Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00002055 (transcript) - C. hemisphaerica

Overview
NameTCONS_00002055
Unique NameTCONS_00002055
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1029

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00002055 ID=TCONS_00002055|Name=TCONS_00002055|organism=Clytia hemisphaerica|type=transcript|length=1029bp
aatatttcATTTGAAAGTCCCTTCTCTAGCTGAATCTATAAAAATAAATG
ATATAAATTATACATAAAATCATCACTGAGAAAAATTAACACACAATGGA
TGATGAAGTAGGTCAAGGAACATACGAAGGTCGAAGACAGCAAGGTTTCA
CCCTCGATTTCGTTCGCTCACCACCTGGTATCCTATTGGTTGTCAATACG
GTTATTTTGTTTCTGTGCTGGACCATCATAGCTGGTTGGAGGACGCAAGT
TCATCCATACATCGGAGTTTATTATGAGGGAAATACTGGATATTACCTCA
CAACCACCATCATACCATTTCTTATTCTGTTGACCGTCTTTGTGCTTAAG
ATGTTAAGACTGCACAAGAAAATTCCCAAAATCGTCAATTGGTCTTTGAC
AATGGCAATCAATTGTGCTGTTTGGTCGGTGCTTCTCTTCATCTCGTCCT
GTGTGGTGGGTGACATGGCAAGAAAATTGAATCCTGCATGTGAAGTTTAT
TTATGTCATCATCTTGGCGCATGCGCGGCTTTTGGATTTTTCGGATGTAT
TGGTTTAGGCGCACAAGCCTTTTTACATTTCCGCGAATGGCGTCAAAAAT
CGGCCGGTGGACTTCATAGCGCCACAAAGTCTTCAGGTGACGGAGCTGAT
GTTGAATAGGATTCTTACACGTATTATAAACATGTATCATAAAATGCTGA
TATCAGCACAAAGTctaaatataaatttttcaattttatcttttacgaat
tttatcttgaaataattttatgATCGTTATGACCACTCGATGTATATTTT
AACGAATACTATTCTATGAAATTTCATTTACTGATCATTCTTCaaaacga
ttttaaaattttttattttttccaggAGTTTAAGACGGGGTCAAAATGCT
TTCAAATCTCACAATCTGAAAACATCTATCTAAACTGAATCTTATTCTAC
TTTCATTAATGTTAATGagcttttaaaaatgatttgtaactttttaagta
ttttgaccctttttcaaGCATTTTGAAAC
Run BLAST on NCBI

protein sequence of TCONS_00002055-protein

>TCONS_00002055-protein ID=TCONS_00002055-protein|Name=TCONS_00002055-protein|organism=Clytia hemisphaerica|type=polypeptide|length=187bp
MDDEVGQGTYEGRRQQGFTLDFVRSPPGILLVVNTVILFLCWTIIAGWRT
QVHPYIGVYYEGNTGYYLTTTIIPFLILLTVFVLKMLRLHKKIPKIVNWS
LTMAINCAVWSVLLFISSCVVGDMARKLNPACEVYLCHHLGACAAFGFFG
CIGLGAQAFLHFREWRQKSAGGLHSATKSSGDGADVE
Run BLAST on NCBI

transcript from alignment at sc0000018:669439..672664+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00002055 ID=TCONS_00002055|Name=TCONS_00002055|organism=Clytia hemisphaerica|type=transcript|length=3226bp|location=Sequence derived from alignment at sc0000018:669439..672664+ (Clytia hemisphaerica)
aatatttcATTTGAAAGTCCCTTCTCTAGCTGAATCTATAAAAATAAATG ATATAAATTATACATAAAATCATCACTGAGAAAAATTAACACACAATGGA TGATGAAGTAGGTCAAGGAACATACGAAGGTCGAAGACAGCAAGGTTTCA CCCTCGATTTCGTTCGCTCACCACCTGGTATCCTATTGGTTGTCAATACG GTAAGGAAATGTCAATCAATCGGTGAATAAATGTGAATTTGGGAGAAATG AGGAAGGGAAGTTTCTGCTcgtgttttgaaattttattatattgggctct ttcagaaaaaatccgttcattgGAGGTGGAGgatgtattattttttcaat gaattacctctaaacattttcatttttcacgcCATGGACAATCATCAATC TAACGAATTAGACACCAAACTTACCCCTGGACACCGCAGACTTTTTTTGG AACCCTTGGACAATTCATCCtacccccatgaacggattttttctggggAA GAGCTCATTTTATATTTATTGTATTAATACTTTACCGGATACCAAGTCTA GCCAAGATGAAACAAGCTCTTTACATTAACGCTTTCTTCCAATAGGTTAT TTTGTTTCTGTGCTGGACCATCATAGCTGGTTGGAGGACGCAAGTTCATC CATACATCGGAGTTTATTATGAGGGAAATACTGGATATTACCTCACAACC ACCATCATACCATTTCTTATTCTGTTGACCGTCTTTGTGCTTAAGATGTT AAGACTGCACAAGAAAATTCCCAAAATCGTCAATTGGTCTTTGACAGTAA GTAAGCTTTAATCCATTTGAAAAGGTTTCGCACGAGCTTTGCATATTATG AGCtgtaaacataaaatatcatcCACATCATCCAAGTCATATCCCAAGCT CTTATTTGTTGGGGATTCTATCCCATCAACGGAATTGGGTGTAATGTAAT CTCAAACCAGATCATCCATTCCGTGCAAAACAACGCTTTGCTCTAGAGAG ATATGACGAATGTGACGATCCGGCCTAgttgttcagccaaaacaaTCGCA AAACCGTGTTTCGAAAAAGAAAGCGATTAGGTTATAATGATTATGTTTAT GATTGGTGTTTGATTCTGGTGTGGCCGTTTTTTGTTTTAGTCAAAGTAGT CCGCAAATAATAATACAAGTCTAATGTGCAAAGCATCGGAATCTGCTCGG GGATAAGGggtttttaaggaaaaaaattctatctaaaaaataaaacgtcA GTGAGAACATTCATTACGTCAATAAAtaatggttttattttttttttcgt tctttaaAGTTCGCGAAATTGATGCTTATGGTGACGATAAGTGACACCCT GAATAcgaaagaaaattatgaaaatatgatgaatgatgaattttgCGCTT ATGTATTACAGTGAAGTGAATACGGTTGCTCTATCTAGTGGTAATTGAGT CCTCGGATTCCACATGGACCtgtagctcaatggtagagcaaatgcccgcg aatggcatggttgtgagttcgactctcgccggatccgttggttttccaac tgTTCTGGTGactggtcagaagacaacatgaaaatatttattcaaaattc tattttatAGATGGCAATCAATTGTGCTGTTTGGTCGGTGCTTCTCTTCA TCTCGTCCTGTGTGGTGGGTGACATGGCAAGAAAATTGAATCCTGCATGT GAAGTTTATTTATGTCATCATCTTGGCGCATGCGCGGTAAGTAATTATTA TTGTTTGTCTGGAAatttcacccctgtctcaagtgCCCCGGTGCAGTATT TTTTCCTAGCGGTtggtataatatttttttaatcaaaatcaaggtgggga tggaaattctattgttcctacCTGTAAAAGTCCGGTGGGGATGGTTGTGG AGTAAGTAATTTGCTTTCATTAATTTCAAATAGGGATGACAGTCAATTCC CTAGTGAGATTGAAACTGTAGGGTATATGTATTTTTCTTACCGGGTGCAA GCTTTAGTTAGACCAAATTCATAGTTGGGCGGGGTCATAGGGTCTTTGAT AAAGTAAAGGAATCGCAGCAGAAGCGTCAAAAGTTATTAAATAATTTAGC CAAAACTCGTAGCCCTAAAAATTCGAAATAAATGGATTTATACCATTGGA TAGATAATAAAATTATGAACAGAAAAGTTTACAACAACAAGTCTTTTGTA TTTTCAGCACCCCCTAGCTCGGGAAGGGGGGTATTAGGTTTACATGATAA CGGAGGGTGCCGCCCAGCTCTCCCGCCGAACCATTATTCGACCAAATTTC GATGTTTCTGGgagcaaaaattcaaattatccTATTTATCCACCTTAACT TGCCTAAGCCCCCCCCTCCCCCGCCAGGCCCTGGTTCAAATGTAAGGACG AAGAATGTTACCGCGACATGAATAAGGTAACTGTAAATGAGGAAGTCAAA ATATTGGTCGAAATACTCATTGCAGTTGAagctctctaatttgatcttca aaagaaattgaattttcatcgaataagggagcgtcgtttatgagagttta ttgttgacggggactttaaatttcatcgaataaggggccccccgaatagt agaacgtcgagtTAGAGAGCGCCAATTGTACTTACTTCACGTTGTACTTA CTCAAATGCACTTTACTTTTGCAAAAATTGAACAATGAGgtaaatatttt atattttccatttctttttcaCAGGCTTTTGGATTTTTCGGATGTATTGG TTTAGGCGCACAAGCCTTTTTACATTTCCGCGAATGGCGTCAAAAATCGG CCGGTGGACTTCATAGCGCCACAAAGTCTTCAGGTGACGGAGCTGATGTT GAATAGGATTCTTACACGTATTATAAACATGTATCATAAAATGCTGATAT CAGCACAAAGTctaaatataaatttttcaattttatcttttacgaatttt atcttgaaataattttatgATCGTTATGACCACTCGATGTATATTTTAAC GAATACTATTCTATGAAATTTCATTTACTGATCATTCTTCaaaacgattt taaaattttttattttttccaggAGTTTAAGACGGGGTCAAAATGCTTTC AAATCTCACAATCTGAAAACATCTATCTAAACTGAATCTTATTCTACTTT CATTAATGTTAATGagcttttaaaaatgatttgtaactttttaagtattt tgaccctttttcaaGCATTTTGAAAC

Coding sequence (CDS) from alignment at sc0000018:669439..672664+

>TCONS_00002055 ID=TCONS_00002055|Name=TCONS_00002055|organism=Clytia hemisphaerica|type=CDS|length=2256bp|location=Sequence derived from alignment at sc0000018:669439..672664+ (Clytia hemisphaerica)
ATGGATGATGAAGTAGGTCAAGGAACATACGAAGGTCGAAGACAGCAAGG
TTTCACCCTCGATTTCGTTCGCTCACCACCTGGTATCCTATTGGTTGTCA
ATACGGTTATTTTGTTTCTGTGCTGGACCATCATAGCTGGTTGGAGGACG
CAAGTTCATCCATACATCGGAGTTTATTATGAGGGAAATACTGGATATTA
CCTCACAACCACCATCATACCATTTCTTATTCTGTTGACCGTCTTTGTGC
TTAAGATGTTAAGACTGCACAAGAAAATTCCCAAAATCGTCAATTGGTCT
TTGACAATGGCAATCAATTGTGCTGTTTGGTCGGTGCTTCTCTTCATCTC
GTCCTGTGTGGTGGGTGACATGGCAAGAAAATTGAATCCTGCATGTGAAG
TTTATTTATGTCATCATCTTGGCGCATGCGCGGCTTTTGGATTTTTCGGA
TGTATTGGTTTAGGCGCACAAGCCTTTTTACATTTCCGCGAATGGCGTCA
AAAATCGGCCGGTGGACTTCATAGCGCCACAAAGTCTTCAGGTGACGGAG
CTGATGTTGAATAGATGGATGATGAAGTAGGTCAAGGAACATACGAAGGT
CGAAGACAGCAAGGTTTCACCCTCGATTTCGTTCGCTCACCACCTGGTAT
CCTATTGGTTGTCAATACGGTTATTTTGTTTCTGTGCTGGACCATCATAG
CTGGTTGGAGGACGCAAGTTCATCCATACATCGGAGTTTATTATGAGGGA
AATACTGGATATTACCTCACAACCACCATCATACCATTTCTTATTCTGTT
GACCGTCTTTGTGCTTAAGATGTTAAGACTGCACAAGAAAATTCCCAAAA
TCGTCAATTGGTCTTTGACAATGGCAATCAATTGTGCTGTTTGGTCGGTG
CTTCTCTTCATCTCGTCCTGTGTGGTGGGTGACATGGCAAGAAAATTGAA
TCCTGCATGTGAAGTTTATTTATGTCATCATCTTGGCGCATGCGCGGCTT
TTGGATTTTTCGGATGTATTGGTTTAGGCGCACAAGCCTTTTTACATTTC
CGCGAATGGCGTCAAAAATCGGCCGGTGGACTTCATAGCGCCACAAAGTC
TTCAGGTGACGGAGCTGATGTTGAATAGATGGATGATGAAGTAGGTCAAG
GAACATACGAAGGTCGAAGACAGCAAGGTTTCACCCTCGATTTCGTTCGC
TCACCACCTGGTATCCTATTGGTTGTCAATACGGTTATTTTGTTTCTGTG
CTGGACCATCATAGCTGGTTGGAGGACGCAAGTTCATCCATACATCGGAG
TTTATTATGAGGGAAATACTGGATATTACCTCACAACCACCATCATACCA
TTTCTTATTCTGTTGACCGTCTTTGTGCTTAAGATGTTAAGACTGCACAA
GAAAATTCCCAAAATCGTCAATTGGTCTTTGACAATGGCAATCAATTGTG
CTGTTTGGTCGGTGCTTCTCTTCATCTCGTCCTGTGTGGTGGGTGACATG
GCAAGAAAATTGAATCCTGCATGTGAAGTTTATTTATGTCATCATCTTGG
CGCATGCGCGGCTTTTGGATTTTTCGGATGTATTGGTTTAGGCGCACAAG
CCTTTTTACATTTCCGCGAATGGCGTCAAAAATCGGCCGGTGGACTTCAT
AGCGCCACAAAGTCTTCAGGTGACGGAGCTGATGTTGAATAGATGGATGA
TGAAGTAGGTCAAGGAACATACGAAGGTCGAAGACAGCAAGGTTTCACCC
TCGATTTCGTTCGCTCACCACCTGGTATCCTATTGGTTGTCAATACGGTT
ATTTTGTTTCTGTGCTGGACCATCATAGCTGGTTGGAGGACGCAAGTTCA
TCCATACATCGGAGTTTATTATGAGGGAAATACTGGATATTACCTCACAA
CCACCATCATACCATTTCTTATTCTGTTGACCGTCTTTGTGCTTAAGATG
TTAAGACTGCACAAGAAAATTCCCAAAATCGTCAATTGGTCTTTGACAAT
GGCAATCAATTGTGCTGTTTGGTCGGTGCTTCTCTTCATCTCGTCCTGTG
TGGTGGGTGACATGGCAAGAAAATTGAATCCTGCATGTGAAGTTTATTTA
TGTCATCATCTTGGCGCATGCGCGGCTTTTGGATTTTTCGGATGTATTGG
TTTAGGCGCACAAGCCTTTTTACATTTCCGCGAATGGCGTCAAAAATCGG
CCGGTGGACTTCATAGCGCCACAAAGTCTTCAGGTGACGGAGCTGATGTT
GAATAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_001081XLOC_001081Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00002055-exon-sc0000018-1491911889:669439..669638TCONS_00002055-exon-sc0000018-1491911889:669439..669638Clytia hemisphaericaexon
TCONS_00002055-exon-sc0000018-1510915933:669439..669638TCONS_00002055-exon-sc0000018-1510915933:669439..669638Clytia hemisphaericaexon
TCONS_00002055-exon-sc0000018-1575043694:669439..669638TCONS_00002055-exon-sc0000018-1575043694:669439..669638Clytia hemisphaericaexon
TCONS_00002055-exon-sc0000018-1491911889:670034..670234TCONS_00002055-exon-sc0000018-1491911889:670034..670234Clytia hemisphaericaexon
TCONS_00002055-exon-sc0000018-1510915933:670034..670234TCONS_00002055-exon-sc0000018-1510915933:670034..670234Clytia hemisphaericaexon
TCONS_00002055-exon-sc0000018-1575043694:670034..670234TCONS_00002055-exon-sc0000018-1575043694:670034..670234Clytia hemisphaericaexon
TCONS_00002055-exon-sc0000018-1491911889:671049..671174TCONS_00002055-exon-sc0000018-1491911889:671049..671174Clytia hemisphaericaexon
TCONS_00002055-exon-sc0000018-1510915933:671049..671174TCONS_00002055-exon-sc0000018-1510915933:671049..671174Clytia hemisphaericaexon
TCONS_00002055-exon-sc0000018-1575043694:671049..671174TCONS_00002055-exon-sc0000018-1575043694:671049..671174Clytia hemisphaericaexon
TCONS_00002055-exon-sc0000018-1491911889:672163..672664TCONS_00002055-exon-sc0000018-1491911889:672163..672664Clytia hemisphaericaexon
TCONS_00002055-exon-sc0000018-1510915933:672163..672664TCONS_00002055-exon-sc0000018-1510915933:672163..672664Clytia hemisphaericaexon
TCONS_00002055-exon-sc0000018-1575043694:672163..672664TCONS_00002055-exon-sc0000018-1575043694:672163..672664Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00002055-proteinTCONS_00002055-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000018supercontigsc0000018:669439..672664 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
4.28329 4.0925 0.979749 1.10231 5.71791 4.19563 40.6616 40.6186 53.5219 48.999 43.79 28.8146 38.5867 34.1559 41.9369 54.8915 25.4962 18.9421 32.5625 30.9941 13.7208 13.283 13.0964 10.0123 11.8918 17.9926 1.89842 3.60889 25.9796 20.5001
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR008253Marvel
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0016020 membrane
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00002055 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top