Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00002056 (transcript) - C. hemisphaerica

Overview
NameTCONS_00002056
Unique NameTCONS_00002056
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2863

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00002056 ID=TCONS_00002056|Name=TCONS_00002056|organism=Clytia hemisphaerica|type=transcript|length=2863bp
ATTCGGAAGCCGTAAAAAATTCTTACACCAACTCGCGGGCCGCCATTTTC
TTTTCTGCATAAGGCAAACAGTGAAGATCACTGTTTTTTGTCATGTGACG
TATTTGTCGTGGGGACGTACCATTACGACCACGGATTTCACATCCAGAGT
GAAGTGCTTCTTAATTCAAAGGCGTGTTTGGTTTTAGAGAATTAGCACAT
ACTGGACAGGACATTCGAAAAGGAAGCCGCGTGCGAACGTCTGGTCTGGA
ACAGTTTGGAACGTGATCTTTcatcttcaaaaacaaagaggTATAAAGTC
AAGTTGGTAATAAAATGACTGAAATAAACGAGCCAAATGAGTCTCGAATT
CAAGAAGAGACTGTCAGTTCCTTATCTGAAGATGTTGATTTAAAATCCCA
AAAAACAGtagatgaaaatcaaaatggggaAAGTGGCACAGACGATCAAA
AAGAGGCAGCTTCTGATGAAACTGTGAAAGTTGAAACAAGTGAGAATGGA
GGCGAGACTCAAAGCAATGGCCTTGACCATAAAGACGGAGAAGATGAAGA
AGCAAAGGCTGTTAGTTCTACTGACggagaaaaaatgaaacaaaacgaAA
ATCCTGAGGCTGGAGAggagaagaagaaagaagaaaatcaggCTATCAAG
AAGAAGgATGAGTCGTTGGGATCAGCAGTTGCTAAGCATTACAATGAAAT
TCCTGCTGGTAGTAGAGAAACCAGGAAAGACAGTCGAATTTTCCATTTAC
GAAATTTTAACAATTGGATAAAAAGTGTGATTATCAATGAATATCTTGAC
AAAATCAAAAGACGAAAGCGCACTTCAGATGATATCAATGTGTTAGACTT
GGGATGTGGAAAAGGCGGCGATTTACTGAAATGGGATAAAGGACGTGTTG
ACCATGTTATTATGGCAGACATTGCTGCTACTTCAGTGGACCAATGTAAA
GAACGATATAGCAAACTGGAGCGTGATCGCCGAAGAGGATCTCATTCGCG
TGTCTTCTCAACTGAATTCTTTGCCGCTGATTGCACCAAGGAAGTGATAT
CAGAGAAATATAAGAAGAAGGAAATCAAACTAGACCTGACAAGTTGTCAA
TTCGCTTTCCACTATTCCTTTGAAAGTTATGATCAAGCCGACATTATGTT
GCGAAATGCTTGCCAAAACCTTCGAGTCGGAGGTTACTTCATTGGCACAA
CTGCCGACTCCAACAAACTAGTTAAGCGAATCAAAGAATGCAAAGAGGCC
GATTCTTTCGGAAACTCAGTTTTCAACATCAAGTCGAACCACCGAGACAA
CTTCCCATTGTTTGGATCCAAATACACTTTCTTCCTTGAAGGCGTTGTTG
ATTGTCCAGAATTTTTGGTGCACTTCCCAACAATGGAGGCCTTGGCAGCC
AAGTACAACATGAAGTTGGTTTGGAAGAAGAATTTCcatgaaattttcaa
agaacatGAACGCCAACATTCCACCCTCTTGAACAAAATGAACGCCCTCG
AGACGTACCCTGCACCTGCGAACAAGACTCTCTTGGGAGGAAGCGAATCG
CAATACAAATCAGCTTGTGATTACTTGGAAAGGAAGAGCTGCAGTCAGGT
GGGCACCTTATCAGCAGACGAGTGGGAAGTGGCTGGGCTTTATGTGGCTT
TCGCTTTTGAGAAAATGGAAGAGAAATCGGCATCGACGAGCCATGACAGC
AGGAAGAGAGGTCGCGATCATAGCTCCGATAAACGACGATCGGTGTCCTC
CAGCAGCAGTAAACGATCACGAAAaggtttttctcatttttacttGCAAT
TCTCtcttgttttttggacctaccccggtggggtggaggtcctataaatt
aacccgtgttcgttagttaattagttcgttcgttagttaccaacttttct
cgagattggctcattcaatttttctgattttttgcacaaaggtgcattac
tataaattctcgaatgtgacggagcccgattttcgaaaaaaatttttccg
gccggtagaaccggaaatgtcccgaaaaaagcggttttttgagattttct
cgagattttatcattagttttttgcgattttatgcacatagatgcacatt
agtactgccgaaaaggtgtcgaaaaacgtttgccgaaaaaattttttttc
cggtagaaccggaaatgtcccgaaaaaagcggttttttgagattttctcg
agattttatcattagttttttgcgattttttgcacatagatgcacattag
tactgccgaaaaggtgtcgaaaaacgtttgccgaaaaaattttttttccg
gtagaaccggaaatgtgccggaaatcgtcgttttttcacatttccgtcac
attttttcaacttatttaattgtttctttacagaaaaatgttctttatga
tgatgcccaaaacttagcatcgtttgatttccaaaaaaatcatcctttga
atccggaactccttaaaaatcgccggaacggccgaaaaccggcgtaaaac
ggtcttccttcattttttcaacttatactcgacagattttcatgattttt
tgcacaatgatgtaaaatggcaatgcccaaaatgtgacagagcccaattt
tcgaaaaagaaatttttccggccgctagaaccggaaatgtcccgaaaaaa
gccgttttttgagattttctagagattttctcattagttttttgcgattt
tttgcacatagatgcacattagtactgccgaaaaggtgatGTATATTATG
ATTGAGTTTGTGTGTATAGTTTGTTTTTGACTACCCCCTCCCCCATCCTC
CACCCCGACACTCCTCAATCTGtgatgaaataatgaaaactgaaaactaa
atgttttttttac
Run BLAST on NCBI

protein sequence of TCONS_00002056-protein

>TCONS_00002056-protein ID=TCONS_00002056-protein|Name=TCONS_00002056-protein|organism=Clytia hemisphaerica|type=polypeptide|length=510bp
MTEINEPNESRIQEETVSSLSEDVDLKSQKTVDENQNGESGTDDQKEAAS
DETVKVETSENGGETQSNGLDHKDGEDEEAKAVSSTDGEKMKQNENPEAG
EEKKKEENQAIKKKDESLGSAVAKHYNEIPAGSRETRKDSRIFHLRNFNN
WIKSVIINEYLDKIKRRKRTSDDINVLDLGCGKGGDLLKWDKGRVDHVIM
ADIAATSVDQCKERYSKLERDRRRGSHSRVFSTEFFAADCTKEVISEKYK
KKEIKLDLTSCQFAFHYSFESYDQADIMLRNACQNLRVGGYFIGTTADSN
KLVKRIKECKEADSFGNSVFNIKSNHRDNFPLFGSKYTFFLEGVVDCPEF
LVHFPTMEALAAKYNMKLVWKKNFHEIFKEHERQHSTLLNKMNALETYPA
PANKTLLGGSESQYKSACDYLERKSCSQVGTLSADEWEVAGLYVAFAFEK
MEEKSASTSHDSRKRGRDHSSDKRRSVSSSSSKRSRKGFSHFYLQFSLVF
WTYPGGVEVL
Run BLAST on NCBI

transcript from alignment at sc0000018:680602..693507+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00002056 ID=TCONS_00002056|Name=TCONS_00002056|organism=Clytia hemisphaerica|type=transcript|length=12906bp|location=Sequence derived from alignment at sc0000018:680602..693507+ (Clytia hemisphaerica)
ATTCGGAAGCCGTAAAAAATTCTTACACCAACTCGCGGGCCGCCATTTTC TTTTCTGCATAAGGCAAACAGTGAAGATCACTGTTTTTTGTCATGTGACG TATTTGTCGTGGGGACGTACCATTACGACCACGGATTTCACATCCAGAGT GAAGTGCTTCTTAATTCAAAGGCGTGTTTGGTTTTAGAGAATTAGCACAT ACTGGACAGGACATTCGAAAAGGAAGCCGCGTGCGAACGTCTGGTCTGGA ACAGTTTGGAACGTGATCTTTcatcttcaaaaacaaagaggTATAAAGTC AAGTTGGTAATAAAATGACTGAAATAAACGAGCCAAATGAGTCTCGAATT CAAGAAGAGACTGTCAGTTCCTTATCTGAAGATGTTGATTTAAAATCCCA AAAAACAGtagatgaaaatcaaaatggggaAAGTGGCACAGACGATCAAA AAGAGGCAGCTTCTGATGAAACTGTGAAAGGTAAACAAATATATTGTACT AGAAAAGATAAATCTGGAAAAAGAGAGTTTAGACCAATCTACTGTTTGTG GGAGAATGTGTGGAGTGAGACCTTTCCAGAAAAAGCCCCTGTTTGTCCCA CCCACCAAGGCAAGTGTTCCTTCTCATCCTGCCAGACAGATATATATGCA AATTGACCTTCTGTCCCACTGTACTTGTACGTCCTCTTTGTGTCCCACCT GTTCAAAAATTAATTGGAATTATGCTCAAAGTCAtgaaaaagtgacaaaa tacAACCAATAGACCATTTTGCCACATTTGGCTAaagcttcagatgcatc cggctggacttagaatttttttcaagttgaataGTGACCAAAGGGGGTTT TGAACCGGGAACCTATAGGTTTCGGAACCAATGCCCTATCCACTAGGCCA AACCGGCTGCCGAAATGTTGTTATTTAGGGTTACTTATACGAAAGTCTTA GTACTATATAAAAATAAGTCtgactgacgagttaggctaactgttatgat cGCCATTACTCCGAAGAAGCCACCACACGTGTGCACCGCCGGGTGGGTGC ACCGCCGGCCGGGTGAGGGGTTAGGGATGTGCACCAGGGTGGCTTCGCCA CCCTGGTGCAAATCCCTAACCCTATGCTACGCGCTACGCGCGTCGCGTGG TATACGCGCGCCTCCGTGCGGTATATGCGCGCCTCCGCGCGGTATATGCG CGCGTCCCGCGCggccggatgcatctgaagcatTAGCCGAATCTAttttg cctttccatccgccatattgaattgtatgcaaaaattatggtggccgaat tgccgtggtgaaattcccttagaaagtatgcaaaacatatgcaaaaagaa agtattaatataaaacttacatgcataattgccATTATATTAaggtgtaa tcttgtagaagaaagattaaatttgcttctcttgaaaacttaaaaataat tatattcgctcatctcttggaacaagcacttcaaaaatccataacattat acataaactcaaactgaaaaatcaccagcgaagataaaaaataatcctta ttcggctgacggtaaattattctcctgggaatagagccgccaaatgatca aatcaaaacaatgataatgtgtgacgtcatgATTACTGCTTTTAAGTTtg catgttttgaaagtttgatgtgagtactccgtcttcgtggaatttcttaa tggcatgaaaacagaacatgctatgtctttaagaacaaatttctaaaaga ctattgttgttctgtaaatatttttttttggattaagaaattccatcttt tattgttctaatgattataatattttttaataagatgctttgttgtcttt ttaatctttgtgtaaacttgcatatgttttgcatactttccaactaaatc caaccacggctttttcgttcctctattttNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNGgtctatgcatgttagcctccactgatgcaagttacctgacttcatg GTACAACTCAATATTTggagaatttttattttgtgtcaaaaaatgtaaaa aagatgATGATAGTgagcaaaatcaaaatgttttctctatgatgtttgaa aataaattcaattcaatgcaattctttttattttcacaaATACAATGCTT AAAATCCTTGAAAATAAACCCTTCATAAGTACCACCTACCCacccaaaac ttttaaaattcctAAGTCAGAAAATGGTCTGTGACCAAAGTGCTTGGAAT ATCGCCTGCCAGTATATATGCGGCattatcgtaaagctagaatcgcttga CGTgtgttctcggctcaatcctcggactgcgcacaaaatggtagacttaa CTTTGACagtagatctgacatattgtaCAGAGCACTTtgtagttttgatt cccattgaagaatcatattgtggttttcattttattagatgctgttttag agctttagagctgcCTGCACTCTCTTTCATTAATGTCACTGTGGCAATAA AACTTAAATCTTAAGATATTCAACCCTTTGTTGGCTTTGTTGCTGTATGT AGATATTCCATCACTGTTTCATCAACCATTTTTATTTTGGCTATGGCTTG CATCTAGTGCAGCCGCCAAGCAAAGAGAACCCGAGACATAAACATcaggc cgtttgttttggttttcaaaacagttgaagcaataaaaaagaaacaaggT ATATCGGGTGTGCCAAAAAAAATAggcctaaaattgaaactttgacgtaa cttttttcagttagattagaaacttgaaattttacatgcGTCTTAAGAGC AGATGCACCTAAGAATCAGAAAAAGTGGGATCATGGGGGTCTTCAaatct ttctgaaattttgacacAAGGTCACATATCTTGGGTTGATCacacacaaa aaatttcagctCTCTAGCAACAGCGGTTGGTAAGTTATGCCCAATTTACG Aaaatgtaatttacagaccagtaatttactgaccagaatttgaaatttta ataactAGGCCATTTTTGATCTGATTAAGCTGAAATTTTGGACACTGGTA GATTTTGGtactttggtattttttttcggATCAACAGGAATTCTGCCAtc ttgatttttcaattttccaaaaaatctttACCGGATGACTCTAGGCttga tttcccaaaaaaggggtcttcaaattttcaacttttgtacCTTTTCGGAA AGCTCTAAGGCTGTACTTTCAGGATATAAAAAANNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNTTTTCCCTCGTTTCCAGGCCCCCGTAT TTCAGAGTGAGAGGTCAAATAAAGATTGGAAATCCAATATTTGGATTCAG ATTTTTTAGTTGTTTCAGGATAGGTATGGTTTTAAGTACTTTATTGCAAT ATCTGAAGAGCTATCAGGCTTAGAAAGTACAGGTAAAAACATGCGATTTA GGcagattttaggttttttgCAGTTTCCCACCCCTTAAAGCCCCTTCTGG GTGAGAAATGAGTGTCTGTAAGCTGCACCTTTTGGTCCATAGCTGATGTA CTCCATACATAATAACACAATATACTGAAAGAAACTTTCTCAGATAGCTC TACTTCAAGCAAAATCAAGCCAAAGTTTGAGAAATAACTGTAGATTACCA CCTTTTACCAGATTACCAGATTTTAATACATTTAATGGTCTAAGTAGGGT TTTGGTGTCCCTCTATATTGATTTTGACCTCTCACTCTGAAATACGGGGG CCTGGAAACGAGGGAAAAATGAATATCAGTGAAAAGCTGAACTTGGGCGG TCATTTTCtcaatttgacaaaatatctccatggaaatttttttatatccT GAAAGTACAGCCTTAGAGCTTTCCGAAAAGgtacaaaagttgaaaatttg aagaccccttttttgggaaatcaaGCCTAGAGTCATCCGGTaaagatttt ttggaaaattgaaaaatcaaaatggcagaatgcCTGTTGatccgaaaaat tttttttcattaaaaactgaAAGATAGTACCAAAATCTACCAGTGTCCAA AATTTCAGCTTAATCAGATCAAAAATGGCCTAGTTATTAAAGTTTCAAAT TCTGGTCAGTAAAttactggtctgtaaattacatttTCGTAAATTGGGCA TAACTTACCAACCGCTGTTGCTAGAGagctgaaattttttgtgtgtGATC AACCCAAGATATGTGACCTTgtgtcaaaatttcagaaagattTGAAGACC CCCATGATCCCACTTTTTCTGATTCTTAGGTGCATCTGCTCTTAAGACgc atgtaaaatttcaagtttctaatctaactgaaaaaagttacgtcaaagtt tcaattttaggccTATTTTTTTTGGCACACCCGATATAccttgtttcttt tttattgcttcaactgttttgaaaaccaaaacaNCAACCTATTTCGAAGC TTTCCGAAGAGTTTCATTTGTACAGCTTTAGTAATTTCAAAGATATGGAG ATTTTCCTAAAGGATGTGAAAATGTGCTTGTTTATAgatttgacgtcatt tttttttctgaagataAATTCAGAATATACTTTTTTACAAAGCAGTACTT TTGATGATAAAAGTAAAGACAAAAATTATAATGAGTAAATCCGAGATTTG AGTTCGCGAATAATGCATCTTAATTGATGAACCATTACATTCACCAACAG TGCGAACACGACCAACAAATTGTTTcatagattttctgatttcagGTAGG TTTCTTGCGCATTCCTTCCAAACAGACTTGATCTTAGAAATGATTTCCTC CTCTGTTTCAAAAGGCTTCTTCAATCTTCCATGGTACAACTTGCGTTTAA CTTCGTTCCAAAAATAGTAATCTAAAGGATTACTGTCCGGACTCTTTGGA GGCCACTGATCTTTCCTAAGGTATCGTCTCGGTATGGTTTCCTGCAACCG GTATAAAGTAACATTTGGCACGGAATGAACCTCGGAATGAGCCACAAGTA AACGTCCACAACCTACACCTCCACCCCTGGAATGTCCAAGTTTATCGTAA AACAAGTTTGAATTTGGGTGTCTCCCCTTAGGGAGCAGATCCCCCTAACA GTCTATGCTGACAAATTGACACAACACATTAACAAGAAATCCCTGTGAGG GTTTATGccaaaatctgcaaaaaaaccaaaatggtctcttctactgattg ctttgtGGCGCTCCTTTGCagactgtttatcaaatttcaaccaatgagat tgccgCATTTCACacagcccttctttttggcacccgtggcctctcagtgc cttgaaTGACGGGGAGCTgtaaatcccacccttcatatatttgtttcaat ctgtaATCCTAAGGCTTAggctttttctcatcttcaatatactgaagaaa gcaggaatttgatgTGAGAGTTACATTGCCAACAAAGTGCCGTAGAAAAT CATTGAGTAAAAGAAGAGTTTaaaatctcaaatattttgattttaaataa tggtgggaaaaagtgaaacatggaaagtttaattttttattggtttaatT TGAAATGggagatttggaaaattttcgtttgattttttgcacaaacccct gtgaCTATGGGTTAGCACCCCactgctaagatgttggcttgaaatcgaaa atgaaatcaCTGAAAAATCAGCCTGCACTCCAAATCCTGACAATCTTGAT ACCTTTGAAAGGACCAAAGGACCAAAACAATAAATAGATCTTTTTGCTTT TCATCCACCATCTTGGATAACGTGCAGATACAATGGCAGCAAATTTGCTG TGGTGGGGTTTTGTAGGAAAACTACACGCAAAAAGATAGTACTAATTTAA AACTCACATGCATAATTAGCATTACATTAAAGTATTATAatcttgaagaa gaaaaatcaattttgcttaACTCTTGAAAACCAAAAATAATCATCATATC CTCTCACCTCTTAGAACCAGCcctttaaaaagttgaaaaatcagCAACAA ATCCTTTTTCTGCTGAcagtaaattttttctttggaataGCACTgcgaaa atgacgtcatttcaaatcaaaacatttaaaaaaatgaaattaaaccaTGA TAAcaatatatgaaaatatatataatccttgttgaaataaaaagaacaat tttcaagtACAATGCTTGGCCATGAATTGcgtttcaagcaatttaagcTT TAATCATAGTTTTCCATTACATTTACCTACAGGAAAATGTAAGAATTGAT TTCGAAATTGCTCATTAATCTAGGCTGGTTGAAAAAAAAGGCTAATCAGC TACTGCGAGCTTGAGAAACCAAACGAATGTACTCAATTGGTAAAAATtga ttaccttattacacgaatattactagtcattttattagcatgaattgaaa aactttgtgtaccttaaaggaagaaattttggcggatttggtggatttga ctgaaatccgccaaattaagttcctgccaaaatttttccgccatccgcca aatcaaattcccgccaaattaaaaatTGTGTTAATTTTTGgtatgttaat ttcaaggctgtTGAAtatcgtgtaataaggtagatTGCCATTCCAATCAG AGATGTTTCAATTTGGAGAAGAGCAATTTATGATGTGTGATGAACAAGCT GCAATGAAGAAAGATGTGTCTATATTTTTTACCTGTTTGCCTGTTTTCCC AATTTCAGTAAGAGCAACTGAAATATAGGAAAGAATGATGAATTGGTGAA TCTGACAGGCATATAAAAGACTCACAAGAAGAATCAAAGACAGAAAACTA CAGCCTGGTCTTGTAAAAATATGTTAACAGTCCCTGATTCATCCGGTCTG TATTCCAGGTTTCTTATTAAGGGAGCTCCCAGTGTCCCACAAACAGTAAA TATCAAGGTCTAATTTGTATTGTTTTGAAGTATTAGCAGAGCAAAATGTT AACAACATCACATACAATTCTTCTGACACGACTCTTGGCAAAATAATGAG AATGAGGTACCAAATAGAAGTGTTATCAATTGTTACtccattttattttt ctgataaaaaaaggATCAAGTTGTCACCTTCTACCTTTGCTACTATTTAA ATTCATTTCTGGCAAAATCAAAGATTGGTCAAATTGAAAACCTTTTACTG CTAACTGATTAAAAACTCATTTCTAGTTGAAACAAGTGAGAATGGAGGCG AGACTCAAAGCAATGGCCTTGACCATAAAGACGGAGAAGATGAAGAAGCA AAGGCTGTTAGTTCTACTGACggagaaaaaatgaaacaaaacgaAAATCC TGAGGCTGGAGAggagaagaagaaagaagaaaatcaggCTATCAAGAAGA AGGTTACTGaacaaacatcaaaacaattttaagaattttgatgTCATTAA TGGGCCAATTGCCTGTAGGTTCAGTCTTATTCTTACAAGAAActctttat ttctttatttttctgttttaggATGAGTCGTTGGGATCAGCAGTTGCTAA GCATTACAATGAAATTCCTGCTGGTAGTAGAGAAACCAGGAAAGACAGTC GAATTTTCCATTTACGAAATTTTAACAATTGGATAAAAAGTGTGATTATC AATGAATATCTTGACAAAATCAAAAGGTAACAATAGTGCAGAAAGATTTT AGCCTACCTAAGCAAAAAAACCTTTGTTAGGTTATGACTATAACCAGTTG TGATTTGTGAGTTGTGACCTCATCTTTACTAATTTTGCTATTAAAACACA GCTTGAGAAATCTCACTGCTAAACGCTCGTAAAAGCGCAATAACAACCAT TTCCAAAGTAATCAGTTATCATAAAGTAGTGAAACATCAGATTTCTGTAA TCTGTTAAAGAGCAGAAAAGGTTTTGACCGAAATTTTGCTTTATTAATAA TTTGATACTGGAGTCTAGTGAAGAAGTAGACAAACATTATGAATCTTTTC ATAGACGAAAGCGCACTTCAGATGATATCAATGTGTTAGACTTGGGATGT GGAAAAGGCGGCGATTTACTGAAATGGGATAAAGGACGTGTTGACCATGT TATTATGGCAGGTAAGATAAGCCTAAAATCTTCTAGATTATTTAATAAAT AGCTGTTTCGTCATCTTTTTGGGCTCACCAATTTCGCTTTTTTCTACAGA AGTTGTCACAGTTCTAATCTTCTATTGAACATTTGAATTTCTTTATCTTG GAATAGTTCTATGTTAATGAGTTTCATGGGACGAGCCTGTAGGTGGCTTT TGAAATATGTATGGGGCAGAAAGAACAAGCAAAACTATTGGAAAAATCAT CAAGATGATCCATTAGGCAATGGAAGGCTTTACTAAAAGACATTACATGC CCTTACTTGAGCTTTCCTTTGGGTTTTAAATGATTATGTTAGCTTTGAGT CAGTTGACTGAAGTTGGTTGTATGATGATATGGTGGTTatatcaaaagtt ttaaaaaccttttgtAGTTCAATTCCATTGATTACTCCTTGAGGggaggc gtttaaaagaagggagtGTTCACGTCAAGTAATACAGTATACAGTGTTTA AAAATTCCGAGTACCTTCAGAATTTGGTATTGTGCTTTAACGTTTCAATT TTATCAATTAGACATTGCTGCTACTTCAGTGGACCAATGTAAAGAACGAT ATAGCAAACTGGAGCGTGATCGCCGAAGAGGATCTCATTCGCGTGTCTTC TCAACTGAATTCTTTGCCGCTGATTGCACCAAGGTTAGAAATTCCTTTGC AgatatttttcgaatttttactATTTGATGATATTCTACTCCTGCATTAT GCCTACCTTtcaaacaagcacaaaaccgtTATTTAATTTGAACTCTATCA ATATTTACGGCCTTTTTGGTCACCGCTGCAAAATTACCAGTATTCATTTT GTCTTGAAACTGACTTTCTAAGAAAAgttttgtttggaaaataaTCATAA AATTTAAAGTGTCTTTTCACTCAATCAATGAGCTGTTCCAtcaaaaaacc atacagggggtggacgaacccttacaagttaaaaaagaataattgaaaat gtgtcgataccccctggaaaatcgcgaaatttgcaAATGTGCCCTTGGAA AGATTTCTTTCATACCTTTTAGCGAGGGGGGACAAACTGAAACCAGTCTT TTAACCCGTGGAAGTTTTAGAAAACCTTTTTACTCCCtcggaaaaatgaa aaaagccccccccctggaaaatttTCTCAGATTACCATCTGGAGATGTTC CTCCACCCCCTGTATCGATATAAAATGGTAGGCCCAATAGCATCACTGCT TTTCGATTGTCTTTTTATGCCATACTATTCTCAAGACTTTCTTTTGTGAT CAGGTGAAATTTGGTATTCCGAAATCTATGGATTTTCTGATATAGAGACA AAAATTGGAATACAACAATCGAATTTGTAGAGGCGAATTCTAAGACAAAT AGAATATATTTTTCTGTAATTTagattttcttccttttatttcctTTGAT TTCTTGTGTTTCAGGAAGTGATATCAGAGAAATATAAGAAGAAGGAAATC AAACTAGACCTGACAAGTTGTCAATTCGCTTTCCACTATTCCTTTGAAAG TTATGATCAAGCCGACATTATGTTGCGAAATGCTTGCCAAAACCTTCGAG TCGGAGGTTACTTCATTGGCACAACTGCCGACTCCAACAAACTAGTGTAA GCTTCTATGGAGTACTACTAATTCTAAATCACTTTATGATGCATTGGGCT TTCTATCTCATCATTCTTTCAACATATCGGTGGTTGATACATATTGATTC AGGAACCATTTGTGTCtgactccccccccccccccgggcccccccccccc ccgggccccccccccccccgggccccccccccccccgggccccccccccc cccgggccccccccccccccgggccccccccccccccgggcccccccccc ccccgggcccccccccccccccccccccgggacccCCCGGAAGACTTcca tctattcatgatatacaccactggagagtcttctgagaacttttaagaTT TTCCATTGTACAACGTCACTTAagcaatagaaaaagtgacgtattgggtg gaaaaaagaacagaaaagttgcataattttgtgaagtcatttcagtggtg catatcatgaattcacaTTATCATAGTGTAgatctttgaaatttattttt ctatattAGTAAGCGAATCAAAGAATGCAAAGAGGCCGATTCTTTCGGAA ACTCAGTTTTCAACATCAAGTCGAACCACCGAGACAACTTCCCATTGTTT GGATCCAAATACACTTTCTTCCTTGAAGGCGTTGTTGATTGTCCAGAATT TTTGGTGCACTTCCCAACAATGGAGGCGTGagtcttttttgtaattttgt tgtTCAGTGTGCTCTGGTTTGTCCctttctttgaaatttcctgtAGTCGT ACGTAAAGTTTTAAGGCTAGTAACtaatgtgaaaataaaaaatacgcACG ATAACATTAATCGAAGGAACTTTGAATGTTCTTCAGGCTCACTTTGGTAT ATCTGTAAAAATATtggtcatttttattttttacatgcTATTTTATTTAT TACTAACAACACTTCCTTTTCCCAAGGCCAGCTCTTTAACCTTTATCATA TATATTTTAGCTTGGCAGCCAAGTACAACATGAAGTTGGTTTGGAAGAAG AATTTCcatgaaattttcaaagaacatGAACGCCAACATTCCACCCTCTT GAACAAAATGAACGCCCTCGAGGTGTGTTTGCTTTCATTGGTTTGCATGA GGGGAGCGAATTCTTTTTGAATACTCAAAACTTAGAAAAGACGATAAGGC TTGAAATTTCATTTAGTTTTTAGGGAAACAAAAATTAAAGCACGTTAGCT TCGTTGTCTTTTAATTTATTATTGTTTAATTTCTATTTCATGTAGACGTA CCCTGCACCTGCGAACAAGACTCTCTTGGGAGGAAGCGAATCGCAATACA AATCAGCTTGTGATTACTTGGAAAGGAAGAGCTGCAGTCAGGTGGGCACC TTATCAGCAGACGAGTGGGAAGTGGCTGGGCTTTATGTGGCTTTCGCTTT TGAGAAAATGGAAGAGAAATCGGCATCGACGAGCCATGACAGCAGGAAGA GAGGTCGCGATCATAGCTCCGATAAACGACGATCGGTGTCCTCCAGCAGC AGTAAACGATCACGAAAaggtttttctcatttttacttGCAATTCTCtct tgttttttggacctaccccggtggggtggaggtcctataaattaacccgt gttcgttagttaattagttcgttcgttagttaccaacttttctcgagatt ggctcattcaatttttctgattttttgcacaaaggtgcattactataaat tctcgaatgtgacggagcccgattttcgaaaaaaatttttccggccggta gaaccggaaatgtcccgaaaaaagcggttttttgagattttctcgagatt ttatcattagttttttgcgattttatgcacatagatgcacattagtactg ccgaaaaggtgtcgaaaaacgtttgccgaaaaaattttttttccggtaga accggaaatgtcccgaaaaaagcggttttttgagattttctcgagatttt atcattagttttttgcgattttttgcacatagatgcacattagtactgcc gaaaaggtgtcgaaaaacgtttgccgaaaaaattttttttccggtagaac cggaaatgtgccggaaatcgtcgttttttcacatttccgtcacatttttt caacttatttaattgtttctttacagaaaaatgttctttatgatgatgcc caaaacttagcatcgtttgatttccaaaaaaatcatcctttgaatccgga actccttaaaaatcgccggaacggccgaaaaccggcgtaaaacggtcttc cttcattttttcaacttatactcgacagattttcatgattttttgcacaa tgatgtaaaatggcaatgcccaaaatgtgacagagcccaattttcgaaaa agaaatttttccggccgctagaaccggaaatgtcccgaaaaaagccgttt tttgagattttctagagattttctcattagttttttgcgattttttgcac atagatgcacattagtactgccgaaaaggtgatGTATATTATGATTGAGT TTGTGTGTATAGTTTGTTTTTGACTACCCCCTCCCCCATCCTCCACCCCG ACACTCCTCAATCTGtgatgaaataatgaaaactgaaaactaaatgtttt ttttac

Coding sequence (CDS) from alignment at sc0000018:680602..693507+

>TCONS_00002056 ID=TCONS_00002056|Name=TCONS_00002056|organism=Clytia hemisphaerica|type=CDS|length=13797bp|location=Sequence derived from alignment at sc0000018:680602..693507+ (Clytia hemisphaerica)
ATGACTGAAATAAACGAGCCAAATGAGTCTCGAATTCAAGAAGAGACTGT
CAGTTCCTTATCTGAAGATGTTGATTTAAAATCCCAAAAAACAGtagatg
aaaatcaaaatggggaAAGTGGCACAGACGATCAAAAAGAGGCAGCTTCT
GATGAAACTGTGAAAGTTGAAACAAGTGAGAATGGAGGCGAGACTCAAAG
CAATGGCCTTGACCATAAAGACGGAGAAGATGAAGAAGCAAAGGCTGTTA
GTTCTACTGACggagaaaaaatgaaacaaaacgaAAATCCTGAGGCTGGA
GAggagaagaagaaagaagaaaatcaggCTATCAAGAAGAAGgATGAGTC
GTTGGGATCAGCAGTTGCTAAGCATTACAATGAAATTCCTGCTGGTAGTA
GAGAAACCAGGAAAGACAGTCGAATTTTCCATTTACGAAATTTTAACAAT
TGGATAAAAAGTGTGATTATCAATGAATATCTTGACAAAATCAAAAGACG
AAAGCGCACTTCAGATGATATCAATGTGTTAGACTTGGGATGTGGAAAAG
GCGGCGATTTACTGAAATGGGATAAAGGACGTGTTGACCATGTTATTATG
GCAGACATTGCTGCTACTTCAGTGGACCAATGTAAAGAACGATATAGCAA
ACTGGAGCGTGATCGCCGAAGAGGATCTCATTCGCGTGTCTTCTCAACTG
AATTCTTTGCCGCTGATTGCACCAAGGAAGTGATATCAGAGAAATATAAG
AAGAAGGAAATCAAACTAGACCTGACAAGTTGTCAATTCGCTTTCCACTA
TTCCTTTGAAAGTTATGATCAAGCCGACATTATGTTGCGAAATGCTTGCC
AAAACCTTCGAGTCGGAGGTTACTTCATTGGCACAACTGCCGACTCCAAC
AAACTAGTTAAGCGAATCAAAGAATGCAAAGAGGCCGATTCTTTCGGAAA
CTCAGTTTTCAACATCAAGTCGAACCACCGAGACAACTTCCCATTGTTTG
GATCCAAATACACTTTCTTCCTTGAAGGCGTTGTTGATTGTCCAGAATTT
TTGGTGCACTTCCCAACAATGGAGGCCTTGGCAGCCAAGTACAACATGAA
GTTGGTTTGGAAGAAGAATTTCcatgaaattttcaaagaacatGAACGCC
AACATTCCACCCTCTTGAACAAAATGAACGCCCTCGAGACGTACCCTGCA
CCTGCGAACAAGACTCTCTTGGGAGGAAGCGAATCGCAATACAAATCAGC
TTGTGATTACTTGGAAAGGAAGAGCTGCAGTCAGGTGGGCACCTTATCAG
CAGACGAGTGGGAAGTGGCTGGGCTTTATGTGGCTTTCGCTTTTGAGAAA
ATGGAAGAGAAATCGGCATCGACGAGCCATGACAGCAGGAAGAGAGGTCG
CGATCATAGCTCCGATAAACGACGATCGGTGTCCTCCAGCAGCAGTAAAC
GATCACGAAAaggtttttctcatttttacttGCAATTCTCtcttgttttt
tggacctaccccggtggggtggaggtcctataaATGACTGAAATAAACGA
GCCAAATGAGTCTCGAATTCAAGAAGAGACTGTCAGTTCCTTATCTGAAG
ATGTTGATTTAAAATCCCAAAAAACAGtagatgaaaatcaaaatggggaA
AGTGGCACAGACGATCAAAAAGAGGCAGCTTCTGATGAAACTGTGAAAGT
TGAAACAAGTGAGAATGGAGGCGAGACTCAAAGCAATGGCCTTGACCATA
AAGACGGAGAAGATGAAGAAGCAAAGGCTGTTAGTTCTACTGACggagaa
aaaatgaaacaaaacgaAAATCCTGAGGCTGGAGAggagaagaagaaaga
agaaaatcaggCTATCAAGAAGAAGgATGAGTCGTTGGGATCAGCAGTTG
CTAAGCATTACAATGAAATTCCTGCTGGTAGTAGAGAAACCAGGAAAGAC
AGTCGAATTTTCCATTTACGAAATTTTAACAATTGGATAAAAAGTGTGAT
TATCAATGAATATCTTGACAAAATCAAAAGACGAAAGCGCACTTCAGATG
ATATCAATGTGTTAGACTTGGGATGTGGAAAAGGCGGCGATTTACTGAAA
TGGGATAAAGGACGTGTTGACCATGTTATTATGGCAGACATTGCTGCTAC
TTCAGTGGACCAATGTAAAGAACGATATAGCAAACTGGAGCGTGATCGCC
GAAGAGGATCTCATTCGCGTGTCTTCTCAACTGAATTCTTTGCCGCTGAT
TGCACCAAGGAAGTGATATCAGAGAAATATAAGAAGAAGGAAATCAAACT
AGACCTGACAAGTTGTCAATTCGCTTTCCACTATTCCTTTGAAAGTTATG
ATCAAGCCGACATTATGTTGCGAAATGCTTGCCAAAACCTTCGAGTCGGA
GGTTACTTCATTGGCACAACTGCCGACTCCAACAAACTAGTTAAGCGAAT
CAAAGAATGCAAAGAGGCCGATTCTTTCGGAAACTCAGTTTTCAACATCA
AGTCGAACCACCGAGACAACTTCCCATTGTTTGGATCCAAATACACTTTC
TTCCTTGAAGGCGTTGTTGATTGTCCAGAATTTTTGGTGCACTTCCCAAC
AATGGAGGCCTTGGCAGCCAAGTACAACATGAAGTTGGTTTGGAAGAAGA
ATTTCcatgaaattttcaaagaacatGAACGCCAACATTCCACCCTCTTG
AACAAAATGAACGCCCTCGAGACGTACCCTGCACCTGCGAACAAGACTCT
CTTGGGAGGAAGCGAATCGCAATACAAATCAGCTTGTGATTACTTGGAAA
GGAAGAGCTGCAGTCAGGTGGGCACCTTATCAGCAGACGAGTGGGAAGTG
GCTGGGCTTTATGTGGCTTTCGCTTTTGAGAAAATGGAAGAGAAATCGGC
ATCGACGAGCCATGACAGCAGGAAGAGAGGTCGCGATCATAGCTCCGATA
AACGACGATCGGTGTCCTCCAGCAGCAGTAAACGATCACGAAAaggtttt
tctcatttttacttGCAATTCTCtcttgttttttggacctaccccggtgg
ggtggaggtcctataaATGACTGAAATAAACGAGCCAAATGAGTCTCGAA
TTCAAGAAGAGACTGTCAGTTCCTTATCTGAAGATGTTGATTTAAAATCC
CAAAAAACAGtagatgaaaatcaaaatggggaAAGTGGCACAGACGATCA
AAAAGAGGCAGCTTCTGATGAAACTGTGAAAGTTGAAACAAGTGAGAATG
GAGGCGAGACTCAAAGCAATGGCCTTGACCATAAAGACGGAGAAGATGAA
GAAGCAAAGGCTGTTAGTTCTACTGACggagaaaaaatgaaacaaaacga
AAATCCTGAGGCTGGAGAggagaagaagaaagaagaaaatcaggCTATCA
AGAAGAAGgATGAGTCGTTGGGATCAGCAGTTGCTAAGCATTACAATGAA
ATTCCTGCTGGTAGTAGAGAAACCAGGAAAGACAGTCGAATTTTCCATTT
ACGAAATTTTAACAATTGGATAAAAAGTGTGATTATCAATGAATATCTTG
ACAAAATCAAAAGACGAAAGCGCACTTCAGATGATATCAATGTGTTAGAC
TTGGGATGTGGAAAAGGCGGCGATTTACTGAAATGGGATAAAGGACGTGT
TGACCATGTTATTATGGCAGACATTGCTGCTACTTCAGTGGACCAATGTA
AAGAACGATATAGCAAACTGGAGCGTGATCGCCGAAGAGGATCTCATTCG
CGTGTCTTCTCAACTGAATTCTTTGCCGCTGATTGCACCAAGGAAGTGAT
ATCAGAGAAATATAAGAAGAAGGAAATCAAACTAGACCTGACAAGTTGTC
AATTCGCTTTCCACTATTCCTTTGAAAGTTATGATCAAGCCGACATTATG
TTGCGAAATGCTTGCCAAAACCTTCGAGTCGGAGGTTACTTCATTGGCAC
AACTGCCGACTCCAACAAACTAGTTAAGCGAATCAAAGAATGCAAAGAGG
CCGATTCTTTCGGAAACTCAGTTTTCAACATCAAGTCGAACCACCGAGAC
AACTTCCCATTGTTTGGATCCAAATACACTTTCTTCCTTGAAGGCGTTGT
TGATTGTCCAGAATTTTTGGTGCACTTCCCAACAATGGAGGCCTTGGCAG
CCAAGTACAACATGAAGTTGGTTTGGAAGAAGAATTTCcatgaaattttc
aaagaacatGAACGCCAACATTCCACCCTCTTGAACAAAATGAACGCCCT
CGAGACGTACCCTGCACCTGCGAACAAGACTCTCTTGGGAGGAAGCGAAT
CGCAATACAAATCAGCTTGTGATTACTTGGAAAGGAAGAGCTGCAGTCAG
GTGGGCACCTTATCAGCAGACGAGTGGGAAGTGGCTGGGCTTTATGTGGC
TTTCGCTTTTGAGAAAATGGAAGAGAAATCGGCATCGACGAGCCATGACA
GCAGGAAGAGAGGTCGCGATCATAGCTCCGATAAACGACGATCGGTGTCC
TCCAGCAGCAGTAAACGATCACGAAAaggtttttctcatttttacttGCA
ATTCTCtcttgttttttggacctaccccggtggggtggaggtcctataaA
TGACTGAAATAAACGAGCCAAATGAGTCTCGAATTCAAGAAGAGACTGTC
AGTTCCTTATCTGAAGATGTTGATTTAAAATCCCAAAAAACAGtagatga
aaatcaaaatggggaAAGTGGCACAGACGATCAAAAAGAGGCAGCTTCTG
ATGAAACTGTGAAAGTTGAAACAAGTGAGAATGGAGGCGAGACTCAAAGC
AATGGCCTTGACCATAAAGACGGAGAAGATGAAGAAGCAAAGGCTGTTAG
TTCTACTGACggagaaaaaatgaaacaaaacgaAAATCCTGAGGCTGGAG
AggagaagaagaaagaagaaaatcaggCTATCAAGAAGAAGgATGAGTCG
TTGGGATCAGCAGTTGCTAAGCATTACAATGAAATTCCTGCTGGTAGTAG
AGAAACCAGGAAAGACAGTCGAATTTTCCATTTACGAAATTTTAACAATT
GGATAAAAAGTGTGATTATCAATGAATATCTTGACAAAATCAAAAGACGA
AAGCGCACTTCAGATGATATCAATGTGTTAGACTTGGGATGTGGAAAAGG
CGGCGATTTACTGAAATGGGATAAAGGACGTGTTGACCATGTTATTATGG
CAGACATTGCTGCTACTTCAGTGGACCAATGTAAAGAACGATATAGCAAA
CTGGAGCGTGATCGCCGAAGAGGATCTCATTCGCGTGTCTTCTCAACTGA
ATTCTTTGCCGCTGATTGCACCAAGGAAGTGATATCAGAGAAATATAAGA
AGAAGGAAATCAAACTAGACCTGACAAGTTGTCAATTCGCTTTCCACTAT
TCCTTTGAAAGTTATGATCAAGCCGACATTATGTTGCGAAATGCTTGCCA
AAACCTTCGAGTCGGAGGTTACTTCATTGGCACAACTGCCGACTCCAACA
AACTAGTTAAGCGAATCAAAGAATGCAAAGAGGCCGATTCTTTCGGAAAC
TCAGTTTTCAACATCAAGTCGAACCACCGAGACAACTTCCCATTGTTTGG
ATCCAAATACACTTTCTTCCTTGAAGGCGTTGTTGATTGTCCAGAATTTT
TGGTGCACTTCCCAACAATGGAGGCCTTGGCAGCCAAGTACAACATGAAG
TTGGTTTGGAAGAAGAATTTCcatgaaattttcaaagaacatGAACGCCA
ACATTCCACCCTCTTGAACAAAATGAACGCCCTCGAGACGTACCCTGCAC
CTGCGAACAAGACTCTCTTGGGAGGAAGCGAATCGCAATACAAATCAGCT
TGTGATTACTTGGAAAGGAAGAGCTGCAGTCAGGTGGGCACCTTATCAGC
AGACGAGTGGGAAGTGGCTGGGCTTTATGTGGCTTTCGCTTTTGAGAAAA
TGGAAGAGAAATCGGCATCGACGAGCCATGACAGCAGGAAGAGAGGTCGC
GATCATAGCTCCGATAAACGACGATCGGTGTCCTCCAGCAGCAGTAAACG
ATCACGAAAaggtttttctcatttttacttGCAATTCTCtcttgtttttt
ggacctaccccggtggggtggaggtcctataaATGACTGAAATAAACGAG
CCAAATGAGTCTCGAATTCAAGAAGAGACTGTCAGTTCCTTATCTGAAGA
TGTTGATTTAAAATCCCAAAAAACAGtagatgaaaatcaaaatggggaAA
GTGGCACAGACGATCAAAAAGAGGCAGCTTCTGATGAAACTGTGAAAGTT
GAAACAAGTGAGAATGGAGGCGAGACTCAAAGCAATGGCCTTGACCATAA
AGACGGAGAAGATGAAGAAGCAAAGGCTGTTAGTTCTACTGACggagaaa
aaatgaaacaaaacgaAAATCCTGAGGCTGGAGAggagaagaagaaagaa
gaaaatcaggCTATCAAGAAGAAGgATGAGTCGTTGGGATCAGCAGTTGC
TAAGCATTACAATGAAATTCCTGCTGGTAGTAGAGAAACCAGGAAAGACA
GTCGAATTTTCCATTTACGAAATTTTAACAATTGGATAAAAAGTGTGATT
ATCAATGAATATCTTGACAAAATCAAAAGACGAAAGCGCACTTCAGATGA
TATCAATGTGTTAGACTTGGGATGTGGAAAAGGCGGCGATTTACTGAAAT
GGGATAAAGGACGTGTTGACCATGTTATTATGGCAGACATTGCTGCTACT
TCAGTGGACCAATGTAAAGAACGATATAGCAAACTGGAGCGTGATCGCCG
AAGAGGATCTCATTCGCGTGTCTTCTCAACTGAATTCTTTGCCGCTGATT
GCACCAAGGAAGTGATATCAGAGAAATATAAGAAGAAGGAAATCAAACTA
GACCTGACAAGTTGTCAATTCGCTTTCCACTATTCCTTTGAAAGTTATGA
TCAAGCCGACATTATGTTGCGAAATGCTTGCCAAAACCTTCGAGTCGGAG
GTTACTTCATTGGCACAACTGCCGACTCCAACAAACTAGTTAAGCGAATC
AAAGAATGCAAAGAGGCCGATTCTTTCGGAAACTCAGTTTTCAACATCAA
GTCGAACCACCGAGACAACTTCCCATTGTTTGGATCCAAATACACTTTCT
TCCTTGAAGGCGTTGTTGATTGTCCAGAATTTTTGGTGCACTTCCCAACA
ATGGAGGCCTTGGCAGCCAAGTACAACATGAAGTTGGTTTGGAAGAAGAA
TTTCcatgaaattttcaaagaacatGAACGCCAACATTCCACCCTCTTGA
ACAAAATGAACGCCCTCGAGACGTACCCTGCACCTGCGAACAAGACTCTC
TTGGGAGGAAGCGAATCGCAATACAAATCAGCTTGTGATTACTTGGAAAG
GAAGAGCTGCAGTCAGGTGGGCACCTTATCAGCAGACGAGTGGGAAGTGG
CTGGGCTTTATGTGGCTTTCGCTTTTGAGAAAATGGAAGAGAAATCGGCA
TCGACGAGCCATGACAGCAGGAAGAGAGGTCGCGATCATAGCTCCGATAA
ACGACGATCGGTGTCCTCCAGCAGCAGTAAACGATCACGAAAaggttttt
ctcatttttacttGCAATTCTCtcttgttttttggacctaccccggtggg
gtggaggtcctataaATGACTGAAATAAACGAGCCAAATGAGTCTCGAAT
TCAAGAAGAGACTGTCAGTTCCTTATCTGAAGATGTTGATTTAAAATCCC
AAAAAACAGtagatgaaaatcaaaatggggaAAGTGGCACAGACGATCAA
AAAGAGGCAGCTTCTGATGAAACTGTGAAAGTTGAAACAAGTGAGAATGG
AGGCGAGACTCAAAGCAATGGCCTTGACCATAAAGACGGAGAAGATGAAG
AAGCAAAGGCTGTTAGTTCTACTGACggagaaaaaatgaaacaaaacgaA
AATCCTGAGGCTGGAGAggagaagaagaaagaagaaaatcaggCTATCAA
GAAGAAGgATGAGTCGTTGGGATCAGCAGTTGCTAAGCATTACAATGAAA
TTCCTGCTGGTAGTAGAGAAACCAGGAAAGACAGTCGAATTTTCCATTTA
CGAAATTTTAACAATTGGATAAAAAGTGTGATTATCAATGAATATCTTGA
CAAAATCAAAAGACGAAAGCGCACTTCAGATGATATCAATGTGTTAGACT
TGGGATGTGGAAAAGGCGGCGATTTACTGAAATGGGATAAAGGACGTGTT
GACCATGTTATTATGGCAGACATTGCTGCTACTTCAGTGGACCAATGTAA
AGAACGATATAGCAAACTGGAGCGTGATCGCCGAAGAGGATCTCATTCGC
GTGTCTTCTCAACTGAATTCTTTGCCGCTGATTGCACCAAGGAAGTGATA
TCAGAGAAATATAAGAAGAAGGAAATCAAACTAGACCTGACAAGTTGTCA
ATTCGCTTTCCACTATTCCTTTGAAAGTTATGATCAAGCCGACATTATGT
TGCGAAATGCTTGCCAAAACCTTCGAGTCGGAGGTTACTTCATTGGCACA
ACTGCCGACTCCAACAAACTAGTTAAGCGAATCAAAGAATGCAAAGAGGC
CGATTCTTTCGGAAACTCAGTTTTCAACATCAAGTCGAACCACCGAGACA
ACTTCCCATTGTTTGGATCCAAATACACTTTCTTCCTTGAAGGCGTTGTT
GATTGTCCAGAATTTTTGGTGCACTTCCCAACAATGGAGGCCTTGGCAGC
CAAGTACAACATGAAGTTGGTTTGGAAGAAGAATTTCcatgaaattttca
aagaacatGAACGCCAACATTCCACCCTCTTGAACAAAATGAACGCCCTC
GAGACGTACCCTGCACCTGCGAACAAGACTCTCTTGGGAGGAAGCGAATC
GCAATACAAATCAGCTTGTGATTACTTGGAAAGGAAGAGCTGCAGTCAGG
TGGGCACCTTATCAGCAGACGAGTGGGAAGTGGCTGGGCTTTATGTGGCT
TTCGCTTTTGAGAAAATGGAAGAGAAATCGGCATCGACGAGCCATGACAG
CAGGAAGAGAGGTCGCGATCATAGCTCCGATAAACGACGATCGGTGTCCT
CCAGCAGCAGTAAACGATCACGAAAaggtttttctcatttttacttGCAA
TTCTCtcttgttttttggacctaccccggtggggtggaggtcctataaAT
GACTGAAATAAACGAGCCAAATGAGTCTCGAATTCAAGAAGAGACTGTCA
GTTCCTTATCTGAAGATGTTGATTTAAAATCCCAAAAAACAGtagatgaa
aatcaaaatggggaAAGTGGCACAGACGATCAAAAAGAGGCAGCTTCTGA
TGAAACTGTGAAAGTTGAAACAAGTGAGAATGGAGGCGAGACTCAAAGCA
ATGGCCTTGACCATAAAGACGGAGAAGATGAAGAAGCAAAGGCTGTTAGT
TCTACTGACggagaaaaaatgaaacaaaacgaAAATCCTGAGGCTGGAGA
ggagaagaagaaagaagaaaatcaggCTATCAAGAAGAAGgATGAGTCGT
TGGGATCAGCAGTTGCTAAGCATTACAATGAAATTCCTGCTGGTAGTAGA
GAAACCAGGAAAGACAGTCGAATTTTCCATTTACGAAATTTTAACAATTG
GATAAAAAGTGTGATTATCAATGAATATCTTGACAAAATCAAAAGACGAA
AGCGCACTTCAGATGATATCAATGTGTTAGACTTGGGATGTGGAAAAGGC
GGCGATTTACTGAAATGGGATAAAGGACGTGTTGACCATGTTATTATGGC
AGACATTGCTGCTACTTCAGTGGACCAATGTAAAGAACGATATAGCAAAC
TGGAGCGTGATCGCCGAAGAGGATCTCATTCGCGTGTCTTCTCAACTGAA
TTCTTTGCCGCTGATTGCACCAAGGAAGTGATATCAGAGAAATATAAGAA
GAAGGAAATCAAACTAGACCTGACAAGTTGTCAATTCGCTTTCCACTATT
CCTTTGAAAGTTATGATCAAGCCGACATTATGTTGCGAAATGCTTGCCAA
AACCTTCGAGTCGGAGGTTACTTCATTGGCACAACTGCCGACTCCAACAA
ACTAGTTAAGCGAATCAAAGAATGCAAAGAGGCCGATTCTTTCGGAAACT
CAGTTTTCAACATCAAGTCGAACCACCGAGACAACTTCCCATTGTTTGGA
TCCAAATACACTTTCTTCCTTGAAGGCGTTGTTGATTGTCCAGAATTTTT
GGTGCACTTCCCAACAATGGAGGCCTTGGCAGCCAAGTACAACATGAAGT
TGGTTTGGAAGAAGAATTTCcatgaaattttcaaagaacatGAACGCCAA
CATTCCACCCTCTTGAACAAAATGAACGCCCTCGAGACGTACCCTGCACC
TGCGAACAAGACTCTCTTGGGAGGAAGCGAATCGCAATACAAATCAGCTT
GTGATTACTTGGAAAGGAAGAGCTGCAGTCAGGTGGGCACCTTATCAGCA
GACGAGTGGGAAGTGGCTGGGCTTTATGTGGCTTTCGCTTTTGAGAAAAT
GGAAGAGAAATCGGCATCGACGAGCCATGACAGCAGGAAGAGAGGTCGCG
ATCATAGCTCCGATAAACGACGATCGGTGTCCTCCAGCAGCAGTAAACGA
TCACGAAAaggtttttctcatttttacttGCAATTCTCtcttgttttttg
gacctaccccggtggggtggaggtcctataaATGACTGAAATAAACGAGC
CAAATGAGTCTCGAATTCAAGAAGAGACTGTCAGTTCCTTATCTGAAGAT
GTTGATTTAAAATCCCAAAAAACAGtagatgaaaatcaaaatggggaAAG
TGGCACAGACGATCAAAAAGAGGCAGCTTCTGATGAAACTGTGAAAGTTG
AAACAAGTGAGAATGGAGGCGAGACTCAAAGCAATGGCCTTGACCATAAA
GACGGAGAAGATGAAGAAGCAAAGGCTGTTAGTTCTACTGACggagaaaa
aatgaaacaaaacgaAAATCCTGAGGCTGGAGAggagaagaagaaagaag
aaaatcaggCTATCAAGAAGAAGgATGAGTCGTTGGGATCAGCAGTTGCT
AAGCATTACAATGAAATTCCTGCTGGTAGTAGAGAAACCAGGAAAGACAG
TCGAATTTTCCATTTACGAAATTTTAACAATTGGATAAAAAGTGTGATTA
TCAATGAATATCTTGACAAAATCAAAAGACGAAAGCGCACTTCAGATGAT
ATCAATGTGTTAGACTTGGGATGTGGAAAAGGCGGCGATTTACTGAAATG
GGATAAAGGACGTGTTGACCATGTTATTATGGCAGACATTGCTGCTACTT
CAGTGGACCAATGTAAAGAACGATATAGCAAACTGGAGCGTGATCGCCGA
AGAGGATCTCATTCGCGTGTCTTCTCAACTGAATTCTTTGCCGCTGATTG
CACCAAGGAAGTGATATCAGAGAAATATAAGAAGAAGGAAATCAAACTAG
ACCTGACAAGTTGTCAATTCGCTTTCCACTATTCCTTTGAAAGTTATGAT
CAAGCCGACATTATGTTGCGAAATGCTTGCCAAAACCTTCGAGTCGGAGG
TTACTTCATTGGCACAACTGCCGACTCCAACAAACTAGTTAAGCGAATCA
AAGAATGCAAAGAGGCCGATTCTTTCGGAAACTCAGTTTTCAACATCAAG
TCGAACCACCGAGACAACTTCCCATTGTTTGGATCCAAATACACTTTCTT
CCTTGAAGGCGTTGTTGATTGTCCAGAATTTTTGGTGCACTTCCCAACAA
TGGAGGCCTTGGCAGCCAAGTACAACATGAAGTTGGTTTGGAAGAAGAAT
TTCcatgaaattttcaaagaacatGAACGCCAACATTCCACCCTCTTGAA
CAAAATGAACGCCCTCGAGACGTACCCTGCACCTGCGAACAAGACTCTCT
TGGGAGGAAGCGAATCGCAATACAAATCAGCTTGTGATTACTTGGAAAGG
AAGAGCTGCAGTCAGGTGGGCACCTTATCAGCAGACGAGTGGGAAGTGGC
TGGGCTTTATGTGGCTTTCGCTTTTGAGAAAATGGAAGAGAAATCGGCAT
CGACGAGCCATGACAGCAGGAAGAGAGGTCGCGATCATAGCTCCGATAAA
CGACGATCGGTGTCCTCCAGCAGCAGTAAACGATCACGAAAaggtttttc
tcatttttacttGCAATTCTCtcttgttttttggacctaccccggtgggg
tggaggtcctataaATGACTGAAATAAACGAGCCAAATGAGTCTCGAATT
CAAGAAGAGACTGTCAGTTCCTTATCTGAAGATGTTGATTTAAAATCCCA
AAAAACAGtagatgaaaatcaaaatggggaAAGTGGCACAGACGATCAAA
AAGAGGCAGCTTCTGATGAAACTGTGAAAGTTGAAACAAGTGAGAATGGA
GGCGAGACTCAAAGCAATGGCCTTGACCATAAAGACGGAGAAGATGAAGA
AGCAAAGGCTGTTAGTTCTACTGACggagaaaaaatgaaacaaaacgaAA
ATCCTGAGGCTGGAGAggagaagaagaaagaagaaaatcaggCTATCAAG
AAGAAGgATGAGTCGTTGGGATCAGCAGTTGCTAAGCATTACAATGAAAT
TCCTGCTGGTAGTAGAGAAACCAGGAAAGACAGTCGAATTTTCCATTTAC
GAAATTTTAACAATTGGATAAAAAGTGTGATTATCAATGAATATCTTGAC
AAAATCAAAAGACGAAAGCGCACTTCAGATGATATCAATGTGTTAGACTT
GGGATGTGGAAAAGGCGGCGATTTACTGAAATGGGATAAAGGACGTGTTG
ACCATGTTATTATGGCAGACATTGCTGCTACTTCAGTGGACCAATGTAAA
GAACGATATAGCAAACTGGAGCGTGATCGCCGAAGAGGATCTCATTCGCG
TGTCTTCTCAACTGAATTCTTTGCCGCTGATTGCACCAAGGAAGTGATAT
CAGAGAAATATAAGAAGAAGGAAATCAAACTAGACCTGACAAGTTGTCAA
TTCGCTTTCCACTATTCCTTTGAAAGTTATGATCAAGCCGACATTATGTT
GCGAAATGCTTGCCAAAACCTTCGAGTCGGAGGTTACTTCATTGGCACAA
CTGCCGACTCCAACAAACTAGTTAAGCGAATCAAAGAATGCAAAGAGGCC
GATTCTTTCGGAAACTCAGTTTTCAACATCAAGTCGAACCACCGAGACAA
CTTCCCATTGTTTGGATCCAAATACACTTTCTTCCTTGAAGGCGTTGTTG
ATTGTCCAGAATTTTTGGTGCACTTCCCAACAATGGAGGCCTTGGCAGCC
AAGTACAACATGAAGTTGGTTTGGAAGAAGAATTTCcatgaaattttcaa
agaacatGAACGCCAACATTCCACCCTCTTGAACAAAATGAACGCCCTCG
AGACGTACCCTGCACCTGCGAACAAGACTCTCTTGGGAGGAAGCGAATCG
CAATACAAATCAGCTTGTGATTACTTGGAAAGGAAGAGCTGCAGTCAGGT
GGGCACCTTATCAGCAGACGAGTGGGAAGTGGCTGGGCTTTATGTGGCTT
TCGCTTTTGAGAAAATGGAAGAGAAATCGGCATCGACGAGCCATGACAGC
AGGAAGAGAGGTCGCGATCATAGCTCCGATAAACGACGATCGGTGTCCTC
CAGCAGCAGTAAACGATCACGAAAaggtttttctcatttttacttGCAAT
TCTCtcttgttttttggacctaccccggtggggtggaggtcctataa
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_001082XLOC_001082Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00002056-exon-sc0000018-1491911889:680602..681081TCONS_00002056-exon-sc0000018-1491911889:680602..681081Clytia hemisphaericaexon
TCONS_00002056-exon-sc0000018-1510915933:680602..681081TCONS_00002056-exon-sc0000018-1510915933:680602..681081Clytia hemisphaericaexon
TCONS_00002056-exon-sc0000018-1575043694:680602..681081TCONS_00002056-exon-sc0000018-1575043694:680602..681081Clytia hemisphaericaexon
TCONS_00002056-exon-sc0000018-1491911889:688378..688553TCONS_00002056-exon-sc0000018-1491911889:688378..688553Clytia hemisphaericaexon
TCONS_00002056-exon-sc0000018-1510915933:688378..688553TCONS_00002056-exon-sc0000018-1510915933:688378..688553Clytia hemisphaericaexon
TCONS_00002056-exon-sc0000018-1575043694:688378..688553TCONS_00002056-exon-sc0000018-1575043694:688378..688553Clytia hemisphaericaexon
TCONS_00002056-exon-sc0000018-1491911889:688673..688827TCONS_00002056-exon-sc0000018-1491911889:688673..688827Clytia hemisphaericaexon
TCONS_00002056-exon-sc0000018-1510915933:688673..688827TCONS_00002056-exon-sc0000018-1510915933:688673..688827Clytia hemisphaericaexon
TCONS_00002056-exon-sc0000018-1575043694:688673..688827TCONS_00002056-exon-sc0000018-1575043694:688673..688827Clytia hemisphaericaexon
TCONS_00002056-exon-sc0000018-1491911889:689156..689262TCONS_00002056-exon-sc0000018-1491911889:689156..689262Clytia hemisphaericaexon
TCONS_00002056-exon-sc0000018-1510915933:689156..689262TCONS_00002056-exon-sc0000018-1510915933:689156..689262Clytia hemisphaericaexon
TCONS_00002056-exon-sc0000018-1575043694:689156..689262TCONS_00002056-exon-sc0000018-1575043694:689156..689262Clytia hemisphaericaexon
TCONS_00002056-exon-sc0000018-1491911889:689813..689934TCONS_00002056-exon-sc0000018-1491911889:689813..689934Clytia hemisphaericaexon
TCONS_00002056-exon-sc0000018-1510915933:689813..689934TCONS_00002056-exon-sc0000018-1510915933:689813..689934Clytia hemisphaericaexon
TCONS_00002056-exon-sc0000018-1575043694:689813..689934TCONS_00002056-exon-sc0000018-1575043694:689813..689934Clytia hemisphaericaexon
TCONS_00002056-exon-sc0000018-1491911889:690716..690897TCONS_00002056-exon-sc0000018-1491911889:690716..690897Clytia hemisphaericaexon
TCONS_00002056-exon-sc0000018-1510915933:690716..690897TCONS_00002056-exon-sc0000018-1510915933:690716..690897Clytia hemisphaericaexon
TCONS_00002056-exon-sc0000018-1575043694:690716..690897TCONS_00002056-exon-sc0000018-1575043694:690716..690897Clytia hemisphaericaexon
TCONS_00002056-exon-sc0000018-1491911889:691411..691578TCONS_00002056-exon-sc0000018-1491911889:691411..691578Clytia hemisphaericaexon
TCONS_00002056-exon-sc0000018-1510915933:691411..691578TCONS_00002056-exon-sc0000018-1510915933:691411..691578Clytia hemisphaericaexon
TCONS_00002056-exon-sc0000018-1575043694:691411..691578TCONS_00002056-exon-sc0000018-1575043694:691411..691578Clytia hemisphaericaexon
TCONS_00002056-exon-sc0000018-1491911889:691862..691973TCONS_00002056-exon-sc0000018-1491911889:691862..691973Clytia hemisphaericaexon
TCONS_00002056-exon-sc0000018-1510915933:691862..691973TCONS_00002056-exon-sc0000018-1510915933:691862..691973Clytia hemisphaericaexon
TCONS_00002056-exon-sc0000018-1575043694:691862..691973TCONS_00002056-exon-sc0000018-1575043694:691862..691973Clytia hemisphaericaexon
TCONS_00002056-exon-sc0000018-1491911889:692147..693507TCONS_00002056-exon-sc0000018-1491911889:692147..693507Clytia hemisphaericaexon
TCONS_00002056-exon-sc0000018-1510915933:692147..693507TCONS_00002056-exon-sc0000018-1510915933:692147..693507Clytia hemisphaericaexon
TCONS_00002056-exon-sc0000018-1575043694:692147..693507TCONS_00002056-exon-sc0000018-1575043694:692147..693507Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00002056-proteinTCONS_00002056-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000018supercontigsc0000018:680602..693507 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
93.602 92.1351 127.994 140.413 153.864 123.919 129.106 140.841 136.19 133.828 145.645 149.117 102.384 104.061 105.467 108.71 108.287 101.067 47.4619 55.9683 89.4918 93.8094 71.8329 73.9717 92.769 112.567 79.1706 76.1807 63.1372 60.5803
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR016899mRNA_G-N7_MeTrfase
IPR004971mRNA_G-N7_MeTrfase_dom
IPR029063SAM-dependent_MTases
Vocabulary: Cellular Component
TermDefinition
GO:0005634nucleus
Vocabulary: Molecular Function
TermDefinition
GO:0004482mRNA (guanine-N7-)-methyltransferase activity
Vocabulary: Biological Process
TermDefinition
GO:00063707-methylguanosine mRNA capping
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006370 7-methylguanosine mRNA capping
cellular_component GO:0005634 nucleus
molecular_function GO:0004482 mRNA (guanine-N7-)-methyltransferase activity
Blast
BLAST of TCONS_00002056 vs. Swiss-Prot (Human)
Match: MCES (mRNA cap guanine-N7 methyltransferase OS=Homo sapiens GN=RNMT PE=1 SV=1)

HSP 1 Score: 306.22 bits (783), Expect = 5.933e-93
Identity = 168/341 (49.27%), Postives = 234/341 (68.62%), Query Frame = 3
Query:  657 DESLGSAVAKHYNEIPAGSRETRKDSRIFHLRNFNNWIKSVIINEYLDKIKRRKRTSDDINVXXXXXXXXXXXXXXXXXRVDHVIMADIAATSVDQCKERYSKLERDRRRGSHSRVFSTEFFAADCTKEVISEKYKKKEIKLDLTSCQFAFHYSFESYDQADIMLRNACQNLRVGGYFIGTTADSNKLVKRIKECKEADSFGNSVFNIKSNHRDNFPLFGSKYTFFLEGVVDCPEFLVHFPTMEALAAKYNMKLVWKKNFHEIFKEHER--QHSTLLNKMNALETYPAPANKTLLGGSESQYKSACDYLERKSCS-QVGTLSADEWEVAGLYVAFAFEKME 1670
            +E   S VA HYNE+     E R  SRIF+LRNFNNW+KSV+I E+L+K++++K+   DI VLDLGCGKGGDLLKW KGR++ ++  DIA  SV QC++RY  + ++RR   +  +FS EF  AD +KE++ +K++  ++  D+ SCQF  HYSFESY+QAD+MLRNAC+ L  GGYFIGTT +S +L++R+ E  E +SFGN ++ +K   + ++PLFG KY F LEGVVD PEFLV+FP +  +A KYNMKLV+KK F E ++E  +  ++  LL +M ALE YPA  +  L+      Y+ A  Y++       +GTLS  EWE   +Y+ FAFEK +
Sbjct:  142 EEGHSSTVAAHYNELQEVGLEKRSQSRIFYLRNFNNWMKSVLIGEFLEKVRQKKKR--DITVLDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQCQQRYEDM-KNRRDSEY--IFSAEFITADSSKELLIDKFRDPQMCFDICSCQFVCHYSFESYEQADMMLRNACERLSPGGYFIGTTPNSFELIRRL-EASETESFGNEIYTVKFQKKGDYPLFGCKYDFNLEGVVDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQALEPYPANESSKLVSEKVDDYEHAAKYMKNSQVRLPLGTLSKSEWEATSIYLVFAFEKQQ 476          
The following BLAST results are available for this feature:
BLAST of TCONS_00002056 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
MCES5.933e-9349.27mRNA cap guanine-N7 methyltransferase OS=Homo sapi... [more]
back to top