Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001985 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001985
Unique NameTCONS_00001985
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1743

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001985 ID=TCONS_00001985|Name=TCONS_00001985|organism=Clytia hemisphaerica|type=transcript|length=1743bp
GTGCTTGTATACTAAGGCTAAGCCTTATAGGTGACACTAACAATAATATT
TATAATTCAAGGATAACCCTGATGTCtgaaaagttaaatttttcagtcAT
TACGTACCAACATTAACGAAAGGAATTCCATCGTAAGGGATATATTGTGA
TTTCCACATCAAACGAACTGTTTCAGCACTTTCATCTTTTGCTGCTGACG
GAGTCTGCCTAATTGCAAATAAACTTtgtgtttcttttttataaaggtTC
AAGATATCATCCATTTCACTTTCTGTAAAAACATAACCAGTGTATGTATC
TCCACATAAAGTACAATCCCTTAGCTGAAGTGCCCAATTTGGTATTGTAT
TTAGAAGATCTGAGTTTGTATTTAAAACATAATGTCCTTCAGTTGCCTTC
ATGTCGCCTGCATTATCAAGGGTATTTGGTGCAACAAAAGAAGCAAGATT
TATTATAGTATTCCCATCTTTTTTAACCAAGTTATTTTTGTTGAGAGTAG
CTATAATATCGTTAACGTTTATGTTTACAGGTACACCCTCTGTGTTCATC
ACTTGTACTATAGCAGCTTCTGGAGCAGAAGTCGAGGTTGACGATGATTC
ATTCTGAAGGCTCATGTTTTTTATATTGTCTGTACTATTTGGTGGTGGAG
CATTTTGATCAAGATTAACAATGTTTAGCATTTGAGGAGCTGACGTGTTT
GGTTGTTGCTGTATTGGAAATTGTTGCTGATCAATCGGTTGCAAGACCGT
TTGAGTTTCAGACTGGGAAACTAACAAATAAATAGTACCATTATTTGGTT
GCTGTTGTACATTATTTTCATTAGCAGCATTAATATTGTTATTGATGATT
TCGATGTTATTCAAAATACCAGGGTTTGTTGAGTAATCAACCAGCGAGTT
TGCATCTATCGTGACAATATTCTGTTGTAAATATTTCTGATCACTAACCT
CTCCAACCATGGTAGGTCCCATGGATAAGGTGTTTGCttcaatttcattg
aaaacattatCTCCAGTGACAGCATTTTCATTTCCATCTTTCTTGGCTAA
ATCTGGAGTAACATAACAAACATCAGATGTGTTCTCACAAGTTACCTCCG
TGTGAAGTGCTGTTGTAAAACTTTCATTGTCTTTAACATTACCAGGAACT
CCTAAAGACATCGATATCAAAATCTGCAGTGATTCATAAAATTTTCTTGT
CTTGGTTTTGAAGTTTTCCCaccaaattttttgttttggtagCCTCGTTT
GTCTTCAATCACAACCTCATAATCAAAAACTCGGAGCGAAAAGGGAGGCT
GTTTTGCATGACATCGAGGATAAAGATtcgattttctaaaaatatttgta
gTGCGCATGCGCAGTAAATCTCGGCCATTTTCAAGATTACGGGAAGACCA
ATCAAATTCATTAGAAAGTGTGAATGACACGCGCCGACAGACGTTGGGGG
ATAATAGGGGTAATTAAACCCAATTAATTCGGATAGATGAAAAGAAAGGA
AATACGGGACCTTCTAAATAGTCTAAGCAACTTTTGAGAGAAGGGGAGCT
CATATACACAAATACAAGAGGTGAAGCAGATGTTGGGGGAcatatttctt
gtttttatttcgtCTAAACACACCCTGTTTATGCTATAATCATATGCTAC
ACCACGCCTTTTGGTTTTGCATTCGTTCAATCTAATTACAATTAGTGAGC
CACCCAAGCTGCTCAACGTATATAAATTCAGAGTGCGCTAAAA
Run BLAST on NCBI

protein sequence of TCONS_00001985-protein

>TCONS_00001985-protein ID=TCONS_00001985-protein|Name=TCONS_00001985-protein|organism=Clytia hemisphaerica|type=polypeptide|length=353bp
MSLGVPGNVKDNESFTTALHTEVTCENTSDVCYVTPDLAKKDGNENAVTG
DNVFNEIEANTLSMGPTMVGEVSDQKYLQQNIVTIDANSLVDYSTNPGIL
NNIEIINNNINAANENNVQQQPNNGTIYLLVSQSETQTVLQPIDQQQFPI
QQQPNTSAPQMLNIVNLDQNAPPPNSTDNIKNMSLQNESSSTSTSAPEAA
IVQVMNTEGVPVNINVNDIIATLNKNNLVKKDGNTIINLASFVAPNTLDN
AGDMKATEGHYVLNTNSDLLNTIPNWALQLRDCTLCGDTYTGYVFTESEM
DDILNLYKKETQSLFAIRQTPSAAKDESAETVRLMWKSQYIPYDGIPFVN
VGT
Run BLAST on NCBI

transcript from alignment at sc0000012:150316..152058

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001985 ID=TCONS_00001985|Name=TCONS_00001985|organism=Clytia hemisphaerica|type=transcript|length=1743bp|location=Sequence derived from alignment at sc0000012:150316..152058 (Clytia hemisphaerica)
TTTTAGCGCACTCTGAATTTATATACGTTGAGCAGCTTGGGTGGCTCACT AATTGTAATTAGATTGAACGAATGCAAAACCAAAAGGCGTGGTGTAGCAT ATGATTATAGCATAAACAGGGTGTGTTTAGacgaaataaaaacaagaaat atgTCCCCCAACATCTGCTTCACCTCTTGTATTTGTGTATATGAGCTCCC CTTCTCTCAAAAGTTGCTTAGACTATTTAGAAGGTCCCGTATTTCCTTTC TTTTCATCTATCCGAATTAATTGGGTTTAATTACCCCTATTATCCCCCAA CGTCTGTCGGCGCGTGTCATTCACACTTTCTAATGAATTTGATTGGTCTT CCCGTAATCTTGAAAATGGCCGAGATTTACTGCGCATGCGCActacaaat atttttagaaaatcgaATCTTTATCCTCGATGTCATGCAAAACAGCCTCC CTTTTCGCTCCGAGTTTTTGATTATGAGGTTGTGATTGAAGACAAACGAG GctaccaaaacaaaaaatttggtGGGAAAACTTCAAAACCAAGACAAGAA AATTTTATGAATCACTGCAGATTTTGATATCGATGTCTTTAGGAGTTCCT GGTAATGTTAAAGACAATGAAAGTTTTACAACAGCACTTCACACGGAGGT AACTTGTGAGAACACATCTGATGTTTGTTATGTTACTCCAGATTTAGCCA AGAAAGATGGAAATGAAAATGCTGTCACTGGAGataatgttttcaatgaa attgaaGCAAACACCTTATCCATGGGACCTACCATGGTTGGAGAGGTTAG TGATCAGAAATATTTACAACAGAATATTGTCACGATAGATGCAAACTCGC TGGTTGATTACTCAACAAACCCTGGTATTTTGAATAACATCGAAATCATC AATAACAATATTAATGCTGCTAATGAAAATAATGTACAACAGCAACCAAA TAATGGTACTATTTATTTGTTAGTTTCCCAGTCTGAAACTCAAACGGTCT TGCAACCGATTGATCAGCAACAATTTCCAATACAGCAACAACCAAACACG TCAGCTCCTCAAATGCTAAACATTGTTAATCTTGATCAAAATGCTCCACC ACCAAATAGTACAGACAATATAAAAAACATGAGCCTTCAGAATGAATCAT CGTCAACCTCGACTTCTGCTCCAGAAGCTGCTATAGTACAAGTGATGAAC ACAGAGGGTGTACCTGTAAACATAAACGTTAACGATATTATAGCTACTCT CAACAAAAATAACTTGGTTAAAAAAGATGGGAATACTATAATAAATCTTG CTTCTTTTGTTGCACCAAATACCCTTGATAATGCAGGCGACATGAAGGCA ACTGAAGGACATTATGTTTTAAATACAAACTCAGATCTTCTAAATACAAT ACCAAATTGGGCACTTCAGCTAAGGGATTGTACTTTATGTGGAGATACAT ACACTGGTTATGTTTTTACAGAAAGTGAAATGGATGATATCTTGAacctt tataaaaaagaaacacaAAGTTTATTTGCAATTAGGCAGACTCCGTCAGC AGCAAAAGATGAAAGTGCTGAAACAGTTCGTTTGATGTGGAAATCACAAT ATATCCCTTACGATGGAATTCCTTTCGTTAATGTTGGTACGTAATgactg aaaaatttaacttttcaGACATCAGGGTTATCCTTGAATTATAAATATTA TTGTTAGTGTCACCTATAAGGCTTAGCCTTAGTATACAAGCAC

Coding sequence (CDS) from alignment at sc0000012:150316..152058

>TCONS_00001985 ID=TCONS_00001985|Name=TCONS_00001985|organism=Clytia hemisphaerica|type=CDS|length=1062bp|location=Sequence derived from alignment at sc0000012:150316..152058 (Clytia hemisphaerica)
ATGTCTTTAGGAGTTCCTGGTAATGTTAAAGACAATGAAAGTTTTACAAC
AGCACTTCACACGGAGGTAACTTGTGAGAACACATCTGATGTTTGTTATG
TTACTCCAGATTTAGCCAAGAAAGATGGAAATGAAAATGCTGTCACTGGA
GataatgttttcaatgaaattgaaGCAAACACCTTATCCATGGGACCTAC
CATGGTTGGAGAGGTTAGTGATCAGAAATATTTACAACAGAATATTGTCA
CGATAGATGCAAACTCGCTGGTTGATTACTCAACAAACCCTGGTATTTTG
AATAACATCGAAATCATCAATAACAATATTAATGCTGCTAATGAAAATAA
TGTACAACAGCAACCAAATAATGGTACTATTTATTTGTTAGTTTCCCAGT
CTGAAACTCAAACGGTCTTGCAACCGATTGATCAGCAACAATTTCCAATA
CAGCAACAACCAAACACGTCAGCTCCTCAAATGCTAAACATTGTTAATCT
TGATCAAAATGCTCCACCACCAAATAGTACAGACAATATAAAAAACATGA
GCCTTCAGAATGAATCATCGTCAACCTCGACTTCTGCTCCAGAAGCTGCT
ATAGTACAAGTGATGAACACAGAGGGTGTACCTGTAAACATAAACGTTAA
CGATATTATAGCTACTCTCAACAAAAATAACTTGGTTAAAAAAGATGGGA
ATACTATAATAAATCTTGCTTCTTTTGTTGCACCAAATACCCTTGATAAT
GCAGGCGACATGAAGGCAACTGAAGGACATTATGTTTTAAATACAAACTC
AGATCTTCTAAATACAATACCAAATTGGGCACTTCAGCTAAGGGATTGTA
CTTTATGTGGAGATACATACACTGGTTATGTTTTTACAGAAAGTGAAATG
GATGATATCTTGAacctttataaaaaagaaacacaAAGTTTATTTGCAAT
TAGGCAGACTCCGTCAGCAGCAAAAGATGAAAGTGCTGAAACAGTTCGTT
TGATGTGGAAATCACAATATATCCCTTACGATGGAATTCCTTTCGTTAAT
GTTGGTACGTAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_001023XLOC_001023Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001985-proteinTCONS_00001985-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001985-exon-sc0000012-1491911889:150316..152058TCONS_00001985-exon-sc0000012-1491911889:150316..152058Clytia hemisphaericaexon
TCONS_00001985-exon-sc0000012-1510915933:150316..152058TCONS_00001985-exon-sc0000012-1510915933:150316..152058Clytia hemisphaericaexon
TCONS_00001985-exon-sc0000012-1575043694:150316..152058TCONS_00001985-exon-sc0000012-1575043694:150316..152058Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000012supercontigsc0000012:150316..152058 .
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
9.8061 10.645 6.2847 4.20154 35.7736 26.9133 7.79036 7.7943 4.38507 5.26263 4.17078 2.84953 3.03014 3.01904 2.66592 4.0025 4.49671 3.63024 2.58144 2.34112 3.60013 3.9265 8.98948 8.77546 10.4291 10.7038 2.31501 2.50449 5.26232 6.95683
Blast
BLAST of TCONS_00001985 vs. Swiss-Prot (Human)
Match: CARTF (Calcium-responsive transcription factor OS=Homo sapiens GN=CARF PE=1 SV=2)

HSP 1 Score: 106.686 bits (265), Expect = 5.864e-24
Identity = 59/161 (36.65%), Postives = 85/161 (52.80%), Query Frame = -1
Query:  103 PEAAIVQVMNTEGVPVNINVNDIIATLNKNNLVKKDGNTIIN-LASFVAPNTLDNAGDMKATEGHY---VLNTNSDLLNTIPNWALQLRDCTLCGDTYTGYVFTESEMDDILNLYKKETQSLFAIRQTPSAAKDESAETVRLMWKSQYIPYDGIPFVNVGT 573
            P+  +V V +   VP     N  + T+  + L     N I++   SF  P         K+  G     +L     L +  P WA +LR C   GD+Y GY  +E+E++ +L  +K++TQS++  RQ+PS AK       RLMWKSQY+PYDGIPFVN G+
Sbjct:  131 PQGQLVDVNSPRDVPEEKPSNRNLPTVRVDTLADNTSNYILHPQTSFPLPK--------KSVTGMLEEPLLGPLQPLSSNTPIWACRLRSCEKIGDSYRGYCVSETELESVLTFHKQQTQSVWGTRQSPSPAKP----ATRLMWKSQYVPYDGIPFVNAGS 279          
The following BLAST results are available for this feature:
BLAST of TCONS_00001985 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
CARTF5.864e-2436.65Calcium-responsive transcription factor OS=Homo sa... [more]
back to top