTCATGAAATATG
TCATCACCAAGGAATCTATACACCATTCTCTCATCTTATTATGCATTGAT
ATCTCGAAACCATGGAACATGCTTGACCAACTGGAAAACCATGTCAATAT
TTTACGTCAGCACTTACACACTTTAAATATTTCGGCAAAAATTTTAAACG
AACTCGAAAAACAAGTTCTTCGAGATTTTCACATGTACAAATACAATGAC
GAGGAAAACAAACGGTTGAGTTCCAACATGGAGCAAGACGAACAAGAGAT
GAACCAACTAGCAGAAAATATGATCGTTGATAATATTGGTCTCCCTATCG
TCGTTGCTGTCACTAAGACGGACAACATGTCTTCCCTCGAACAAGAACAC
GACTACCGTGAAGAACATTTCgatttcatccaaaaaaatCTACGAAAATT
CTGCCTCAAATGCGGGGCATCATTAATATATACTTCGACCAAAGAGAATT
GCAACACATCCGTTTTATATAAATATCTACTACATCGATTATACAACTTC
CCCTTAAAAGATCCAGCACAAATCGTAGAGAAAGATGCCATTTATATtCC
TGCAGGATGGGACAATCAGAGCAAAATCAACATTCTAGACGAGCACATCA
AAACTTTCGACGCAAACGAAACATTCAAAGATAGAATCGTCAAACCCGTC
ACACGAAAGtACGTCAACCAAGaaaaagaagtcgttgcagaGGACGAACA
GAAATTCTTGGAAGCGCAAATgGCGATCCTAAGCAAAGAACCAGCACCTT
CTTCATCCGCTCAAAGAGGTCCACCATCGCAGGACGCCAGAGCTTCCGCC
CGAATGCAGGGCCATTCTCCAGGACAACGAGCAACCGGCCTCCCCCGACC
AGCAGCCATGCCCAACATGAAGGGAAAGCCTGACCCAACAAAAGGTGGTG
CTGCTGGACAAAATTCATCAGAGACGGTCCTCGCCAATTTCTTCAACAGC
TTATTGAATAAAAACTCAACCGGAAAGCCAGGTGGTCCGCCCGGCAAAGG
TGCCCCTCCAGCGAGCGGTGCAGCAAATCGAAGCGACGTTCAAGCAGAAC
TAGAGAAGATGTCaagaaaaaccatcaaaaaagaagaaaaatgaATGGCG
GACCGACTAAGGGATGAACTCAATGATTCTaaagaagaggaagaagaaaa
CTTTTGGAAGCAAATTTTACGAGAAGTATCAGCAAAATCATCTAGAAGAT
TTCCTTCTTGCAAAAGAATCTTGGTGTTAGGGAACGATGGAACAGGTAAA
ACAAGTCTGGTCATGAAATTGAGGAGGTCTGGGGACGATTTATTGCGTGG
TTCAGGATTGGAATATACCTACCTTGATGTGGATGACGAAGAACGAGATG
aacACACCAGGCTCAGTGTTTGGATACAATCAGGAGAAGCACACATCAAG
GACCTCATGAAATATGTCATCACCAAGGAATCTATACACCATTCTCTCAT
CTTATTATGCATTGATATCTCGAAACCATGGAACATGCTTGACCAACTGG
AAAACCATGTCAATATTTTACGTCAGCACTTACACACTTTAAATATTTCG
GCAAAAATTTTAAACGAACTCGAAAAACAAGTTCTTCGAGATTTTCACAT
GTACAAATACAATGACGAGGAAAACAAACGGTTGAGTTCCAACATGGAGC
AAGACGAACAAGAGATGAACCAACTAGCAGAAAATATGATCGTTGATAAT
ATTGGTCTCCCTATCGTCGTTGCTGTCACTAAGACGGACAACATGTCTTC
CCTCGAACAAGAACACGACTACCGTGAAGAACATTTCgatttcatccaaa
aaaatCTACGAAAATTCTGCCTCAAATGCGGGGCATCATTAATATATACT
TCGACCAAAGAGAATTGCAACACATCCGTTTTATATAAATATCTACTACA
TCGATTATACAACTTCCCCTTAAAAGATCCAGCACAAATCGTAGAGAAAG
ATGCCATTTATATtCCTGCAGGATGGGACAATCAGAGCAAAATCAACATT
CTAGACGAGCACATCAAAACTTTCGACGCAAACGAAACATTCAAAGATAG
AATCGTCAAACCCGTCACACGAAAGtACGTCAACCAAGaaaaagaagtcg
ttgcagaGGACGAACAGAAATTCTTGGAAGCGCAAATgGCGATCCTAAGC
AAAGAACCAGCACCTTCTTCATCCGCTCAAAGAGGTCCACCATCGCAGGA
CGCCAGAGCTTCCGCCCGAATGCAGGGCCATTCTCCAGGACAACGAGCAA
CCGGCCTCCCCCGACCAGCAGCCATGCCCAACATGAAGGGAAAGCCTGAC
CCAACAAAAGGTGGTGCTGCTGGACAAAATTCATCAGAGACGGTCCTCGC
CAATTTCTTCAACAGCTTATTGAATAAAAACTCAACCGGAAAGCCAGGTG
GTCCGCCCGGCAAAGGTGCCCCTCCAGCGAGCGGTGCAGCAAATCGAAGC
GACGTTCAAGCAGAACTAGAGAAGATGTCaagaaaaaccatcaaaaaaga
agaaaaatgaATGGCGGACCGACTAAGGGATGAACTCAATGATTCTaaag
aagaggaagaagaaaaCTTTTGGAAGCAAATTTTACGAGAAGTATCAGCA
AAATCATCTAGAAGATTTCCTTCTTGCAAAAGAATCTTGGTGTTAGGGAA
CGATGGAACAGGTAAAACAAGTCTGGTCATGAAATTGAGGAGGTCTGGGG
ACGATTTATTGCGTGGTTCAGGATTGGAATATACCTACCTTGATGTGGAT
GACGAAGAACGAGATGaacACACCAGGCTCAGTGTTTGGATACAATCAGG
AGAAGCACACATCAAGGACCTCATGAAATATGTCATCACCAAGGAATCTA
TACACCATTCTCTCATCTTATTATGCATTGATATCTCGAAACCATGGAAC
ATGCTTGACCAACTGGAAAACCATGTCAATATTTTACGTCAGCACTTACA
CACTTTAAATATTTCGGCAAAAATTTTAAACGAACTCGAAAAACAAGTTC
TTCGAGATTTTCACATGTACAAATACAATGACGAGGAAAACAAACGGTTG
AGTTCCAACATGGAGCAAGACGAACAAGAGATGAACCAACTAGCAGAAAA
TATGATCGTTGATAATATTGGTCTCCCTATCGTCGTTGCTGTCACTAAGA
CGGACAACATGTCTTCCCTCGAACAAGAACACGACTACCGTGAAGAACAT
TTCgatttcatccaaaaaaatCTACGAAAATTCTGCCTCAAATGCGGGGC
ATCATTAATATATACTTCGACCAAAGAGAATTGCAACACATCCGTTTTAT
ATAAATATCTACTACATCGATTATACAACTTCCCCTTAAAAGATCCAGCA
CAAATCGTAGAGAAAGATGCCATTTATATtCCTGCAGGATGGGACAATCA
GAGCAAAATCAACATTCTAGACGAGCACATCAAAACTTTCGACGCAAACG
AAACATTCAAAGATAGAATCGTCAAACCCGTCACACGAAAGtACGTCAAC
CAAGaaaaagaagtcgttgcagaGGACGAACAGAAATTCTTGGAAGCGCA
AATgGCGATCCTAAGCAAAGAACCAGCACCTTCTTCATCCGCTCAAAGAG
GTCCACCATCGCAGGACGCCAGAGCTTCCGCCCGAATGCAGGGCCATTCT
CCAGGACAACGAGCAACCGGCCTCCCCCGACCAGCAGCCATGCCCAACAT
GAAGGGAAAGCCTGACCCAACAAAAGGTGGTGCTGCTGGACAAAATTCAT
CAGAGACGGTCCTCGCCAATTTCTTCAACAGCTTATTGAATAAAAACTCA
ACCGGAAAGCCAGGTGGTCCGCCCGGCAAAGGTGCCCCTCCAGCGAGCGG
TGCAGCAAATCGAAGCGACGTTCAAGCAGAACTAGAGAAGATGTCaagaa
aaaccatcaaaaaagaagaaaaatgaATGGCGGACCGACTAAGGGATGAA
CTCAATGATTCTaaagaagaggaagaagaaaaCTTTTGGAAGCAAATTTT
ACGAGAAGTATCAGCAAAATCATCTAGAAGATTTCCTTCTTGCAAAAGAA
TCTTGGTGTTAGGGAACGATGGAACAGGTAAAACAAGTCTGGTCATGAAA
TTGAGGAGGTCTGGGGACGATTTATTGCGTGGTTCAGGATTGGAATATAC
CTACCTTGATGTGGATGACGAAGAACGAGATGaacACACCAGGCTCAGTG
TTTGGATACAATCAGGAGAAGCACACATCAAGGACCTCATGAAATATGTC
ATCACCAAGGAATCTATACACCATTCTCTCATCTTATTATGCATTGATAT
CTCGAAACCATGGAACATGCTTGACCAACTGGAAAACCATGTCAATATTT
TACGTCAGCACTTACACACTTTAAATATTTCGGCAAAAATTTTAAACGAA
CTCGAAAAACAAGTTCTTCGAGATTTTCACATGTACAAATACAATGACGA
GGAAAACAAACGGTTGAGTTCCAACATGGAGCAAGACGAACAAGAGATGA
ACCAACTAGCAGAAAATATGATCGTTGATAATATTGGTCTCCCTATCGTC
GTTGCTGTCACTAAGACGGACAACATGTCTTCCCTCGAACAAGAACACGA
CTACCGTGAAGAACATTTCgatttcatccaaaaaaatCTACGAAAATTCT
GCCTCAAATGCGGGGCATCATTAATATATACTTCGACCAAAGAGAATTGC
AACACATCCGTTTTATATAAATATCTACTACATCGATTATACAACTTCCC
CTTAAAAGATCCAGCACAAATCGTAGAGAAAGATGCCATTTATATtCCTG
CAGGATGGGACAATCAGAGCAAAATCAACATTCTAGACGAGCACATCAAA
ACTTTCGACGCAAACGAAACATTCAAAGATAGAATCGTCAAACCCGTCAC
ACGAAAGtACGTCAACCAAGaaaaagaagtcgttgcagaGGACGAACAGA
AATTCTTGGAAGCGCAAATgGCGATCCTAAGCAAAGAACCAGCACCTTCT
TCATCCGCTCAAAGAGGTCCACCATCGCAGGACGCCAGAGCTTCCGCCCG
AATGCAGGGCCATTCTCCAGGACAACGAGCAACCGGCCTCCCCCGACCAG
CAGCCATGCCCAACATGAAGGGAAAGCCTGACCCAACAAAAGGTGGTGCT
GCTGGACAAAATTCATCAGAGACGGTCCTCGCCAATTTCTTCAACAGCTT
ATTGAATAAAAACTCAACCGGAAAGCCAGGTGGTCCGCCCGGCAAAGGTG
CCCCTCCAGCGAGCGGTGCAGCAAATCGAAGCGACGTTCAAGCAGAACTA
GAGAAGATGTCaagaaaaaccatcaaaaaagaagaaaaatgaATGGCGGA
CCGACTAAGGGATGAACTCAATGATTCTaaagaagaggaagaagaaaaCT
TTTGGAAGCAAATTTTACGAGAAGTATCAGCAAAATCATCTAGAAGATTT
CCTTCTTGCAAAAGAATCTTGGTGTTAGGGAACGATGGAACAGGTAAAAC
AAGTCTGGTCATGAAATTGAGGAGGTCTGGGGACGATTTATTGCGTGGTT
CAGGATTGGAATATACCTACCTTGATGTGGATGACGAAGAACGAGATGaa
cACACCAGGCTCAGTGTTTGGATACAATCAGGAGAAGCACACATCAAGGA
CCTCATGAAATATGTCATCACCAAGGAATCTATACACCATTCTCTCATCT
TATTATGCATTGATATCTCGAAACCATGGAACATGCTTGACCAACTGGAA
AACCATGTCAATATTTTACGTCAGCACTTACACACTTTAAATATTTCGGC
AAAAATTTTAAACGAACTCGAAAAACAAGTTCTTCGAGATTTTCACATGT
ACAAATACAATGACGAGGAAAACAAACGGTTGAGTTCCAACATGGAGCAA
GACGAACAAGAGATGAACCAACTAGCAGAAAATATGATCGTTGATAATAT
TGGTCTCCCTATCGTCGTTGCTGTCACTAAGACGGACAACATGTCTTCCC
TCGAACAAGAACACGACTACCGTGAAGAACATTTCgatttcatccaaaaa
aatCTACGAAAATTCTGCCTCAAATGCGGGGCATCATTAATATATACTTC
GACCAAAGAGAATTGCAACACATCCGTTTTATATAAATATCTACTACATC
GATTATACAACTTCCCCTTAAAAGATCCAGCACAAATCGTAGAGAAAGAT
GCCATTTATATtCCTGCAGGATGGGACAATCAGAGCAAAATCAACATTCT
AGACGAGCACATCAAAACTTTCGACGCAAACGAAACATTCAAAGATAGAA
TCGTCAAACCCGTCACACGAAAGtACGTCAACCAAGaaaaagaagtcgtt
gcagaGGACGAACAGAAATTCTTGGAAGCGCAAATgGCGATCCTAAGCAA
AGAACCAGCACCTTCTTCATCCGCTCAAAGAGGTCCACCATCGCAGGACG
CCAGAGCTTCCGCCCGAATGCAGGGCCATTCTCCAGGACAACGAGCAACC
GGCCTCCCCCGACCAGCAGCCATGCCCAACATGAAGGGAAAGCCTGACCC
AACAAAAGGTGGTGCTGCTGGACAAAATTCATCAGAGACGGTCCTCGCCA
ATTTCTTCAACAGCTTATTGAATAAAAACTCAACCGGAAAGCCAGGTGGT
CCGCCCGGCAAAGGTGCCCCTCCAGCGAGCGGTGCAGCAAATCGAAGCGA
CGTTCAAGCAGAACTAGAGAAGATGTCaagaaaaaccatcaaaaaagaag
aaaaatga
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_001083XLOC_001083Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00002059-exon-sc0000018-1491911889:698064..698430TCONS_00002059-exon-sc0000018-1491911889:698064..698430Clytia hemisphaericaexon
TCONS_00002059-exon-sc0000018-1510915933:698064..698430TCONS_00002059-exon-sc0000018-1510915933:698064..698430Clytia hemisphaericaexon
TCONS_00002059-exon-sc0000018-1575043694:698064..698430TCONS_00002059-exon-sc0000018-1575043694:698064..698430Clytia hemisphaericaexon
TCONS_00002059-exon-sc0000018-1491911889:706469..706542TCONS_00002059-exon-sc0000018-1491911889:706469..706542Clytia hemisphaericaexon
TCONS_00002059-exon-sc0000018-1510915933:706469..706542TCONS_00002059-exon-sc0000018-1510915933:706469..706542Clytia hemisphaericaexon
TCONS_00002059-exon-sc0000018-1575043694:706469..706542TCONS_00002059-exon-sc0000018-1575043694:706469..706542Clytia hemisphaericaexon
TCONS_00002059-exon-sc0000018-1491911889:706804..706923TCONS_00002059-exon-sc0000018-1491911889:706804..706923Clytia hemisphaericaexon
TCONS_00002059-exon-sc0000018-1510915933:706804..706923TCONS_00002059-exon-sc0000018-1510915933:706804..706923Clytia hemisphaericaexon
TCONS_00002059-exon-sc0000018-1575043694:706804..706923TCONS_00002059-exon-sc0000018-1575043694:706804..706923Clytia hemisphaericaexon
TCONS_00002059-exon-sc0000018-1491911889:707940..708170TCONS_00002059-exon-sc0000018-1491911889:707940..708170Clytia hemisphaericaexon
TCONS_00002059-exon-sc0000018-1510915933:707940..708170TCONS_00002059-exon-sc0000018-1510915933:707940..708170Clytia hemisphaericaexon
TCONS_00002059-exon-sc0000018-1575043694:707940..708170TCONS_00002059-exon-sc0000018-1575043694:707940..708170Clytia hemisphaericaexon
TCONS_00002059-exon-sc0000018-1491911889:711312..711463TCONS_00002059-exon-sc0000018-1491911889:711312..711463Clytia hemisphaericaexon
TCONS_00002059-exon-sc0000018-1510915933:711312..711463TCONS_00002059-exon-sc0000018-1510915933:711312..711463Clytia hemisphaericaexon
TCONS_00002059-exon-sc0000018-1575043694:711312..711463TCONS_00002059-exon-sc0000018-1575043694:711312..711463Clytia hemisphaericaexon
TCONS_00002059-exon-sc0000018-1491911889:712057..712150TCONS_00002059-exon-sc0000018-1491911889:712057..712150Clytia hemisphaericaexon
TCONS_00002059-exon-sc0000018-1510915933:712057..712150TCONS_00002059-exon-sc0000018-1510915933:712057..712150Clytia hemisphaericaexon
TCONS_00002059-exon-sc0000018-1575043694:712057..712150TCONS_00002059-exon-sc0000018-1575043694:712057..712150Clytia hemisphaericaexon
TCONS_00002059-exon-sc0000018-1491911889:712326..712461TCONS_00002059-exon-sc0000018-1491911889:712326..712461Clytia hemisphaericaexon
TCONS_00002059-exon-sc0000018-1510915933:712326..712461TCONS_00002059-exon-sc0000018-1510915933:712326..712461Clytia hemisphaericaexon
TCONS_00002059-exon-sc0000018-1575043694:712326..712461TCONS_00002059-exon-sc0000018-1575043694:712326..712461Clytia hemisphaericaexon
TCONS_00002059-exon-sc0000018-1491911889:712629..712677TCONS_00002059-exon-sc0000018-1491911889:712629..712677Clytia hemisphaericaexon
TCONS_00002059-exon-sc0000018-1510915933:712629..712677TCONS_00002059-exon-sc0000018-1510915933:712629..712677Clytia hemisphaericaexon
TCONS_00002059-exon-sc0000018-1575043694:712629..712677TCONS_00002059-exon-sc0000018-1575043694:712629..712677Clytia hemisphaericaexon
TCONS_00002059-exon-sc0000018-1491911889:713657..713719TCONS_00002059-exon-sc0000018-1491911889:713657..713719Clytia hemisphaericaexon
TCONS_00002059-exon-sc0000018-1510915933:713657..713719TCONS_00002059-exon-sc0000018-1510915933:713657..713719Clytia hemisphaericaexon
TCONS_00002059-exon-sc0000018-1575043694:713657..713719TCONS_00002059-exon-sc0000018-1575043694:713657..713719Clytia hemisphaericaexon
TCONS_00002059-exon-sc0000018-1491911889:714084..714146TCONS_00002059-exon-sc0000018-1491911889:714084..714146Clytia hemisphaericaexon
TCONS_00002059-exon-sc0000018-1510915933:714084..714146TCONS_00002059-exon-sc0000018-1510915933:714084..714146Clytia hemisphaericaexon
TCONS_00002059-exon-sc0000018-1575043694:714084..714146TCONS_00002059-exon-sc0000018-1575043694:714084..714146Clytia hemisphaericaexon
TCONS_00002059-exon-sc0000018-1491911889:720107..720166TCONS_00002059-exon-sc0000018-1491911889:720107..720166Clytia hemisphaericaexon
TCONS_00002059-exon-sc0000018-1510915933:720107..720166TCONS_00002059-exon-sc0000018-1510915933:720107..720166Clytia hemisphaericaexon
TCONS_00002059-exon-sc0000018-1575043694:720107..720166TCONS_00002059-exon-sc0000018-1575043694:720107..720166Clytia hemisphaericaexon
TCONS_00002059-exon-sc0000018-1491911889:720330..720425TCONS_00002059-exon-sc0000018-1491911889:720330..720425Clytia hemisphaericaexon
TCONS_00002059-exon-sc0000018-1510915933:720330..720425TCONS_00002059-exon-sc0000018-1510915933:720330..720425Clytia hemisphaericaexon
TCONS_00002059-exon-sc0000018-1575043694:720330..720425TCONS_00002059-exon-sc0000018-1575043694:720330..720425Clytia hemisphaericaexon
TCONS_00002059-exon-sc0000018-1491911889:721070..722166TCONS_00002059-exon-sc0000018-1491911889:721070..722166Clytia hemisphaericaexon
TCONS_00002059-exon-sc0000018-1510915933:721070..722166TCONS_00002059-exon-sc0000018-1510915933:721070..722166Clytia hemisphaericaexon
TCONS_00002059-exon-sc0000018-1575043694:721070..722166TCONS_00002059-exon-sc0000018-1575043694:721070..722166Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00002059-proteinTCONS_00002059-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000018supercontigsc0000018:698064..722166 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
39.5667 40.3045 24.2575 13.663 23.8043 17.9006 25.1762 25.3832 15.0614 25.1888 15.044 13.8799 9.54119 8.99224 11.6344 12.9587 15.4337 13.1782 7.52042 12.9159 1.0203 10.2721 14.4432 26.9496 11.4493 12.1402 13.5215 17.7116 22.0741 22.8976
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR022780Dynein_light_int_chain
IPR027417P-loop_NTPase
Blast
BLAST of TCONS_00002059 vs. Swiss-Prot (Human)
Match: DC1L2 (Cytoplasmic dynein 1 light intermediate chain 2 OS=Homo sapiens GN=DYNC1LI2 PE=1 SV=1)

HSP 1 Score: 351.673 bits (901), Expect = 1.381e-110
Identity = 190/457 (41.58%), Postives = 281/457 (61.49%), Query Frame = 3
Query:  360 NFWKQILREVSAKSSRRFPSCKRILVLGNDGTGKTSLVMKLRRSGDDLLRGSGLEYTYLDVDDEERDEHTRLSVWIQSGEAHIKDLMKYVITKESIHHSLILLCIDISKPWNMLDQLENHVNILRQHLHTLNISAKILNELEKQVLRDFHMYKYNDE-----ENKRLSSNMEQDEQEMN-QLAENMIVDNIGLPIVVAVTKTDNMSSLEQEHDYREEHFDFIQKNLRKFCLKCGASLIYTSTKENCNTSVLYKYLLHRLYNFPLKDPAQIVEKDAIYIPAGWDNQSKINILDEHIKTFDANETFKDRIVKPVTRKYVNQEKEVVAEDEQKFLEAQMAILSKEPAPSSSAQRGPPSQDARASARMQGHSPGQRATGLPRPAAMPNMK-GKPDP-TKGGAAGQNSSETVLANFFNSLLNKNSTXXXXXXXXXXXXXXXXXXNR---SDVQAELEKMSRK 1697
            + W  IL EVS ++  + PS K ILV G DG+GKT+L+ KL+   +   +G GLEY YL V DE+RD+HTR +VWI  G+ + K L+K+ ++ ES+  +L++   D+S+PW +++ L+   ++LR+H+  + I  + + ELE++ ++DF  Y   +E       +R       DE+ +   L +N++  N+G+P++V  TK D +S LE+EHDYR+EH DFIQ +LR+FCL+ GA+LIYTS KE  N  +LYKY++H+ Y F    PA +VEKDA++IPAGWDN+ KI IL E+  T    + ++D IVKP  RK V+ +KE+ AEDEQ FL  Q ++L+K+PA  + A    P++    S R QG     R      P++ P     KPDP  K  AA    SE VLA+FFNSLL+K +        G     A  +  +   S+VQ EL++M+RK
Sbjct:   34 SLWSSILSEVSTRARSKLPSGKNILVFGEDGSGKTTLMTKLQ-GAEHGKKGRGLEYLYLSVHDEDRDDHTRCNVWILDGDLYHKGLLKFAVSAESLPETLVIFVADMSRPWTVMESLQKWASVLREHIDKMKIPPEKMRELERKFVKDFQDYMEPEEGCQGSPQRRGPLTSGSDEENVALPLGDNVLTHNLGIPVLVVCTKCDAVSVLEKEHDYRDEHLDFIQSHLRRFCLQYGAALIYTSVKEEKNLDLLYKYIVHKTYGFHFTTPALVVEKDAVFIPAGWDNEKKIAILHENFTTVKPEDAYEDFIVKPPVRKLVH-DKELAAEDEQVFLMKQQSLLAKQPATPTRASES-PARGPSGSPRTQG-----RGGPASVPSSSPGTSVKKPDPNIKNNAA----SEGVLASFFNSLLSKKTGSPGSPGAGGVQSTAKKSGQKTVLSNVQEELDRMTRK 478          
The following BLAST results are available for this feature:
BLAST of TCONS_00002059 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
DC1L21.381e-11041.58Cytoplasmic dynein 1 light intermediate chain 2 OS... [more]
back to top