Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00002043 (transcript) - C. hemisphaerica

Overview
NameTCONS_00002043
Unique NameTCONS_00002043
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1302

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00002043 ID=TCONS_00002043|Name=TCONS_00002043|organism=Clytia hemisphaerica|type=transcript|length=1302bp
CGTGcagcccggcaatcgtccttgcAAGAACGTCTTGCGCCGTGCCATAA
ACCTCTAGCATTTTTATAGATATTCTTGCTCGTACATcattgaaaatcat
tttcatcgcttgcattatttttaatttcgttttagttaatttaagaaatt
aaaagaaaaattaataaacataACAAAATACAACAGAATATAATTAGAGA
ACTTCCAAAGATGTCGTCACCGAAATTGAAAACTGCTCTTGGAAATATTG
TTGCTGCTGAAAAAGCccTGAAGACATCCATGTTTAAATGGTCACCTGAT
TATGACACAGCGGCCAGTGAATACACAAAAGCAGCTACCAATTTCAAGCT
GGCTGGTTCAGCAGAGAAAGCACAAGACGCCTACATTAAAGCCTCGCAGA
TGCAAGAAAAGCTTGGATCGTTATTCCATGCAGCTAAGCTTTTGACACAG
GCAGCAGGGATTGCATCAGATCTCAAAAATCTTGAGGAAGCTGTTACTTT
AATGCAAAGAGCGTGTTCGTTATACAGAGAGCATGGTACCCCAGATACAG
CCGCACTCACTATATCCAAAGCTGCTAAAATGTGTGAAACAGGACTACCA
AGTAAAGCTACAGAGATGTATCTACTAGCTGCAGAGCTATGCGAAAACGA
TGAGAAATTGCGAGACTCGGCAGACCATTTGAATAACGCAGTGAGGATGG
AACTCAAACAGAAAAAATACAAAGAAGCGGCCACTATAATGAAGCAACGA
TGTGAACTcttcaaaaaacttcaaaatcctAATAACGCACACCAGCTAAC
CCTATGCATGGCGATCGTGTATTTGGCTGCTGGAGATTTCGTGCAAGCGG
AAACAGCTTTCAAGGATGGTTTTGAAGTTGATCGTTTTGGTGACAGTGAT
GAAGCGATGTATACCGAACAATTTCTCAAAGCCTACCAAGAATATGATGC
GGAATTACTCAATCAAACGAAATCAGCTCCTCTCGTCAAATATTTAGATA
CTGAGATTGCACGCCTCGCCAAAACACTTGAACTGTCAACCTGTAAAAAC
ATTCCATCCAAACTTGACATCGGTGGTAAAAGTGAATTGGAACAATTTGA
AGACCAGTTGGGTGATCAAGACAAAGTTGCTGGTGACATCGAGCAAAATA
ATGAAGCAGATGAAGGAGAAGTTGAAGGGATGCTTTGTTGAGGAAGAAAA
GTTTTCCTTGATTTCATTTGGAAGATTATTCTATCAGGGAAGAAAGTGGG
GGGGGGAGTTTAAGAACACCTCACCGGATGAAATTTGATCACATCCTTAA
AA
Run BLAST on NCBI

protein sequence of TCONS_00002043-protein

>TCONS_00002043-protein ID=TCONS_00002043-protein|Name=TCONS_00002043-protein|organism=Clytia hemisphaerica|type=polypeptide|length=326bp
MSSPKLKTALGNIVAAEKALKTSMFKWSPDYDTAASEYTKAATNFKLAGS
AEKAQDAYIKASQMQEKLGSLFHAAKLLTQAAGIASDLKNLEEAVTLMQR
ACSLYREHGTPDTAALTISKAAKMCETGLPSKATEMYLLAAELCENDEKL
RDSADHLNNAVRMELKQKKYKEAATIMKQRCELFKKLQNPNNAHQLTLCM
AIVYLAAGDFVQAETAFKDGFEVDRFGDSDEAMYTEQFLKAYQEYDAELL
NQTKSAPLVKYLDTEIARLAKTLELSTCKNIPSKLDIGGKSELEQFEDQL
GDQDKVAGDIEQNNEADEGEVEGMLC
Run BLAST on NCBI

transcript from alignment at sc0000018:449555..456964+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00002043 ID=TCONS_00002043|Name=TCONS_00002043|organism=Clytia hemisphaerica|type=transcript|length=7410bp|location=Sequence derived from alignment at sc0000018:449555..456964+ (Clytia hemisphaerica)
CGTGcagcccggcaatcgtccttgcAAGAACGTCTTGCGCCGTGCCATAA ACCTCTAGCATTTTTATAGATATTCTTGCTCGTACATcattgaaaatcat tttcatcgcttgcattatttttaatttcgttttagttaatttaagaaatt aaaagaaaaattaataaacataACAAAATACAACAGAATATAATTAGAGA ACTTCCAAAGATGTCGTCACCGAAATTGAAAACTGCTCTTGGAAATATTG TTGCTGCTGAAAAAGCGTAAGTATTTAtaagacacttttttataagaacg atatttttttcattatatcATCGAAATTTTTTCAGGGAAAATCGTCCtgt tcttacagtattcttaggttaggatccaaatTCAACCAAAATTAACTGAA TGTagcatgtaatacatacctgaaccataaaatggcacttttagCGCTAC TGAGGGATGATTATCAATTTACAGTTATCTATTAcagtcactgaccttta tatatccctggaccaagctatatccaccttctttgatcggagttttttag gaattggtacccgtaaagaagccattgcagtgttaaaaatgaACGTCTAA CGGCGATACATCATCAAAAGGggaagtagatctagcgctctcactgtatt tacaccgctattgagtggTGCCGCCATTAGgataccacttttcaaaaaac tccgatcaaagatttagcatggccgggattgagaaacatGGTCTAGAGtg tataaaggtcagtgaataCAGTATGTATTTCAgtttattcaatttatttt aTACAACAATTAAATAAGTAAAGAACACATGGTCTCCAAAATCGTTCTTG TAatacattttgtatttttgttttcaattatagCCTGAAGACATCCATGN AAATCGTTCttgtaataaatttttatttttaattttagccTGAAGACATC CATGTTTAAATGGTCACCTGATTATGACACAGCGGCCAGTGAATACACAA AAGCAGGTTTGACTTTCATGTTTTTTCTCCAAACtaccttaaaagaagaa attttggtaggaatttaatttggcggatgaccgaaaaagttttttagagg gaatttaatttggtggatggacgaaaaaactaaatttggcgggaatttaa tttggcgtttgctgaaaaatgtatccttaaaatggcgtaaaaacagcaaa aaaaaatacaaaaacaccTTAACAGAGATCATATTTCCAAAAAGTTTAAt atggcgggaacttaattttggcggattctggccaaatccgccaaatccgt caaattcgccaaattttctttccgccaaaatttcttcctttaaggtagag CAACTGCATTGCattagagtctctttaactcgaacctctacaaatctaat gtctccttaactcgaaataGTTtgctcgtcccttcagttaacaatgcctt ataaatcttactccataactcgaattaATCGAACataaatttccttaact cgaacaagtttgtcTTTCCCGTCAGTTGTCGAGTTATGGATAGACTCAAC TGTATTAAAACTTCTACAATCCGATTTATAGAAACTTGTTATAAGGGTTT ATACTCTACATGATGAAGAGTCGTTCAAGTTAAAGAGACATCCGAGTTGA TAGAGACTTTACTATAATAGAGTGACCCATTGCAATGTCTCCTGGCATTG CATCATAGACCAATCATggatccaacagctgattggttgtaagtgacgta aaatcggTCAATACGTCACtaacaaccaatcagctgttgagtcctttgaa gacattgcaatggtgcatataatGAATAGTAGAATGTCCCTCTTAAGGTC TATGTGTTTACGGCCTTTATATTTCTTTGAGGTTTgtttttcattctttt cttttttgcttcatttttctaaGCTACCAATTTCAAGCTGGCTGGTTCAG CAGAGAAAGCACAAGACGCCTACATTAAAGCCTCGCAGATGCAAGAAAAG CTTGGATCGTTATTCCATGCAGCTAAGTAAGTTAAACACTTATGATTTCA TTCGACTCTTAAACTAATGTTAGCATTCCAACATAACACCCTTCTAGGGT CTCCTGGGGATGCACATTTGGCAAAACACCCTCCTCGAGGTCCCTCAAAG agtttaaaaacctgaaaaagtaAGCCAATCTCTGAAAGGGCTCAACAATt actaaaaattcaaattgaccCCCCTTAACGGGTCataaatccttaaaatt tctATCATATATAATAATTTTGCCTGAAACTTTTAAGAAAATaccgattt ttgaaatttagcatGGACCTACCCGTCATCTCGCACATATAATTACCCGC AGGTATCACTAGATACCTTTAGATTATTGTTGATAGTTGGTAGTGCTTTT TCTTTGTTGACGTAATATCTCCCCTTTAACTCAGGATTTTCGTTTCAGTT ATCTTTCCATAGTAATCATATATACTTTCCGTACTTTTTTTGCAGGCTTT TGACACAGGCAGCAGGGATTGCATCAGATCTCAAAAATCTTGAGGAAGCT GTTACTTTAATGCAAAGAGCGTGGTATGAAAATCATTTTCCTAATTTATT TATGGAACTCTTTTGTTTGATGGTTTACCCCTTTTTGGTTAAGGGGACTA GATATTTTCAAGTTTCCTACAAAAGAGGGCCCAACAAAGTTTTGACTTTC TAGGGAACCTAAGACAAATGGGTTGACTTATTTTCCCCTGAGATGGGTGT TGAGAGATGTTGGCCAACCTTATCAATCCCAAGGCTTATGGTAAGAACTA ACGTCATTTCCCCGGCTGCAGAGACATAATAAAGTTGAATAAGGTTTCCG TTTTCGTTTCTGAGGCTTCCAATGTTTGCAGATAACTATCATTGTATTTA CTTTTGTTTAGTTCGTTATACAGAGAGCATGGTACCCCAGATACAGCCGC ACTCACTATATCCAAAGCTGCTAAGTATgtatttctcaaaatttatttct tcGATAATTAAAACATTACAAATTACTTCTGCTAATGTAATCGTCTGTAA CTATAATGAAACGATTCTATGAGCAGACTTATGGATACCTACGGAAGGTT GTGAAAAGGttattaattttattgaaatatgtTCTAGTGGATTTGTAAGA GGTAAGATAATGGTGattgttgttattattaccccaattttttcaataat aataatacccCGATTTTTGCTTCATGTCAGGCATTCCCATATCTTACTTT TTTACTCTTTAGAATGTGTGAAACAGGACTACCAAGTAAAGCTACAGAGA TGTATCTACTAGCTGCAGAGCTATGCGAAgtatgttttgaatttcttcCC AAGGAAACGTTCTTTGAGAGTCTTCAACCTTCTGTGTTTCTTGGAAAATG CTTCTCTTCCCAATATTTCCCCTTGAGATATTATATATACTTTGTCGCAA TTAGGTTTAGGGAGACTGAAGGTGTGGATccgttaaaattttattttcta ttatggggggggggtcaaacCCTTAAAACATTATGATCATCTACTAGAAA ATATCAATCAACCCTCTGTCTTTCATAGCTTTACTTTCACCTTTAGTTAG ATTTCTCCCAATTTTTCAATAGAACGATGAGAAATTGCGAGACTCGGCAG ACCATTTGAATAACGCAGTGAGGATGGAACTCAAACAGAAAAAGTAGGTT GTTTGCAAATAATACTGtcaccaaaaaatttaattatcaGTAGCGTATTG CCCTCCCCCCCTCTCCAAGCGGCCGATTTTTTTGGGGGGCGCCGAAATAC AAAGGGTGCAAAAAGACGCCTCCGATTACAAATTTCGCTGCCCATTCGCT CTTTTATAGCAGTTTTCGACCAAGTTttcgtgctcgcttcgctcgcgtca TTTTtacaaagacatttactttttaTAGAGGgggccaaaatccaaattta ctaaaattCCCTCTCCTTAGAACGAGATAAAAATTGTGTCGAAAAACCCT AGTTCTCTTTTAGTTTGCCAACTATTCTAAAAGTAATGTTGAGacccttt aactcgaacaatttttaTGGTCGACCATCCAGTTAACAATGCTTTATGAA CATTACtcccataactcgaaatttccttaacacTCGAATAAATTTTTTGA TCCCTGTGCGTGTTCCAGTTATAAAAACTCTATTGTAGCTTACAGTTATT CTTACTCTAACCTGGTTTGCTTTCAGATACAAAGAAGCGGCCACTATAAT GAAGCAACGATGTGAACTcttcaaaaaacttcaaaatcctAATAACGCAC ACCAGGTAAAATATTTATTGGCGATGCCCGAATTTTCAACTCTTGAACCT AACTGAATTTTGACATCTAGATTGTAAATAATCCTTCAGATGGCTACATT ATTCCACAGTGGTTTCATTCTTACGAAGAAAAGTGATTTAGAAACTCCAT GCTGTCTGCGTGGCTTAGCCCTTAGACCACGAGGGACGTGTATATGcgtc caaaacaagccaaaatactgagtctcagacttgaggccatagttcctgac cacttgatttaaagggacataaaataGCTCTCCAATGGTATCAAAACCAT CTTCTATTAATCAAAAGCTGCaagcttttatggcactttaaagttttgag tttcaaaaaaaagatttagaaaaacttcaactttttcaaaaaaaaaacag cgcgcACAAAGAGTTAAAGTAAAACTTTCTAAATTTGTTTGAGGActcca aatttctaaaaatgactgaaaatcatATGATAAAATGGTATCTGATttga atgaaattgttttgatccttaaaaataattttcaaaggtCTCTAAGTTTT CCTGGCTGCTTTGACGATTTCTACATATTCGGTGGTATAGCACCTTAAGA TGTTCAAGAGGTTCAAAATGATTGTCTTCCTTTTCTTTCAGCTAACCCTA TGCATGGCGATCGTGTATTTGGCTGCTGGAGATTTCGTGCAAGCGGAAAC AGCTTTCAAGGATGGTTTTGAGTAAGTGTTGACTGTTTTACGTATTTTAT TAAAAGACTTATCGAAACTGGTGGTAAAGAGATCCAATTTTTTTGGTTGG CCAGGTTGCTAAGGCTTGAGGAAGGCTCAAATAGCCCATTTTTTCACTGT ACCCTTTCAAGGAGTGATTCGGTGGATATTCTACACTCTATACAGCATTA CATGGGATGTCATGGTACAAAATTATACAAAATTCACAAAGTGGCTCTGA GAGAGTATAACTTCTCTGTATTGTTTCAAAATCACTCTTCTTGGGACTAG ATGGGGTTTTACAAGCTCTTAATTGATTTTATTGGTCGTTAGCCAgtaat aaaagaattttgttactttttctaaaggacctgtcatttttattacttca aatgaccaattattaaagtatcttataaaaaattccATCTCGTATGCTCC TCTTCATGTATTTGCAGAGTTGATCGTTTTGGTGACAGTGATGAAGCGAT GTATACCGAACAATTTCTCAAAGCCTACCAAGAATATGATGCGGAATTAC TCAATCAAACGAAATCAGCTCCTCTCGTCAAATATTTAGATACTGAGGTA ATTATTAACTAATCCATCTGAAGATTATGTCTTTCAAAATAGTTTTTAAT TAAACATAGTAGGTGGCAACTCTTAGTATCCATAACATCAATGTCAATTG AATCCATATATTCTGGAGGTTATGAATTTTGCCTTTAATTTCAGTTTTTG GCCAtaatagtctagcaagctagacgactaattcagacatggtagaaata aagcaaaaagtgatggagggaacaattttagtttatacaaactaaaccCC GTAACAATAATtttattatcatataacgcctatactactgtattacacgc attataaacgactccagtctaggcCATAAAGACCAGACCCcttctcaaaa aagtttaaatatcCTATCCCTTTCGAAGCAATAACATGCGGTTGCGTCCA AGGGTCAAAGGAAAGGTCCTACGGATTCTAAGGGTTGCTCCCTTACTAAA AGTGAACTAAATTGAGTTGGGTGGAGGCCTAAAGAAAGTTCAACGACCAT TGAAACAGTGCTGGACACTTCGTTtagctcagaatttcatgctctatcag atCGAATCAAtctttttcgtttattttgacttttgaaaatcagctatttt CCTACCCCtattattttcccttgcagttttgcctatggcgtcactatttt gatcataaaaagttttcccgggcctaaccTGCGTCCTCCCtcttaaaaat atcttgtaatatactgttctttggaatagacttaAAATGGCTAGGTTGTA AAAAAAATGTCACGGGACCCCAGGCTTGCCCCCTACTAAATAATAGGGGG GGATGTTAGGactaattttttaagcccatttgtcaaaagttgcctttggg tataaaaagaagaaaaattcatgtaaaaacccTGTGGTacttttttcaag gttgccacGGGTAGGGTGCCACCGCCGCTCCGCcagcaaaattgaaattt caaaaaaatttaaaacataggGAAGTGACCCCttatttgaaaggtatttt catgctgattaagaaaatcaatattgtaAGGGTGAAAAACACTCTAACAA GAAGTAACTTAagaaaaacgatcaaaaaattgcgtttttagcaaaatcct caaaattttgccAACTGTCGGAAATTACATTTTGTGACAGTGTTATTTAA CCACATTATATTGactttcttaatcagcatgaaaatacctttcaaatgag gggtcacttcactatgttttgaaaatttttgaaatttcgattttgctggA GGAGCGACGGTGGCACCCTGCCCGTGGCAACCTTGAAAAGGGTGCCAAAG GGTTTTAacatgattttttcttctttttatacccaaaggcaacttttgac aaatgggctaagaatttatgccatttttgcaaaataacttCCCCCCCTAT AAATAACACGTTGCATATTTCCAAAGAATCATAAAATTTAGAGAATtatt gaatgaatttttttaaataacaacAGTTTTGAAATAATCCATGATTCGGC TTCATTTCCATAGATTGCACGCCTCGCCAAAACACTTGAACTGTCAACCT GTAAAAACATTCCATCCAAACTTGACATCGGTGGTAAAAGTGAATTGGAA CAATTTGAAGACCAGTTGGGTGATCAAGACAAAGTTGCTGGTGACATCGA GCAAAATAATGAAGCAGATGAAGGAGAAGTTGAAGGGATGCTTTGTTGAG GAAGAAAAGTTTTCCTTGATTTCATTTGGAAGATTATTCTATCAGGGAAG AAAGTGGGGGGGGGAGTTTAAGAACACCTCACCGGATGAAATTTGATCAC ATCCTTAAAA

Coding sequence (CDS) from alignment at sc0000018:449555..456964+

>TCONS_00002043 ID=TCONS_00002043|Name=TCONS_00002043|organism=Clytia hemisphaerica|type=CDS|length=10791bp|location=Sequence derived from alignment at sc0000018:449555..456964+ (Clytia hemisphaerica)
ATGTCGTCACCGAAATTGAAAACTGCTCTTGGAAATATTGTTGCTGCTGA
AAAAGCccTGAAGACATCCATGTTTAAATGGTCACCTGATTATGACACAG
CGGCCAGTGAATACACAAAAGCAGCTACCAATTTCAAGCTGGCTGGTTCA
GCAGAGAAAGCACAAGACGCCTACATTAAAGCCTCGCAGATGCAAGAAAA
GCTTGGATCGTTATTCCATGCAGCTAAGCTTTTGACACAGGCAGCAGGGA
TTGCATCAGATCTCAAAAATCTTGAGGAAGCTGTTACTTTAATGCAAAGA
GCGTGTTCGTTATACAGAGAGCATGGTACCCCAGATACAGCCGCACTCAC
TATATCCAAAGCTGCTAAAATGTGTGAAACAGGACTACCAAGTAAAGCTA
CAGAGATGTATCTACTAGCTGCAGAGCTATGCGAAAACGATGAGAAATTG
CGAGACTCGGCAGACCATTTGAATAACGCAGTGAGGATGGAACTCAAACA
GAAAAAATACAAAGAAGCGGCCACTATAATGAAGCAACGATGTGAACTct
tcaaaaaacttcaaaatcctAATAACGCACACCAGCTAACCCTATGCATG
GCGATCGTGTATTTGGCTGCTGGAGATTTCGTGCAAGCGGAAACAGCTTT
CAAGGATGGTTTTGAAGTTGATCGTTTTGGTGACAGTGATGAAGCGATGT
ATACCGAACAATTTCTCAAAGCCTACCAAGAATATGATGCGGAATTACTC
AATCAAACGAAATCAGCTCCTCTCGTCAAATATTTAGATACTGAGATTGC
ACGCCTCGCCAAAACACTTGAACTGTCAACCTGTAAAAACATTCCATCCA
AACTTGACATCGGTGGTAAAAGTGAATTGGAACAATTTGAAGACCAGTTG
GGTGATCAAGACAAAGTTGCTGGTGACATCGAGCAAAATAATGAAGCAGA
TGAAGGAGAAGTTGAAGGGATGCTTTGTTGAATGTCGTCACCGAAATTGA
AAACTGCTCTTGGAAATATTGTTGCTGCTGAAAAAGCccTGAAGACATCC
ATGTTTAAATGGTCACCTGATTATGACACAGCGGCCAGTGAATACACAAA
AGCAGCTACCAATTTCAAGCTGGCTGGTTCAGCAGAGAAAGCACAAGACG
CCTACATTAAAGCCTCGCAGATGCAAGAAAAGCTTGGATCGTTATTCCAT
GCAGCTAAGCTTTTGACACAGGCAGCAGGGATTGCATCAGATCTCAAAAA
TCTTGAGGAAGCTGTTACTTTAATGCAAAGAGCGTGTTCGTTATACAGAG
AGCATGGTACCCCAGATACAGCCGCACTCACTATATCCAAAGCTGCTAAA
ATGTGTGAAACAGGACTACCAAGTAAAGCTACAGAGATGTATCTACTAGC
TGCAGAGCTATGCGAAAACGATGAGAAATTGCGAGACTCGGCAGACCATT
TGAATAACGCAGTGAGGATGGAACTCAAACAGAAAAAATACAAAGAAGCG
GCCACTATAATGAAGCAACGATGTGAACTcttcaaaaaacttcaaaatcc
tAATAACGCACACCAGCTAACCCTATGCATGGCGATCGTGTATTTGGCTG
CTGGAGATTTCGTGCAAGCGGAAACAGCTTTCAAGGATGGTTTTGAAGTT
GATCGTTTTGGTGACAGTGATGAAGCGATGTATACCGAACAATTTCTCAA
AGCCTACCAAGAATATGATGCGGAATTACTCAATCAAACGAAATCAGCTC
CTCTCGTCAAATATTTAGATACTGAGATTGCACGCCTCGCCAAAACACTT
GAACTGTCAACCTGTAAAAACATTCCATCCAAACTTGACATCGGTGGTAA
AAGTGAATTGGAACAATTTGAAGACCAGTTGGGTGATCAAGACAAAGTTG
CTGGTGACATCGAGCAAAATAATGAAGCAGATGAAGGAGAAGTTGAAGGG
ATGCTTTGTTGAATGTCGTCACCGAAATTGAAAACTGCTCTTGGAAATAT
TGTTGCTGCTGAAAAAGCccTGAAGACATCCATGTTTAAATGGTCACCTG
ATTATGACACAGCGGCCAGTGAATACACAAAAGCAGCTACCAATTTCAAG
CTGGCTGGTTCAGCAGAGAAAGCACAAGACGCCTACATTAAAGCCTCGCA
GATGCAAGAAAAGCTTGGATCGTTATTCCATGCAGCTAAGCTTTTGACAC
AGGCAGCAGGGATTGCATCAGATCTCAAAAATCTTGAGGAAGCTGTTACT
TTAATGCAAAGAGCGTGTTCGTTATACAGAGAGCATGGTACCCCAGATAC
AGCCGCACTCACTATATCCAAAGCTGCTAAAATGTGTGAAACAGGACTAC
CAAGTAAAGCTACAGAGATGTATCTACTAGCTGCAGAGCTATGCGAAAAC
GATGAGAAATTGCGAGACTCGGCAGACCATTTGAATAACGCAGTGAGGAT
GGAACTCAAACAGAAAAAATACAAAGAAGCGGCCACTATAATGAAGCAAC
GATGTGAACTcttcaaaaaacttcaaaatcctAATAACGCACACCAGCTA
ACCCTATGCATGGCGATCGTGTATTTGGCTGCTGGAGATTTCGTGCAAGC
GGAAACAGCTTTCAAGGATGGTTTTGAAGTTGATCGTTTTGGTGACAGTG
ATGAAGCGATGTATACCGAACAATTTCTCAAAGCCTACCAAGAATATGAT
GCGGAATTACTCAATCAAACGAAATCAGCTCCTCTCGTCAAATATTTAGA
TACTGAGATTGCACGCCTCGCCAAAACACTTGAACTGTCAACCTGTAAAA
ACATTCCATCCAAACTTGACATCGGTGGTAAAAGTGAATTGGAACAATTT
GAAGACCAGTTGGGTGATCAAGACAAAGTTGCTGGTGACATCGAGCAAAA
TAATGAAGCAGATGAAGGAGAAGTTGAAGGGATGCTTTGTTGAATGTCGT
CACCGAAATTGAAAACTGCTCTTGGAAATATTGTTGCTGCTGAAAAAGCc
cTGAAGACATCCATGTTTAAATGGTCACCTGATTATGACACAGCGGCCAG
TGAATACACAAAAGCAGCTACCAATTTCAAGCTGGCTGGTTCAGCAGAGA
AAGCACAAGACGCCTACATTAAAGCCTCGCAGATGCAAGAAAAGCTTGGA
TCGTTATTCCATGCAGCTAAGCTTTTGACACAGGCAGCAGGGATTGCATC
AGATCTCAAAAATCTTGAGGAAGCTGTTACTTTAATGCAAAGAGCGTGTT
CGTTATACAGAGAGCATGGTACCCCAGATACAGCCGCACTCACTATATCC
AAAGCTGCTAAAATGTGTGAAACAGGACTACCAAGTAAAGCTACAGAGAT
GTATCTACTAGCTGCAGAGCTATGCGAAAACGATGAGAAATTGCGAGACT
CGGCAGACCATTTGAATAACGCAGTGAGGATGGAACTCAAACAGAAAAAA
TACAAAGAAGCGGCCACTATAATGAAGCAACGATGTGAACTcttcaaaaa
acttcaaaatcctAATAACGCACACCAGCTAACCCTATGCATGGCGATCG
TGTATTTGGCTGCTGGAGATTTCGTGCAAGCGGAAACAGCTTTCAAGGAT
GGTTTTGAAGTTGATCGTTTTGGTGACAGTGATGAAGCGATGTATACCGA
ACAATTTCTCAAAGCCTACCAAGAATATGATGCGGAATTACTCAATCAAA
CGAAATCAGCTCCTCTCGTCAAATATTTAGATACTGAGATTGCACGCCTC
GCCAAAACACTTGAACTGTCAACCTGTAAAAACATTCCATCCAAACTTGA
CATCGGTGGTAAAAGTGAATTGGAACAATTTGAAGACCAGTTGGGTGATC
AAGACAAAGTTGCTGGTGACATCGAGCAAAATAATGAAGCAGATGAAGGA
GAAGTTGAAGGGATGCTTTGTTGAATGTCGTCACCGAAATTGAAAACTGC
TCTTGGAAATATTGTTGCTGCTGAAAAAGCccTGAAGACATCCATGTTTA
AATGGTCACCTGATTATGACACAGCGGCCAGTGAATACACAAAAGCAGCT
ACCAATTTCAAGCTGGCTGGTTCAGCAGAGAAAGCACAAGACGCCTACAT
TAAAGCCTCGCAGATGCAAGAAAAGCTTGGATCGTTATTCCATGCAGCTA
AGCTTTTGACACAGGCAGCAGGGATTGCATCAGATCTCAAAAATCTTGAG
GAAGCTGTTACTTTAATGCAAAGAGCGTGTTCGTTATACAGAGAGCATGG
TACCCCAGATACAGCCGCACTCACTATATCCAAAGCTGCTAAAATGTGTG
AAACAGGACTACCAAGTAAAGCTACAGAGATGTATCTACTAGCTGCAGAG
CTATGCGAAAACGATGAGAAATTGCGAGACTCGGCAGACCATTTGAATAA
CGCAGTGAGGATGGAACTCAAACAGAAAAAATACAAAGAAGCGGCCACTA
TAATGAAGCAACGATGTGAACTcttcaaaaaacttcaaaatcctAATAAC
GCACACCAGCTAACCCTATGCATGGCGATCGTGTATTTGGCTGCTGGAGA
TTTCGTGCAAGCGGAAACAGCTTTCAAGGATGGTTTTGAAGTTGATCGTT
TTGGTGACAGTGATGAAGCGATGTATACCGAACAATTTCTCAAAGCCTAC
CAAGAATATGATGCGGAATTACTCAATCAAACGAAATCAGCTCCTCTCGT
CAAATATTTAGATACTGAGATTGCACGCCTCGCCAAAACACTTGAACTGT
CAACCTGTAAAAACATTCCATCCAAACTTGACATCGGTGGTAAAAGTGAA
TTGGAACAATTTGAAGACCAGTTGGGTGATCAAGACAAAGTTGCTGGTGA
CATCGAGCAAAATAATGAAGCAGATGAAGGAGAAGTTGAAGGGATGCTTT
GTTGAATGTCGTCACCGAAATTGAAAACTGCTCTTGGAAATATTGTTGCT
GCTGAAAAAGCccTGAAGACATCCATGTTTAAATGGTCACCTGATTATGA
CACAGCGGCCAGTGAATACACAAAAGCAGCTACCAATTTCAAGCTGGCTG
GTTCAGCAGAGAAAGCACAAGACGCCTACATTAAAGCCTCGCAGATGCAA
GAAAAGCTTGGATCGTTATTCCATGCAGCTAAGCTTTTGACACAGGCAGC
AGGGATTGCATCAGATCTCAAAAATCTTGAGGAAGCTGTTACTTTAATGC
AAAGAGCGTGTTCGTTATACAGAGAGCATGGTACCCCAGATACAGCCGCA
CTCACTATATCCAAAGCTGCTAAAATGTGTGAAACAGGACTACCAAGTAA
AGCTACAGAGATGTATCTACTAGCTGCAGAGCTATGCGAAAACGATGAGA
AATTGCGAGACTCGGCAGACCATTTGAATAACGCAGTGAGGATGGAACTC
AAACAGAAAAAATACAAAGAAGCGGCCACTATAATGAAGCAACGATGTGA
ACTcttcaaaaaacttcaaaatcctAATAACGCACACCAGCTAACCCTAT
GCATGGCGATCGTGTATTTGGCTGCTGGAGATTTCGTGCAAGCGGAAACA
GCTTTCAAGGATGGTTTTGAAGTTGATCGTTTTGGTGACAGTGATGAAGC
GATGTATACCGAACAATTTCTCAAAGCCTACCAAGAATATGATGCGGAAT
TACTCAATCAAACGAAATCAGCTCCTCTCGTCAAATATTTAGATACTGAG
ATTGCACGCCTCGCCAAAACACTTGAACTGTCAACCTGTAAAAACATTCC
ATCCAAACTTGACATCGGTGGTAAAAGTGAATTGGAACAATTTGAAGACC
AGTTGGGTGATCAAGACAAAGTTGCTGGTGACATCGAGCAAAATAATGAA
GCAGATGAAGGAGAAGTTGAAGGGATGCTTTGTTGAATGTCGTCACCGAA
ATTGAAAACTGCTCTTGGAAATATTGTTGCTGCTGAAAAAGCccTGAAGA
CATCCATGTTTAAATGGTCACCTGATTATGACACAGCGGCCAGTGAATAC
ACAAAAGCAGCTACCAATTTCAAGCTGGCTGGTTCAGCAGAGAAAGCACA
AGACGCCTACATTAAAGCCTCGCAGATGCAAGAAAAGCTTGGATCGTTAT
TCCATGCAGCTAAGCTTTTGACACAGGCAGCAGGGATTGCATCAGATCTC
AAAAATCTTGAGGAAGCTGTTACTTTAATGCAAAGAGCGTGTTCGTTATA
CAGAGAGCATGGTACCCCAGATACAGCCGCACTCACTATATCCAAAGCTG
CTAAAATGTGTGAAACAGGACTACCAAGTAAAGCTACAGAGATGTATCTA
CTAGCTGCAGAGCTATGCGAAAACGATGAGAAATTGCGAGACTCGGCAGA
CCATTTGAATAACGCAGTGAGGATGGAACTCAAACAGAAAAAATACAAAG
AAGCGGCCACTATAATGAAGCAACGATGTGAACTcttcaaaaaacttcaa
aatcctAATAACGCACACCAGCTAACCCTATGCATGGCGATCGTGTATTT
GGCTGCTGGAGATTTCGTGCAAGCGGAAACAGCTTTCAAGGATGGTTTTG
AAGTTGATCGTTTTGGTGACAGTGATGAAGCGATGTATACCGAACAATTT
CTCAAAGCCTACCAAGAATATGATGCGGAATTACTCAATCAAACGAAATC
AGCTCCTCTCGTCAAATATTTAGATACTGAGATTGCACGCCTCGCCAAAA
CACTTGAACTGTCAACCTGTAAAAACATTCCATCCAAACTTGACATCGGT
GGTAAAAGTGAATTGGAACAATTTGAAGACCAGTTGGGTGATCAAGACAA
AGTTGCTGGTGACATCGAGCAAAATAATGAAGCAGATGAAGGAGAAGTTG
AAGGGATGCTTTGTTGAATGTCGTCACCGAAATTGAAAACTGCTCTTGGA
AATATTGTTGCTGCTGAAAAAGCccTGAAGACATCCATGTTTAAATGGTC
ACCTGATTATGACACAGCGGCCAGTGAATACACAAAAGCAGCTACCAATT
TCAAGCTGGCTGGTTCAGCAGAGAAAGCACAAGACGCCTACATTAAAGCC
TCGCAGATGCAAGAAAAGCTTGGATCGTTATTCCATGCAGCTAAGCTTTT
GACACAGGCAGCAGGGATTGCATCAGATCTCAAAAATCTTGAGGAAGCTG
TTACTTTAATGCAAAGAGCGTGTTCGTTATACAGAGAGCATGGTACCCCA
GATACAGCCGCACTCACTATATCCAAAGCTGCTAAAATGTGTGAAACAGG
ACTACCAAGTAAAGCTACAGAGATGTATCTACTAGCTGCAGAGCTATGCG
AAAACGATGAGAAATTGCGAGACTCGGCAGACCATTTGAATAACGCAGTG
AGGATGGAACTCAAACAGAAAAAATACAAAGAAGCGGCCACTATAATGAA
GCAACGATGTGAACTcttcaaaaaacttcaaaatcctAATAACGCACACC
AGCTAACCCTATGCATGGCGATCGTGTATTTGGCTGCTGGAGATTTCGTG
CAAGCGGAAACAGCTTTCAAGGATGGTTTTGAAGTTGATCGTTTTGGTGA
CAGTGATGAAGCGATGTATACCGAACAATTTCTCAAAGCCTACCAAGAAT
ATGATGCGGAATTACTCAATCAAACGAAATCAGCTCCTCTCGTCAAATAT
TTAGATACTGAGATTGCACGCCTCGCCAAAACACTTGAACTGTCAACCTG
TAAAAACATTCCATCCAAACTTGACATCGGTGGTAAAAGTGAATTGGAAC
AATTTGAAGACCAGTTGGGTGATCAAGACAAAGTTGCTGGTGACATCGAG
CAAAATAATGAAGCAGATGAAGGAGAAGTTGAAGGGATGCTTTGTTGAAT
GTCGTCACCGAAATTGAAAACTGCTCTTGGAAATATTGTTGCTGCTGAAA
AAGCccTGAAGACATCCATGTTTAAATGGTCACCTGATTATGACACAGCG
GCCAGTGAATACACAAAAGCAGCTACCAATTTCAAGCTGGCTGGTTCAGC
AGAGAAAGCACAAGACGCCTACATTAAAGCCTCGCAGATGCAAGAAAAGC
TTGGATCGTTATTCCATGCAGCTAAGCTTTTGACACAGGCAGCAGGGATT
GCATCAGATCTCAAAAATCTTGAGGAAGCTGTTACTTTAATGCAAAGAGC
GTGTTCGTTATACAGAGAGCATGGTACCCCAGATACAGCCGCACTCACTA
TATCCAAAGCTGCTAAAATGTGTGAAACAGGACTACCAAGTAAAGCTACA
GAGATGTATCTACTAGCTGCAGAGCTATGCGAAAACGATGAGAAATTGCG
AGACTCGGCAGACCATTTGAATAACGCAGTGAGGATGGAACTCAAACAGA
AAAAATACAAAGAAGCGGCCACTATAATGAAGCAACGATGTGAACTcttc
aaaaaacttcaaaatcctAATAACGCACACCAGCTAACCCTATGCATGGC
GATCGTGTATTTGGCTGCTGGAGATTTCGTGCAAGCGGAAACAGCTTTCA
AGGATGGTTTTGAAGTTGATCGTTTTGGTGACAGTGATGAAGCGATGTAT
ACCGAACAATTTCTCAAAGCCTACCAAGAATATGATGCGGAATTACTCAA
TCAAACGAAATCAGCTCCTCTCGTCAAATATTTAGATACTGAGATTGCAC
GCCTCGCCAAAACACTTGAACTGTCAACCTGTAAAAACATTCCATCCAAA
CTTGACATCGGTGGTAAAAGTGAATTGGAACAATTTGAAGACCAGTTGGG
TGATCAAGACAAAGTTGCTGGTGACATCGAGCAAAATAATGAAGCAGATG
AAGGAGAAGTTGAAGGGATGCTTTGTTGAATGTCGTCACCGAAATTGAAA
ACTGCTCTTGGAAATATTGTTGCTGCTGAAAAAGCccTGAAGACATCCAT
GTTTAAATGGTCACCTGATTATGACACAGCGGCCAGTGAATACACAAAAG
CAGCTACCAATTTCAAGCTGGCTGGTTCAGCAGAGAAAGCACAAGACGCC
TACATTAAAGCCTCGCAGATGCAAGAAAAGCTTGGATCGTTATTCCATGC
AGCTAAGCTTTTGACACAGGCAGCAGGGATTGCATCAGATCTCAAAAATC
TTGAGGAAGCTGTTACTTTAATGCAAAGAGCGTGTTCGTTATACAGAGAG
CATGGTACCCCAGATACAGCCGCACTCACTATATCCAAAGCTGCTAAAAT
GTGTGAAACAGGACTACCAAGTAAAGCTACAGAGATGTATCTACTAGCTG
CAGAGCTATGCGAAAACGATGAGAAATTGCGAGACTCGGCAGACCATTTG
AATAACGCAGTGAGGATGGAACTCAAACAGAAAAAATACAAAGAAGCGGC
CACTATAATGAAGCAACGATGTGAACTcttcaaaaaacttcaaaatcctA
ATAACGCACACCAGCTAACCCTATGCATGGCGATCGTGTATTTGGCTGCT
GGAGATTTCGTGCAAGCGGAAACAGCTTTCAAGGATGGTTTTGAAGTTGA
TCGTTTTGGTGACAGTGATGAAGCGATGTATACCGAACAATTTCTCAAAG
CCTACCAAGAATATGATGCGGAATTACTCAATCAAACGAAATCAGCTCCT
CTCGTCAAATATTTAGATACTGAGATTGCACGCCTCGCCAAAACACTTGA
ACTGTCAACCTGTAAAAACATTCCATCCAAACTTGACATCGGTGGTAAAA
GTGAATTGGAACAATTTGAAGACCAGTTGGGTGATCAAGACAAAGTTGCT
GGTGACATCGAGCAAAATAATGAAGCAGATGAAGGAGAAGTTGAAGGGAT
GCTTTGTTGAATGTCGTCACCGAAATTGAAAACTGCTCTTGGAAATATTG
TTGCTGCTGAAAAAGCccTGAAGACATCCATGTTTAAATGGTCACCTGAT
TATGACACAGCGGCCAGTGAATACACAAAAGCAGCTACCAATTTCAAGCT
GGCTGGTTCAGCAGAGAAAGCACAAGACGCCTACATTAAAGCCTCGCAGA
TGCAAGAAAAGCTTGGATCGTTATTCCATGCAGCTAAGCTTTTGACACAG
GCAGCAGGGATTGCATCAGATCTCAAAAATCTTGAGGAAGCTGTTACTTT
AATGCAAAGAGCGTGTTCGTTATACAGAGAGCATGGTACCCCAGATACAG
CCGCACTCACTATATCCAAAGCTGCTAAAATGTGTGAAACAGGACTACCA
AGTAAAGCTACAGAGATGTATCTACTAGCTGCAGAGCTATGCGAAAACGA
TGAGAAATTGCGAGACTCGGCAGACCATTTGAATAACGCAGTGAGGATGG
AACTCAAACAGAAAAAATACAAAGAAGCGGCCACTATAATGAAGCAACGA
TGTGAACTcttcaaaaaacttcaaaatcctAATAACGCACACCAGCTAAC
CCTATGCATGGCGATCGTGTATTTGGCTGCTGGAGATTTCGTGCAAGCGG
AAACAGCTTTCAAGGATGGTTTTGAAGTTGATCGTTTTGGTGACAGTGAT
GAAGCGATGTATACCGAACAATTTCTCAAAGCCTACCAAGAATATGATGC
GGAATTACTCAATCAAACGAAATCAGCTCCTCTCGTCAAATATTTAGATA
CTGAGATTGCACGCCTCGCCAAAACACTTGAACTGTCAACCTGTAAAAAC
ATTCCATCCAAACTTGACATCGGTGGTAAAAGTGAATTGGAACAATTTGA
AGACCAGTTGGGTGATCAAGACAAAGTTGCTGGTGACATCGAGCAAAATA
ATGAAGCAGATGAAGGAGAAGTTGAAGGGATGCTTTGTTGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_001075XLOC_001075Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00002043-proteinTCONS_00002043-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00002043-exon-sc0000018-1491911889:449555..449820TCONS_00002043-exon-sc0000018-1491911889:449555..449820Clytia hemisphaericaexon
TCONS_00002043-exon-sc0000018-1510915933:449555..449820TCONS_00002043-exon-sc0000018-1510915933:449555..449820Clytia hemisphaericaexon
TCONS_00002043-exon-sc0000018-1575043694:449555..449820TCONS_00002043-exon-sc0000018-1575043694:449555..449820Clytia hemisphaericaexon
TCONS_00002043-exon-sc0000018-1491911889:450493..450560TCONS_00002043-exon-sc0000018-1491911889:450493..450560Clytia hemisphaericaexon
TCONS_00002043-exon-sc0000018-1510915933:450493..450560TCONS_00002043-exon-sc0000018-1510915933:450493..450560Clytia hemisphaericaexon
TCONS_00002043-exon-sc0000018-1575043694:450493..450560TCONS_00002043-exon-sc0000018-1575043694:450493..450560Clytia hemisphaericaexon
TCONS_00002043-exon-sc0000018-1491911889:451478..451580TCONS_00002043-exon-sc0000018-1491911889:451478..451580Clytia hemisphaericaexon
TCONS_00002043-exon-sc0000018-1510915933:451478..451580TCONS_00002043-exon-sc0000018-1510915933:451478..451580Clytia hemisphaericaexon
TCONS_00002043-exon-sc0000018-1575043694:451478..451580TCONS_00002043-exon-sc0000018-1575043694:451478..451580Clytia hemisphaericaexon
TCONS_00002043-exon-sc0000018-1491911889:452050..452127TCONS_00002043-exon-sc0000018-1491911889:452050..452127Clytia hemisphaericaexon
TCONS_00002043-exon-sc0000018-1510915933:452050..452127TCONS_00002043-exon-sc0000018-1510915933:452050..452127Clytia hemisphaericaexon
TCONS_00002043-exon-sc0000018-1575043694:452050..452127TCONS_00002043-exon-sc0000018-1575043694:452050..452127Clytia hemisphaericaexon
TCONS_00002043-exon-sc0000018-1491911889:452466..452528TCONS_00002043-exon-sc0000018-1491911889:452466..452528Clytia hemisphaericaexon
TCONS_00002043-exon-sc0000018-1510915933:452466..452528TCONS_00002043-exon-sc0000018-1510915933:452466..452528Clytia hemisphaericaexon
TCONS_00002043-exon-sc0000018-1575043694:452466..452528TCONS_00002043-exon-sc0000018-1575043694:452466..452528Clytia hemisphaericaexon
TCONS_00002043-exon-sc0000018-1491911889:452817..452883TCONS_00002043-exon-sc0000018-1491911889:452817..452883Clytia hemisphaericaexon
TCONS_00002043-exon-sc0000018-1510915933:452817..452883TCONS_00002043-exon-sc0000018-1510915933:452817..452883Clytia hemisphaericaexon
TCONS_00002043-exon-sc0000018-1575043694:452817..452883TCONS_00002043-exon-sc0000018-1575043694:452817..452883Clytia hemisphaericaexon
TCONS_00002043-exon-sc0000018-1491911889:453177..453247TCONS_00002043-exon-sc0000018-1491911889:453177..453247Clytia hemisphaericaexon
TCONS_00002043-exon-sc0000018-1510915933:453177..453247TCONS_00002043-exon-sc0000018-1510915933:453177..453247Clytia hemisphaericaexon
TCONS_00002043-exon-sc0000018-1575043694:453177..453247TCONS_00002043-exon-sc0000018-1575043694:453177..453247Clytia hemisphaericaexon
TCONS_00002043-exon-sc0000018-1491911889:453781..453859TCONS_00002043-exon-sc0000018-1491911889:453781..453859Clytia hemisphaericaexon
TCONS_00002043-exon-sc0000018-1510915933:453781..453859TCONS_00002043-exon-sc0000018-1510915933:453781..453859Clytia hemisphaericaexon
TCONS_00002043-exon-sc0000018-1575043694:453781..453859TCONS_00002043-exon-sc0000018-1575043694:453781..453859Clytia hemisphaericaexon
TCONS_00002043-exon-sc0000018-1491911889:454496..454575TCONS_00002043-exon-sc0000018-1491911889:454496..454575Clytia hemisphaericaexon
TCONS_00002043-exon-sc0000018-1510915933:454496..454575TCONS_00002043-exon-sc0000018-1510915933:454496..454575Clytia hemisphaericaexon
TCONS_00002043-exon-sc0000018-1575043694:454496..454575TCONS_00002043-exon-sc0000018-1575043694:454496..454575Clytia hemisphaericaexon
TCONS_00002043-exon-sc0000018-1491911889:455022..455151TCONS_00002043-exon-sc0000018-1491911889:455022..455151Clytia hemisphaericaexon
TCONS_00002043-exon-sc0000018-1510915933:455022..455151TCONS_00002043-exon-sc0000018-1510915933:455022..455151Clytia hemisphaericaexon
TCONS_00002043-exon-sc0000018-1575043694:455022..455151TCONS_00002043-exon-sc0000018-1575043694:455022..455151Clytia hemisphaericaexon
TCONS_00002043-exon-sc0000018-1491911889:456668..456964TCONS_00002043-exon-sc0000018-1491911889:456668..456964Clytia hemisphaericaexon
TCONS_00002043-exon-sc0000018-1510915933:456668..456964TCONS_00002043-exon-sc0000018-1510915933:456668..456964Clytia hemisphaericaexon
TCONS_00002043-exon-sc0000018-1575043694:456668..456964TCONS_00002043-exon-sc0000018-1575043694:456668..456964Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000018supercontigsc0000018:449555..456964 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
8.82886 9.81233 8.59992 8.5575 18.9099 17.3295 25.9568 27.5041 31.1546 33.5757 31.8659 23.2172 20.7456 18.6076 20.7721 25.4168 28.2656 25.6246 18.2185 24.0109 20.9326 20.5276 28.0988 29.5385 29.7618 33.1243 19.6724 21.5175 22.9492 23.5651
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR011990TPR-like_helical_dom
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005515 protein binding
Blast
BLAST of TCONS_00002043 vs. Swiss-Prot (Human)
Match: SNAG (Gamma-soluble NSF attachment protein OS=Homo sapiens GN=NAPG PE=1 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 5.795e-53
Identity = 97/273 (35.53%), Postives = 166/273 (60.81%), Query Frame = 1
Query:  211 MSSPKLKTALGNIVAAEKALKTSMFKWSPDYDTAASEYTKAATNFKLAGSAEKAQDAYIKASQMQEKLGSLFHAAKLLTQAAGIASDLKNLEEAVTLMQRACSLYREHGTPDTAALTISKAAKMCETGLPSKATEMYLLAAELCENDEKLRDSADHLNNAVRMELKQKKYKEAATIMKQRCELFKKLQNPNNAHQLTLCMAIVYLAAGDFVQAETAFKDGFEVDRFGDSDEAMYTEQFLKAYQEYDAELLNQTKSAPLVKYLDTEIARLAKTL 1029
            M++ K+   L ++  AEK LKT   KW PDYD+AASEY KAA  FK A   E+A+DA ++ +   E   +LFHAAK   QA  +  +++ L EAV L+++A  +Y E+GTPDTAA+ + +A K+ E   P KA ++Y   A + EN+E+LR + + L  A R+ ++ +++ EAA  +++   ++K+++N    ++ T+   +V+L   D+V AE   ++ + +  F  S++    EQ L+ Y + D + ++   ++PL KY+D + A+L  +L
Sbjct:    1 MAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLREAVAHENNRALFHAAKAYEQAGMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAMALERAGKLIENVDPEKAVQLYQQTANVFENEERLRQAVELLGKASRLLVRGRRFDEAALSIQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDYVAAERCVRESYSIPGFNGSEDCAALEQLLEGYDQQDQDQVSDVCNSPLFKYMDNDYAKLGLSL 273          
The following BLAST results are available for this feature:
BLAST of TCONS_00002043 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
SNAG5.795e-5335.53Gamma-soluble NSF attachment protein OS=Homo sapie... [more]
back to top