Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001955 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001955
Unique NameTCONS_00001955
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1345

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001955 ID=TCONS_00001955|Name=TCONS_00001955|organism=Clytia hemisphaerica|type=transcript|length=1345bp
AGTTCGCTTCTAACGTGCATGGCATGGAGATATGGAGAAAGAGAAGaaga
ataattttcaattttcaaagaatttacAACAGCAATATTATGGGCAATCA
GGAAAAACAGAAAAGCAAGGCATATAGATAGTCATCTTCAAAGGGACATC
AGATATCAAAGACAACAGAAAGTCCACTATCAACGTTAACGAAAAGTTGA
GTGGTGTGAGCGAAGATAAgacaaattgaacaaaaagacgTGATCTACTG
CGAGTACATTCATTCGATCGACATCAGTAGAACAAGAAGGGCATTGGGAA
GCCTTACATCCCAACTATTGTTAAAATGAACGTGACTTCATGTAATGATA
TCATGAAAATGGTACAACCTTCCGGAACAGTGTCTGCAGATTTGATTCAT
GTCATCTTGCCAAATATTTGTGGTATAATTGACAGTATTAATGCATCTAT
GGTGACATTCGAGGAGAGAATCTTTTACGATCATTGCTGTGACCCGATAC
CCTTTATGATCCTCAATAAGACTGTAAATATAAATAATGAGACGCACCCA
GAACAATTGATTAGTGACGTGTGTAATTATATGCACCATAATCGAAACCA
ACAAGAAGAAGCTCTCTACCAAGAGATCTGTTTAAATTCTTCAACAAATA
ATTCTTCCGTTTTAAATCCAGCATGGCGACTATTGACATTCATCATTCTA
TCCTTGCTTTCACCGATCGGCTTCTTTGCTAACGTTTTGATCCTTATGAC
CGTATACAAAATCAAACATCTTCGCAATACCACTGGTTACTTCATCTGCA
ATCTGGCTGTTTCTGATCTTCTGGTTATCTTTCAGATGCTACTATTTGTG
ACCATGTATACGTCTGGTGCAATGTCAGAGGCGAGCCCACGAGTTCAAAG
CTTTTTCTTTCCAACAATCGATGTCGTTATTGGTTCAGCTTCGTTGCTAC
ATGTAACAGCAGTGACTATGGAAAGAGGCATAGCTGTATCAATGCCTTTG
AGATATCCAAGGTACCTTAATGAACGAACAGCGAATCGTACCATTGTTGG
AATCTGGATTTATTGTTTGGTGCTCCTCGTCATGGGTTTATTACGAATAC
CGATTGTCAGCGACGTCTACAATTCAGTGTTTTTCTTCATCGCTGCTACA
TTGAGCTTTTTCATCCCTTGTATATTAGTGCTTGTCTCTTACGGTTTTAT
ACTGGTATCCGCGTTAAAGAATatgaaaatggaaaagaaaatcaGCAAAG
TTATCGTTGTCATATCTATGNACATGTAACAGCAGTAACTATGGAAAGAG
GCATAGCTGTATCAATGCCTTTGAGATATCCAAGGTACCTTAATG
Run BLAST on NCBI

protein sequence of TCONS_00001955-protein

>TCONS_00001955-protein ID=TCONS_00001955-protein|Name=TCONS_00001955-protein|organism=Clytia hemisphaerica|type=polypeptide|length=317bp
MNVTSCNDIMKMVQPSGTVSADLIHVILPNICGIIDSINASMVTFEERIF
YDHCCDPIPFMILNKTVNINNETHPEQLISDVCNYMHHNRNQQEEALYQE
ICLNSSTNNSSVLNPAWRLLTFIILSLLSPIGFFANVLILMTVYKIKHLR
NTTGYFICNLAVSDLLVIFQMLLFVTMYTSGAMSEASPRVQSFFFPTIDV
VIGSASLLHVTAVTMERGIAVSMPLRYPRYLNERTANRTIVGIWIYCLVL
LVMGLLRIPIVSDVYNSVFFFIAATLSFFIPCILVLVSYGFILVSALKNM
KMEKKISKVIVVISMXM
Run BLAST on NCBI

transcript from alignment at sc0000012:851175..874746-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001955 ID=TCONS_00001955|Name=TCONS_00001955|organism=Clytia hemisphaerica|type=transcript|length=23572bp|location=Sequence derived from alignment at sc0000012:851175..874746- (Clytia hemisphaerica)
AGTTCGCTTCTAACGTGCATGGCATGGAGATATGGAGAAAGAGAAGAAGA ATAATTTTCAATTTTCAAAGAATTTACAACAGCAATATTATGGGCAATCA GGTATTCTTTAATCAAGCTTCCTCAAGTTACTATATGTATCCCATTGAGA AAGAGTAGAGTGAAAGTTACAGGCGTGAAACTTGAAAACCTTAAGTTTTA CGTTTCATTTTGCGCAACAACGAATTGAATATCATTATTTCTATCGTGTT CTAGTGGTACATCTCTAGCAGTTTTTTTGGTCCAACGCTGTGCTTAAAAA CGAAGGTACATCTTTGTCTTGTGGCATCAGAGTAGTGGCTTGCATGAGTC TAGTACCAATTAGGATGGAATTTATTCTCTTGATTTTTGTAGTCCGAAAT TCGGATTTCATTCTTTAGATGAACTTTGTTTGCTAATGTAGTTGAAAATA TCAACCCAATGTAGTTTTAACAATCGGGATGACATTAACATTAAGTTTAT TTTTTCTCTATAGGAGCAATATAACACATTTTTCATTGGTATGGGCTCCC AACAACAGGCCGTGACAACGGTCAAGCCTTACCTTAATAGTTTAGGTTTA ATTTTAGTCAAGCTGTATTTGAAAATATTTAACGGGATTCTAGTTCCTTG TGAAAGAACGAAGCTGTTGATGAAAGAGGTTCAAAAGTTGATTGTATTGG TCATTTTTGGTGGTTTGTTGAACTATTAGTTATTGGTTGGTTAGCAATTC TTTTGATGTTACCTATACATCACTCATTCGCTCACGTATTGGTTTTTATC TTAATCACTGGTGCGGTTTGCACTATAAATAGTGCAGATTCGTAAGACAT TTTCATTTTCTTAAAAACAAAAAAATATTTTCACATTCGTTTAAGACGTT TCATGTTCTGAAAGCGAAAAAATTCCCGCAAATCCTGCAAATTTTAAGCT TTATTCTCTTTAGGATTTAATCCTTTTAGGGTTATTTTGGGTCTTTAAAA TTTAGAATCGATGTTGAATATTTTTGACAGGCGACACNGCTTTATTCTCT TTAGGATTTAATCCTTTTAGGGTTATTTTGGGCCTTCAAAATTTAGAATC GATGTTGAATATTTGTGACAGGCGACAAGGATTAGGATAGAACTATTATG GCTGTCTAAGCATTCCAATGATTTTGGAAAAGAGCCAAAAAAAATTACAG ATGTTGAAATATCAGGATTTTAGTTGATTTTATTTATTTTAACTCACATT CCGTCTTGTTTAGTGAAAAGGGGTGAAAATGAAAACGAAACCCAAAATAT TAGACTCCTACTTTAGTGTATTTTTCACTTTTTCACGAAATAGCGATTAA TATTGCCATCAAAATTTAAATTACGAGATACAACATTTTCAGCTCACAAA ATCCAATAAGATAAAAGCTTAAAAGTATCTGTTCACCGTGAAATGTTTTT GGATAGACTTTCTAGCGGGGAAAGTTTTCCACCATAGGAAAGTGACAAAA TGGTGTAATAATAACCCCTCTACAAAAGCACGAAACTTGAACTTTCTGAT CAAAGTTTGGAACAAATTTGAACGTTTCAGTTCCAAACGTTAGCACTAAA TACACTAATCAAACTCGTTATTGGGGGTGTTTCCCAGTAATCAATCGTTC TTCATGATTTCGCCTTTATGTGGGAGGAGATTATCAAAATCCATGTCATT TACAGTCATGACATATCTAATTACCTCATCTTCAAATCTTCCACTTTTTC AAAATTTACGGTCAAGTATTTTTTTCATATATCATTTGTAGTTCAAACTT GAATAAATTCGAGGTCTAGATTCATGGGTAAAGCTTCCTGTTAACTATGT ATTTAACCTATCATACGTAATACTAATATGACCGAGACTATTGCAATTGT TTACTTGGTTTAAAATTACGGACTTTAAATAAAGAAACAGTAAAGGTAGT TTCAATTAAATGAAGTTTTTTGAAGGTAAGGTCTAGGAGATATTTCATAC ACTATTTCTGTCTCCGATGAAGAGGTTGAAACTCACAAAAAAGAAGGTGG ATCTGCAAATTAAAATCGCAAAATTAACGGTACGCAAAATTTTAACGAAT TAGATAATGAATATGTATAAATGATTGACAGTTGATTTTCAAGAGGCTGG TTGGTATGCAATTATGTTAAATTTTCTCTAATTTCTAAAATACCATACCA CTTTTAAAATCACTGCGTACAAAAATGCGTCCAAAATTGAAAATTAACGT TGCAAAATCCAACATACCAGTTTTTTTTTTGCATAATTAGAAAAAGGCAG AGGTATAGCTATTAGAAATTGACCACATTGATTAGCAAGGACAACGGATA CAGTAATACCTTGTAATTAATTATAGAAATTAAAAACTTAATGATGATAA TAGATGGAACTGAAAAGAATCAAAAAGTTTGGCAAATTTTCTTTTTTTTT TTCTAATGTATGCGCCTTCATTTGAAAAGGAGAGAGAATAGAGACACAAT AACAACTTTCGAGAAAGGGCAAGGACAGGTCATTAATCATTCAATGATGA CATTATAAAAGACAGTGCTAATTTTTTACCTCTTGCAACAAACAAACTGA CTTTGATTTTCATTTTTCATTAATGGCAGCAGACTGTCGGCATTTTGTGG CTGTCTGATTTTTCCGTTTTACACAACGTCGACATTTTGCTTTTTTGAGG GAAATTGGACTGGAATCTTGATTTTGCAGCAACTTCTCAAAAGACATTAG CTCCAGGTTAGATAAAATTTTATTTATTTACTCATTTATTTTCTTCAGAC TTTTCAAAACAATTAGGGCTTGGAGAGCAGGAAAGCACAATGTCATCAAA GCAATTCTTGGCAAAGTTGGCGCTTAGCGGCGGAAAGAAACGGTTGACAA AATTAATCGTCCTATCAATTCCAAAGATCTAAAACGTTTTACATATTTAA ATATAGTTTTGAACAACCTAAATAAGGTATTTTTTTATCACTTTCCAATA AATCAAAATTTATTACTGATAAAATGGGTGATTTTATTCATGATTATCAA TAAAAGGTATCGAATGCGTTCTTTCAAAAAATCTACAATTATATTAGGTC TCTAGAACCTATGATAGATATGTCTGTAGGAACTCAGGTGTCAGGGTTTC TAGAATAACAAGGAAAGATGTGTACATGATGCTCGGTCGATTTCTTTCTT GTTTTCAATACAATTAAACATTGGGATTTCCGTTGACGATTGTCAGGCTT TTCCTTTTGGAGTTACTGTTACCTAGCATCAAACCATTTGGATAAATGTT CAAATCTTCTCTGTTGTAAGTTTTTTTGGGTGAATTTGGGTAAAAGTTTA ACTCTGCTAACTTACAAAAGAATTTCCTTTTCAATTTCTACTAAATTGGG TAACCTTTTACAACCCTGGGTCACATACCCGATGGGACCGCCGCCCTAAA ATTTCGTCCCTCTGGTGGTAAAAAATGNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNAAAAATTTTGATGAAGAAGAAAATGAAGACTTTTGCGAGGAAGAGTA TTTCAACTTTGAAGAGCTTAGTTTCGGCGAAGAAAAAACATTTTGAACAT TTTTTTGCAGTAGATGGTGTATTTTTTACCGAACAATAAAAATTTTTGCG GAAAAATTTTGTAAATACTTCTTTGTCTCGAAATCTTCGAAATAGTGGTT TTTCATCAATTTTTAACTGGATTTTGCTTAAAAAAACAGTCATAACTTTT GACACTTCTTTTTAGAAAAATTTTCCGCAAAATTTAAAATAGTTCAATTC TTTGTGGACAGTATAAAGACATTTTGAAACAAAAAGGTTAATTACCCATT AAAACTTAGCACTTTTTATAAAAGAAGGCGATGCAACATATTATTAACGT CTTTTTAAAGTTCATAACGTCATTTCTGCAATTAAATTCTTAAATACTCT GAAGGGATTTGATTAAAAAGCAATTTATAAAGGTAATTCTTTGTTGAAAG TGTTAAAGAACCTAAAACATAACTTTTATGTTCAAATACTAAAATCAATT TTCCGACTATGGTCAGAGCCCTTAAGTTTCGCGAATTCGCAAAAATCGCG AAATGCGAATAAAAAGATAAAGGATTGTTAATTTTGAAATAACTATGTAG CAAGGTGAAGACTTTTAGCAAATAAATCAAATTACATGTTCGTTAAAATC AGCCCACTTAATTGATAATGCAGTTGGAACTATCATTAATGATGCATTTT TATAATAATACCTATTACTGATCCATTAATTCACTGGTTGCTTGATTCAC CTTTCGTCATTTCTTTCGATTTCTATTATTTAACAAAATTAAAACATTCT TTTGAAATTGGACAAGCCACCTGTGATTACACAAGCTGTATATGTTGAGT TCTTTGCTGAAGAAAATGTTTCGAACATATTATTTCTTGTTTCAAGAGCC TACAATATTTTACTGTAAAATCAATTTGAACTTTATTTTAACCCTGGGTA AAAAAGCAGCAAAATTTGAGCAAATTGGGACAAAAAACCGACCCAATGGT ATACCTTAAAGGAAGAAATTTTGGCGGAAAGAAAATTTGGCGGATTTGGC GGATTTAGCCAAAATCCGCCAAATTAAGTTCCCGCCGAAATTTATTTTTT CCTCCATCCGCCAAATTAAATTCTCGCCAAAATTTCTTCCTTTAAGGTAA ATCTTTATTTTTTTGTCCATTATAGGGTAAATATGGGTGGACTTTTTCAA AATTACGAATAATTTAGAATTTGAAAATCAGCTTAAAGCTATAGGAAGAA ATCGTTTTAGGACTTCAGGATATGGCACGTGTTTTCGTAAAGAATCATTT TCTATTTAAAGTTACCTTACATACAAGAGGTATGACAATGGAAAAATATT TTTCCTATCAGATTAATTTCATCGTTAAAAATTGCATTCAAAGTTAATGA TAACCAGGTAATCGAATTAAAAGATAAAACTTTTTTCCTATCGGATTTAA TTTGCGGCGGGTGTAAAATAGTTTTGTCTACTCAATAAATATTTATTTTA GGCAGGAAAAAGTAAAATTAAGAACCTTGCAATGAAAGCAGAAGGCTACA CCCCTGTCTCAAAGGCCTGGTGGACATTTTTCCCTCAGTGAATGAAGATT TGTAACAAAAATCCCAATAGAAATATAAATTTTATAGTTCCCAGCTAAAA AAATCCAGTGAGAATGGTTTTGAATTAATTTTCTTTCATTAAATTTCGAA TGGGATAATTGTAGGGTATTTTCCAAACGGGGACGAAATTTCAGCAAAAT GTTCTAATATTGCGCGGGCTGTAAACTACTACTTTTCAATGACCAGCTGT ACCAGTAGTTGAAGTTTTTTCCAGCTAATTTAAGTAAATTTTGCAAATAG CTAGTGTATATTCAATGAAAAAGCTAAAAATCAAAATGGGGAACGGAAAA TCGCTTGTTTGTTATGGATGGAGATTCCAACCTTTTATGTTTAATAAAAT TCATTGGAGGTTTCAGAGCTTTAGTGTCTTTTCCATAGGGGATGAGAGTT TAGTTTAGTTTCCCAAAAGGATTTTTGCTCACCGCGGGGAAAATATTTTG CATGATTAACTTTTCCAGAAACCCCTACAAGGTCTGTGGCTACAAACGAG GTACATATTAAGATACTAAGATCATGTATTGTCCTGAACCTGAATAAAAT CAAACTATAGGCTGAAAATGATGCCATTCTCAATATCCATTTCCACGTTT TGTGATCTACAAACGTAACATTTTTCTAAGTTTGTCCTAGTGTTACACTT TCTGTCTCCTAGCCTACTTTGATGTTATTACGAGAAGACTTATTTATAAG GATGTTTTCCCTCAACCCAATACCTCGTGTAATTATCGACATAAATAATG ACAAGTTTAAAGGGACTGGTATCAAGGGTCATTAAGCAAAACATTTTGAA TAGTTTTTTAACTTAACGATGCTATATTGTTCGTTCATTACCACAAATTA GAAACCACCAAAACAGAATAAATGAAGGCCGTTACCATGGTAATACGTTG TAAACAGTTGACGGAATGTTATTCACTTCAAACAGATAGGACTATGTCGT TATGATTTTAAAATACAAGCTATTTTATTAGAACAAGTAAATTTTGGCTG AGGCTGGGCTGTTCTTAACTTTCAAACTCCTAAATTTTCAGGCTTATATG TTCTTACGATTTTCTTATAACTATTAAGTAGTCATATGGTGTCTTGATTT AAAAACTGAAAATGGGTTAAAATCTGTTAAATCCAGTACTTAATAATTTT TAAATCTAAAGCTCAGATTGTTCTTAGATTTTGGCTGGCTAGCCTCATGT TCTTATAAAATTGTTCTTGTGAAAAAAGCGCGTAATAAAAAAATAATAAT AGCAATAATAAAAAAAACAGATTTATTTGCCCTCCTCGGCATTACACTTT TTTTAGTAAGAACAAACTATATAAGGCATAACTAACATAATGCTTCCATG GCCAAAACATTAAGAACAAGTTAAGAACATTTTAAGGCTTCGTAGACTCG AAAACACAGCTAATTTCTTAGGAAAATGGACAAAAATACATAAAAGTGGA GAAAATAAGAACATGTTAAGAACATGTTTAGGCTTGAAACTGAAAAAGCT AAGAACATTCGAAAGCTTCAAAAATTTTGGTTGTTCTTAATAAAAAAAAG TGTATTGGTCATATGTTTCGAAAAATAGGTGTAATCGAAAACTGCTGCAC GTTTTTTTATAAGAAACACCCATATAAGAATGTTGGAAATTGTTGGGCAA NTTTTTTATAAGAAACACCCATATAAGAATGTTCGTTGGGAAATTGTTGG GCAAAGATTAAGAGAATATCTTAATAATATATATTATGATTTATAAATTG ATTTTTGGCTTTCTTCAAGCTTTATTTAAGCATTTCAAGGTTAATATTTT CAAACAGAATAAATTGAAAAATTGCAAGTTTGTACCTTTCAGAGACCATT ACTTGAAAACTAATTTGCCTTAATCAAATTCTTAGTTGCATTATCAGAGA AACGTATTTAATTCAAAGTAACACATTGACAGTTTCTAGGAGGAGGTAAC TAAAAAGGAAAAAAAGGGGTAAAATACTTTAAAAAACCTTAAGTTATACA ATAAAAAAATATAGACCAAGAAAATTAGAATCGAGAAAAATTCGACAAAT AAAGAAGAAATAGTTATTTCTTTGTTTTTCAAATTTTATCATTCATGCAG AAAAACCGTCATCCTCTGTCCGAAAAAAAAATCTATTGTTGTTATTCTCT CTTTCAAAGAGTCTTTTCAAGATTTTTGTCTTGCCATCTGAGTCCGCATA TATAAGCGACATATTGCATTCGTTTAGTACATATATCTGTACTCACTTGA AGTTTTGTCACTCCTACGATGGCAATACACCTTTTCGGCCGTAGCCGCCA ATTGCCGCGCGAGCTCTTTTTTTCACATAGAGACAATAGAAAAAGGTGTA AAAAGGATTGGATCGAGTTTAGGGGGATAATTAAATAATAAAGTGGCAAG CGCTTGACTGCGCGACTACGGCCGAAAAGGTGTATACCCTCAGATAGAGA GGCTCTTTGATGATAGTGACAACATGGAAGTTTGACTTCTGTACGAAGGA ATAAAGACCCCTGTCCCGATGCGTACGATTTTTATTCAGTGGTGATATAA TATGGTTAATAAAGGAGCTATAATTGAGGTATGAGCACGAACCCAGAACA TTTTGGAAGTTTTTAGTATTTTTTCCAAGTGGGAAAAGAATCGATTGCAT GTTTATCTTATATTTATAGAATTTCTGTAACGCTAGCCAAGCATTAAGAG ATTATCTCCGTCTATCACTTTCGCAAATTTAAAAATCCACTTTCCCGTGG AAATAATTGACGTTTTTTGGAATTTTGGTACCCTTGGGGCACAAGGTAAT CAAGGTAATTCGTTTTATTTTACAAGGTACCTGTTGACCGCAAAAATTCC AAAATTCGCGAATTGACCGTTGACAAAATTAGGGGTAAAGGGACCGAATG ACGTTACAGATTTGGGAAAAACTTCAAAATGCGATATCTCGAGTTTGAGA AGGAGTTGGGAGGTCGTTGACCCCTCATTGGATCGAGAATACTATGGGGA ATAAGATGGGAGGGGTAACAGTGGGTATATAGAAATTTTCAAAAATAAAT ATATTCAAATTGAGGCATTTTGGGTCCGATGACGTCATCAAAACCTGAAA AATTCGATATCTTGAGTTTGAGAAAGAATTAAGCAATGGTTGACCCCTCA TTGGATCGGAAATCATCGAGAGAATCTTTTGGGTAAATGACAAATTGATT TCAGTGAAGTAAGCAATTTATTGACCTTTCGATGACGTCATTTAGGGCCC AAAATCGATTGCATGATTATTGATATCTATGGGGATTTCTCAAACAGGGC AAAACTATTCGTTGAGTAAATAAGGGCCCGTAAAGGGGTGCCATTTTGTA TTTAGCACGAATTTGTGTTCAATAGGCTATTTCACAGTCGAAATGGATCA TGGGTAATCAGGACTGATTGCACCCCGATAACGGTTTCCCGTTGTTTAGG GGCAAAAATCTTCAAAATTCTTCAAAACATTCGACCAATAGTAAGTCGTT ATTGGCGCGCAGTGGTCCTGATTACCCATTACGCTTTGCGACTGTGAAGT AGCCTATGGTAAAGTGACTTTTCTTGAGATTGGATATTTCAACACGAAAT TGGATATTTTAATACAGATAAGAAGTCAGACATCACGTGGGAAATTTATT CGGAAGTTGTTTAAAAACAGTATCTTGGCAATCTTTAGGAAAGATTTCCA TAAATATCTCTCCAGACGTATAACTTTTAGAAAGTTTTAAAGATTTATCA AGGTTGATATATCTAAAACTTTCCATCTGTTTCCAAGAAATTTTCCTCCG TGGAGTGGGCTTTTCCAGGAAAAACCGTACGTATATTTTCCAAGGTTACA TTATTTAAAAAATTGTGATAAACATGTTCATGTCCAGGGGATCGATTTGC CCTTGCGGGTCATGGTCAGAATTTGTCTGATAGAAACCAATTTTTTGTAC ATTTTCATTAGTTTCAAGTAAACTGATACAGAAGTTTAAAATGAGTCTTA ATCCAACAAAATGATAAAGAAAAGAAGAAATAAAGGTACTTGAGGCAATA ACAAAGAAAGAGGGGAATTCTATCAATTCCTTAATGATAATGAAGGTTGA CTCGAAAGTTGATTTTTCAAAAGAAACCGAACTGTATTAATTATTTCCGT CATCAAAGCATATTGCGTGAAAAACAAAGGAAAATGTGTAATTTTGTCTT TTTTAGAGTAGATTGACAAAAAGTTTAGATTGCGGCGAGTAAATATTTAG AATATCTTTATAATTATAACGAACAAAAGGTAATAGGTAATATTGAATAC AGTGCATCCTTCTTGACATGGTCATCAAGAATTTTTAACGACTTCAGTAT ATTTGCTTTAAAGTCGTATTTTCGCGCCGCACAATGTGTCAACAGTGTTG TGTAGTCTTTGTCACGCCCTGCACATGCATGGCATGGAAGAGTTTGTTAC TACCTGTTCTCATGTGGTATGTTGGTTATTTTGAAATTTACCGAGAAAGA TTTAGCTGTTGGTTTAACTCGTTTAGTACTGTGGGAAACTGAAATTCAAC TTCAAATGCAATTTATTTTTTCGGTCCAGTGAAATTATAGGTAGCCGAAA GAATCGTTTATAAATGAAGAAAGTTTAGCTAGGTACTCTAAGGTCTCGAA TAGTACGGGGTCCGAATAAAAGGGGGTTCAAAATTGTACCTTCAAAAACC CCAAAATAAGGTAATTGTAAGCTAAGAATAGGCTATTTAGAGCAATACAA AAAGAATTTCTAAAATTAATAAATGGATGGGGACATTTATTCAGGACCTA AGAGTAGTATTGAAAGAGAACCATTGAGTGCTAAAATATAGTATTTTGAT AGTAAATGTCTGCGTGTCATTTTGTCTTTAATACTCGTGTGTAAATTTGT CAATCTAATTCGAAATGTCAATGCAATAAACAAATTCAAATAAATGTTTA CTTTAAAGTACATGACTTAGACTAATTTTTGCAGCTATATAACCGTGGAT CTTGAAAGCTTGACTAGATGTCTTTGCAATTTTTTAGCATCAACGTTTGA ACGGTTCTTGCCGGTTCTTGTTATGTTGAAATTTTTAATAATTTGGATTT TTCTACTAGTGCAGTATGAAGGAGTATTAGAGAGAGTTTATCTTTGGTCA AATACAGAAATATGAGTGATTGATACGAGTATGAAGTTAGAATATGGTTA AAAATAATCCAGATTTTTAAGTTGTTAAAAGTTCTACCGTTGACGCTGTG CCGACAAATCGAGATTCTATTCAGCGCGCAATCAACGAAGACAAAAGTAA CCATGACGACCATCCAAGATCTTGGATGAAGTTCAAAGTTGATATTTTTA TTCCCGTCGTTGAAAACACAACTAAAAAATACATCAATGCTTTTTAAAAA AAGTCAGTGATAGAGAATCACAACATAAAGTCTGTCTATTATTTCGATTC AATTAAAGTGACATTTCCATAATTAATAGTTTAGTAATTACTGTTATACA TTTGGGGATCATGTAAAAGATTTCTTTCGAAAGAAACTTACTTCAATTAC ACTTGGAGGTTTCTGGGTAATTCGTAAATAGTAAACTGCATACTGATACA GGCTGCGTTTAGACCAACTGGCATTTGTAATTTGGCATTTGCTCATGAGG GATTCGATTTTAATAGCTTTCCCATTGTATTTTCTGTCATGGCATTTAAG GAATCGTCTTTACNTTCAGCATTTTTTGAGCATTTTGATCTAATTTCTTA AGAAATTGCATGTTTTTAAGTCTCCAAAGCCTTAGTATGTTCTTAGAATG TTCTTAAATTTTTAGGCTCGAAGCCTCATGTTCTTATATAGTTTGTTCTT ATAAAAAAAAAACGTGTACAGTGATTAGGTTGGCACTTTCGCGATAAAAT TTCTATTATTGGTCTTCAGAGGTCAATATATTCTTTGAAAACTTGACCTC TGATACTCAGGGTATAAAAGTTCTAGTTTGGAGGAAGATTAATATATTGC CCTCTTTATAAGCCTTTGTGAGGTGCGGAAAATTATGAAAGTAAATTGTC CTCAATTTAAAAATTAGATTTATAACTCCATGCTTCCTTTGCACCGCAAA TATGATTTTTGATATTTTGGTATAAGATTAGAAATATTTCTAATTCCTTC AACGCCTACACTGATTTTCCTGCAGTTGATAGTGTTGAGGCATAAGTTCA TTAAGCCTTACAGGTACCGACCTCCTTTTATTTACCGGTCATTTTTTTGT TATTAATCTTCCTTTGATTACATGCTCAAATTCTTCTCTAGGTTGAAGTT AAGGAAACTAAAAAATTTTTGACGTCAAGCTAATTTTCGAGAAATTTGGA CACATCTCTTGTAAGNAATGCCAGAAAAGGGGATTCCTTTGCTCAAAATG GCATTTCAAATGCCAACGAAATGCCAACACGCTGGCATCATTAGGCATTT GATAAACCGAACAATTACGCGGAACAATAGAATTCAAAAGAATACTGCAA GCAATTACAAATGCCAGGCTGGTCTAAACGCAGCCACAGTCTGACATTAC AATAAGGTAATCTTTGCTCTTCATTTTTGATTCTNACTTATGCTATTTTC GATTCTTATGGTCTTTGGTTCTTATAATAGATTAAGATCAAAATTGTGGA CAAATTGGCATATTGTCCAAATTAAAGTCACGATAAATCATTTTCAGAAT TCAAAACAAGTAAAAGGGAATATGGTTTGAGGGTTTTAGAGGAAGTATCA TTCCAATACCATTAAATTATCGAAGCTCTGGTACCAAGTGAAAGTACTAA TATATTTCTTAGGGTATCACAGCCGTAGCATTGCAAAAAGTGCTACGAAA ACTGATATTGACTTTTATGACGTCACATTGTTAACGATATCCTTTTTTGT ATAATGTTAATCATTTCTAATCAGGTGCATCCTGTAAAACAAAAGAGTAG AGTTTTCATTTTACCTCGTTTTAATGCGCAAATGGTAAACTTCATCACTC GTTAAAAGTGGAGTAGAACTTTGAATAATTTGTAAAATTTTATAAATACT TCTTTTGTTGTCGATTCTTTCAAGTTTTAAGTTTTTCAAAATGGGGTAGT GAAAAACGAATTTATCAAAAAAACAGGAACATATAGCCACTTTGAGCAAA AATTAGAAAAACGTTGGAAATGATTTGGGGCACGTACCAACAAAGGAAGA AATATAAGGAAAATCACAGTTTAAAAAGAACAAAAGCATATAGGAACAGC AGTAATAAGTATACCATAATTAGTGTATAAATGTAAATATTTCAGATGAT TAGAAAATTTCAGAAGATTTTGAAGAATGTGGTGTGATGAATAAATGACC TTCATGTTTTGAAAGACTGAAAAAAATCTATTATTTTTGGATACACTGGT AATTAACGCATGTCATTAAAGCTACATTTCTATTGTTAACTGAAATTTTA ATGGTGTAATTAATACTTGCAATTAAAAATGGACAATAATTACAGAGCAA TTACGTGAAAAAAAAAGGTTTTGGAACAGTTTCTTAATTTTTCTGTTTGT TGTGGAGTGGAACGGATGGCCGTTTGAATATGTTTTTCTTTTAAAGTTTG AGTTTTTCATTAAGTTTTTGGCAAGTAAGTGCACTTTTCATCAGGTAAAT CTTCATTTTTGAGGAAAGATAAAATGTTGATCAATTGATGATACATTTCA GAATCATTTGTAAAGTTGCCGTCTTCGGAATTATGACGTTTTTGAAGATT TCCAAGTTAAAAGTATTGTGATTTCTTTTTTTCTGTGATAATATTACTAA ATCTTTTTCACAGTTTTTAAGAAAGCTTGGCATTATTCTTTCATTGTTAT CATACTTTTATCGGAAATATTAGATTTCCTATAAGATGAAACATTTTCTG CTATAATGTTTCATGGTATATTCTTTTGATTTCACTCTTGTTTTCTTCAT TTTAATGATGTTTTAATTATTGAAGTTTCTTCTTGAATGATGTGATTGAA TTGTAGTTTAATTTGACAGGCAGAGACAATTTCAAAGGATTAATACTGAA ATTTCGATGACACTGTATGCTATTAAATGAAGATCAATTTCTAAATTAAA AAAGGACTGATATTATTTTGGGAAATGGCAATCATCTGTTGTACTATAAT TAGAATATAAAAGATATATTTGTCTCAACAAGGGCTTGTTATAATTATCG TGTTTGTCACAATAAAGTTACAGTATTATACTAAAATTATATGACTAAAG AGGGTACCGATACTTTTGTCTTTGAGAGCTTTTTATCTTCTTCATAGGGC TGTAAGATAATGTCTTGACCATTAGTAGTATTTTGACATCAGTGTGATAA ATATCTAAATCTCAGTGTTCAAAAGTTTTTACGAGTCAGCAGTTGTAGAC CAATAAATCTATTTACTTTATCATTATTTGAGATAGAATTTCCAATCGGA AGGGATCAGCAAATAACTCGAGTTTACAACTCTTCTCACCTTCTCTCTCA TCGACCCTTGGGAAGTCATAATAAAACATGCTATTTGTAATTCGCACCTC AACTTTATTGGATATGTCTTGAAATAGAAATGACAGTCAATTGTAAAAGA AAGAAATTTTCTTTTTGATTTACAATAGGAATATTTGGAATTTTTCAATC GTCTGGTGATTGTTTTATATCTGAAATTGAAGATTATGGCTTTACTCAGA AACGGTTTCGTAAGTGTGACACTAATTTGAAGTAACTCATATTTGTATTC AAATGTAAGCTATTTGTTAGTCATCGAGTCTTTGTGATGTGTTTGTAATA CACAACACTAGTAATTTCAATGGAAATAATTGACAAGTGTTTCTTTTTTG CTGTAAAGTTGAAAATAGCAGATTTTATCATTTCAACTATTTTTAAAAAT AGTAAATGTTACCATAGAATCTAAGTAAGTCGGAAACTCTAAGAACAAAA GAAATTGAAAAACAGGAAATGCATAATAGCCTCTTACAATTACTTGATCA CAACAGAATAGAAATGAGTGTTCAAAAGTTACAACAGAAGTGCTAGAAAC AAAGAAATAATTAGAATAGAAATGCCACAATGAGAAAATTTTAATCACCC CTGATTTTAAAGTTCCACTAAAACCTTAGGTTTGGGATAAATAAAGCATC AAACTAAAATACCATGAATATGAACGGATTAGAATTTCACACTTTATTCA AAGACTTGCTAATTCGTTTCAAATGAATCAATCTATCATTTCAGTGCTTA AAGTAGTCAAGAACTCCACAAGATCAAAGGAAGTCTTTAAAATGTTTTTT TTTTCGTGTACAAAAATAGCATATCTTTAATTGGTCTTTTGTTTTGATCA GTTATCTTGGAATATCACGTTATTACTACCTTGTTCAAAACGCAACATTT TTTATGTACAACTTTTTATAAGAATTAAATGATTTTCTTTCGTAATATCT GCAAGTTAGTTGATTTAGTCTTCAAATATCTTGCACATAAAGTTTAAAGT CTACTTGAATAAAGAACAACGTCACAACGTGAAAATTAATCACATTTTTC GCTTAATCCGGTTGAAAATTGTTACGCTAGGCAACCTNAAGAACAACGTC ACAACGTGAAAATTGATCACATTTTTCGCTTAATCCGGTTGAAAATTGTT ACGCTAGGCAACCTGAATTTCAAGTTTAAGGAAAATAAAAAGAAGTCTTT ACGACGATGCTTTAGAAACAAAAAAAGAACAAGTATCTCTTAACCTGCCT ACATCATTTCAAGGTTGCTGATTGGCTGGTTGATTCTCTTTCTTAATTAG AAGGAGACAAATAGAATGGCTGTAATCCGCTTCTAATTACTTTTTATTAT CTTTTGTATTGACGCAAGAATAATTGAATGAGCTGAACTTTTTCTTTACT AATTGCTCTAATGAATTATAACTAAAATAATATTTCTTTTTACAATAAAT GGATAAACTTTTTTTTTGTTGTATGAGGGTCCCAAACAATTTACTGATTA AGGGACATACAGCACTTTTTAAATACTGCCATATGAACAGGACGGATTTT GAAAGTCCGTAAGGAAATGTAAATGTTAAAAAATGCGACGCGTGAAGACT TTGAGCGCGATTATAGGAGCATTTTTGAATGATATTGTGCTTTCCTGCTC TCAACAAGAAGATTCCACTACTACTACAAGGTAAGTTCCTCATGTTCTTC TTCAACCTTAATCCTACATCTTCCGAAAGTCATTTATTCTTCTTAGATAA AGCATTTTCTTTTCCTGAATGATGAGTTTTTACCGAAAAATGAAGATTTT TTATATTAAAGTAAAACGATTTTATTGATTGCCCAAGCTCGCCCTTCAGT TCCTTTTATACATACACAATTCTAATATACTTATTTCAAGGTTCTAAATT ATTTCTATCAAGCCAATTTATAATTCTGAATAAAAAGTCCAAAAATGTAA TTTATAGACGGAGACTCCGTTTTATTGATAGAGCAAAAACATTTTGTTTA TTTGTAAACGACTCAGTTAGTACTTCTGTCTACAAAATGTTCAAGAGAGA CCAACACTTTAGATTTTTTCCCTTCATTTAGCAGCGAATACTTAAACTTA ATCTTCAAATTCAACATTGAGATTCAAATAATGAAGTAATGACGAAATAG GGAAGGGACTTGAATTAAAAAACGTACTTTATTTCATGATCCAGTTTGTT GTTTTTCTCCTTCTTTCTTGTTTACCCTAACTAAGTTTACTCAACTTATT TAGGATCTCATAGTAGGAAAACTTAGATATTGAGCGAGGGCAATCATCAA TCATTACAACACAAAAGAGACCAAATTTAGTGGGAACTCATCACTCAGGA AAACAAAACTTGTGTGATTTAAATAGAGCTAAACAAATATTTTAGGTTTA TATTACCCTTGCCTTTCAACTTATAGATCCTTAAACATGAATGTTAAAAA TAACTTCTTTTTTTCTTTCTAGGTTATTGCTGGTGTCATTATTAGGTAAA ACNCAAGGTAAGTTCCTCATGTTCTTCTTCAACCTTAATCCTACATCTTC CGAAAGTCATTTATTCTTCTTAGATAAAGCATTTTCTTTTCCTGAATGAT GAGTTTTTACCGAAAAATGAAGATTTTTTATATTAAAGTAAAACGATTTT ATTGATTGCCCAAGCTCGCCCTTCAGTTCCTTTTATACATACACAATTCT AATATACTTATTTCAAGGTTCTAAATTATTTCTATCAAGCCAATTTATAA TTCTGAATAAAAAGTCCAAAAATGTAATTTATAGACGGAGACTCCGTTTT ATTGATAGAGCAAAAACATTTTGTTTATTTGTAAACGACTCAGTTAGTAC TTCTGTCTACAAAATGTTCAAGAGAGACCAACACTTTAGATTTTTTCCCT TCATTTAGCAGCGAATACTTAAACTTAATCTTCAAATTCAACATTGAGAT TCAAATAATGAAGTAATGACGAAATAGGGAAGGGACTTGAATTAAAAAAC GTACTTTATTTCATGATCCAGTTTGTTGTTTTTCTCCTTCTTTCTTGTTT ACCCTAACTAAGTTTACTCAACTTATTTAGGATCTCATAGTAGGAAAACT TAGATATTGAGCGAGGGCAATCATCAATCATTACAACACAAAAGAGACCA AATTTAGTGGGAACTCATCACTCAGGAAAACAAAACTTGTGTGATTTAAA TAGAGCTAAACAAATATTTTAGGTTTATATTACCCTTGCCTTTCAACTTA TAGACCCTTAAACATGAATGTTAAAAATAACTTCTTTTTTTCTTTCTAGG TTATTGCTGGTGTCATTATTAGGTAAAAGGAGTACTGAAGAGTCGTGACA GATTTTACTACAGAAATGTTAGACAACGTGGACGGCAACTTTACATTCCC TCATGACATGACATGTGAAGAGATGTTCCCAGACTTTACACCAGACGTAT TTGATTATTTCTGCTCCGTTACAACAGACACTACTCAAACACAAAACGAT ACAACATTGGAATTTTTCGAACAAGTTTGTTGTGTTGATCGCACGCCAGT TTCGGTTCAGGACGATAGCTCTATGCGTAAAACGCTATACATGATTTGTC ATTCACAGAATTTGACAGTGGATGTTGAAAATAACATTTGTAGAGAATTT GAACCATATTACATGCCCCCGGAACCGTTTACGATAACACCAGCAACGTA TGTAATAATGTCACTTCTGACACCGATTGGTTTAATGGCAAACTTATTGA TTATAATGACAGTGTTGCGAGCTAAGAAACTCAGAACAACTACTGGGTTC TTCATTTGTCACCTCGCCATCGCCGATCTGTTATGTATCTTATCTATGAT GGCATACGTGATAGCCCATTCACAAATTGAACTGAAACAAAATTTTAATA TTTTGATGATATTCTCATCATTAGATGTTTTTATCGGTTCAGCTTCATTG CTACACGTGACAGCTGCTAGTGTGGAAAGAGCCATAGCTGTTGCAAAACC CATGGTGTACCCGTTGATATTGTGCAAAGAACGAGCCAAGAAGGTGATTC TACTTATATGGGTTTATTGCATCGTTTTATTTATCGCTTGTGTTGCTAGA GTATTCGTCAAACCAATTATCTACAATTCAATCATATTTTACATAGCAGT TTGTTTAAGCTTCGGTGTACCGTGCATATTGGTATTAATTTCTTATCTGA ACATCTCAATCAGAGCCTTACGGAATTTACAGATGGAGAAAAGAATTGAA CGATCATTAATTATTGTTTCCATGCTGAATGATACTCAAAGGAGAGCGCC GAGATATCATCATCAGATACGCGAATTAAAGCTAGCTNGCTTGTGTTGCT AGAGTATTCGTTAAACCAATTATCTACAATTCAATCATATTTTACATAGC AGTTTGTTTAAGCTTCGGTGTACCGTGCATATTGGTATTAATTTCTTATC TGAACATCTCAATCAGAGCCTTACGGAATTTACAGATGGAGAAAAGAATT GAACGATCATTAATTATTGTTTCCATGCTGAATGATACTCAAAGGAGAGC GCCGAGATATCATCATCAGATACGCGAATTAAAGCTGGCTCTCAATTTGA CCATTATGACAGCACCGTTTGTTTTCGGTTGGGGATATTTCATGATCTGT AATGTTTATGAGGAAGTAACAAAGACTACATTGGATGGATTAAAAAATTG GTTCCTCAACATGTTACCTTATCTTATCTCATGTTTAAACCCAATCACAT ATCTACTATTCACAAAGACTTTACGAAAGGAAGCTATTAAATTGGTACTG AAACCATTCAGTAAGTTCCGCTCACTACACCATCGACGCTTCTCATCGAC ATCGCTCATTTTTACCTCACGTAATAGTAGCAGACACTCAGACTCGTCCG ACGCTCGTATGATGCAAAGGGAGGTCTAAGCTTAAGCTAGATCCCATCAT AACGATTAAGCTTTTGACTACTAAAGCTTTATCCGATGGTAGGAGGGATT GTATTGAGTGTATTGACAAAAGAAGAAGCAACAGGTCATAGCAGGGACAC TAATTAAGTAGATAATAAAAACAATTATAATTCTTGTAAACATTCAGAAG TAATGGAACAAACACATTAAAACGGAATTAAAAATGACAAATATTTCAAA TCCAAAGGGACGTAAATTTGAAATAGGAACACGAACCAAAATTTAGAATG TAAAATATTTTTTTTCAACGTATATAAAAAGATTTAGAGCAATATAGCTA CGGGAGATGTAAATAGAAAACATGTTTAAAACGACCATTTATCTTTGTAA AATATTATTATCCGTGTAAATTTTTGGCTGATAGTATAGAAAAATATCAT ATTTATTTGAGAATTAAAAGAAAACAACAAGAAAAGCTGCTTTAATTGAT CAGTTTTTAATCCATTTAATGCTTGGAACGCGTAAAATAATGCAGTGGGT CAAAGGACACGAGTCAAACATTGAGCTACTTATCTTCGGACAACTCAAAC TAAATAATAAACGCTTTAGGCGACAATTTTATTGCCTTGAAAGAGAACTT ATCAATTCCAGGTCTCAAAAATGTTTTCAATTCGGCGAGAAGTCAAACAA AAGTATTTTACTCTTATATTAATTAGAATTTCTATTGTTTCACAAAGGGA AAACACATATTTATATACTTTTGTGTTCTGCATGTCTTCTTTTTGAAAAA TAGAAGTTACGCTCAAAATCCGAACAAGATTAATTACTTTGGAAAAGGAG GAAATAACATTTCTGGAATTCACAATTGCCTTTCGCATTGCGTTTGATAA GATTACGGACTGTCAGTTTTTTGCAAGCCTTTAATTTCAATTTGACTCGT CAACAAAAACAGAATGAGCCTCCAACTACAAGAGAGTCGAAATACGGGCC ATGTTTTCGAAGATAATTAGTGGTTTTGAGGGATAACTACTTCCGTGTGA AGAAGGATGAAAGTTTGTTTTCAATCATAAGCTCGAGATCATAAGAAAAT TCCAAAAGAATTTCATAAGTTAACAATAGCTTTAAAAAGACCTTTGAATC GATAATTTAACGGTCCGTTTAGTGGTTGACCATAGAGTTTTGCAAATTGA TGAGGACCTCATTTTAAAGCCTGATTGTAACTGTAAGCACCACCTTTTTC CACTCAAAAGTCGTTTGGACTTCCTTGCATTGTCAGCTAACAATCAGAAC TCTTCCATATTTAATTGTTTCTTTTTCAAAACAAAAAGCAATTTCCCGTA GCTAAAGAGACCACAAAATCAAAATATATGCAATTTACGGGAAGTAATTT ATGGGTCGACATCAATAGCCCCACCAAAACATTCGTGAGCTTCATTTAAA TGATTTGTTAGGATATCTAGTTTGTTCTTGAAAATATATTTTTGTGTGCA AAAATGTTAATTGTAAAAGATCAGCAGCGAGTTAATCACTTACATGAGTA TAGCTGGTATTAGTATAGTGCTGTTCGCAAAGGTTGTCAGGTTGGTTATA GTTAATTTTCAATAGATTTTTGATCAATTTGCTATGACAGAAGAATTTTC ATGGTTCTAGAAATAACTGAGATCACCTAACTGAATTAAATATTACGTAA ACGATAAATCAAAACAGATTGATTTTTTAATCTTGGACAACCTTCGCTTT TACTTAATATATACTCATCATAGTTCTCCAATGAATAGAAACGATTTATC ACTTTTCCGCAAATCTAATTTAATAAAGATCCCACACTCACTGACTAGCT GACGACCTATTTAGAGGTTATCAGACAAAGAAGTTACTATTTTAAGAAAG TTTCTATGGAAACATGATAATCCAAGCTAAAGAATTCTTTTTTGAAAATA GACATCGAAAAATTCGGTTGAAGATTAAATGCTTGATGAATAAAGTCTTC TCTGTGCATAGATGCTTCATTTTTAATAAAACACCTTCAAAAACACCAGA TAAAGAATTATCGAACTTAAATCTTGAGACGAGGGATGTTTTATCCCAAC TAACAATTTTAGCCACGGTTAAACCTCCGTTATCACAATAGAAACAGAAA TTTTAGCTCCACTGATTCTTTTGCAATGAAATGACCGCAACAATCTTAAA TCTTAATTCTGAGGGTATGGAAAATACTTACTGGAAAAGCATCATCAGAA CAGCTTGGCTGTATAGTAACGACACTTCAGTATATTTTTTCCAAATCAAT ATAAAATGGTCGCATATATTCCCTGTGGGACGGTTAATTGACTAATCCAT ACCTACAATACAGAAAGATACACGATCAGCCTTCAAAGAGACGAAATAGG ATGAATTTTATACTTGTTATCTAGCTCCCTAACTTTTTCCTTTTTCTCTA ATGTACCGTTATCGTACTTTCGTTGTAGGAAAAACAGAAAAGCAAGGCAT ATAGATAGTCATCTTCAAAGGGACATCAGATATCAAAGACAACAGAAAGT CCACTATCAACGTTAACGAAAAGTTGAGTGGTGTGAGCGAAGATAAGACA AATTGAACAAAAAGACGTGATCTACTGCGAGTACATTCATTCGATCGACA TCAGTAGAACAAGAAGGGCATTGGGAAGCCTTACATCCCAACTATTGTTA AAATGAACGTGACTTCATGTAATGATATCATGAAAATGGTACAACCTTCC GGAACAGTGTCTGCAGATTTGATTCATGTCATCTTGCCAAATATTTGTGG TATAATTGACAGTATTAATGCATCTATGGTGACATTCGAGGAGAGAATCT TTTACGATCATTGCTGTGACCCGATACCCTTTATGATCCTCAATAAGACT GTAAATATAAATAATGAGACGCACCCAGAACAATTGATTAGTGACGTGTG TAATTATATGCACCATAATCGAAACCAACAAGAAGAAGCTCTCTACCAAG AGATCTGTTTAAATTCTTCAACAAATAATTCTTCCGTTTTAAATCCAGCA TGGCGACTATTGACATTCATCATTCTATCCTTGCTTTCACCGATCGGCTT CTTTGCTAACGTTTTGATCCTTATGACCGTATACAAAATCAAACATCTTC GCAATACCACTGGTTACTTCATCTGCAATCTGGCTGTTTCTGATCTTCTG GTTATCTTTCAGATGCTACTATTTGTGACCATGTATACGTCTGGTGCAAT GTCAGAGGCGAGCCCACGAGTTCAAAGCTTTTTCTTTCCAACAATCGATG TCGTTATTGGTTCAGCTTCGTTGCTACATGTAACAGCAGTGACTATGGAA AGAGGCATAGCTGTATCAATGCCTTTGAGATATCCAAGGTACCTTAATGA ACGAACAGCGAATCGTACCATTGTTGGAATCTGGATTTATTGTTTGGTGC TCCTCGTCATGGGTTTATTACGAATACCGATTGTCAGCGACGTCTACAAT TCAGTGTTTTTCTTCATCGCTGCTACATTGAGCTTTTTCATCCCTTGTAT ATTAGTGCTTGTCTCTTACGGTTTTATACTGGTATCCGCGTTAAAGAATA TGAAAATGGAAAAGAAAATCAGCAAAGTTATCGTTGTCATATCTATGNAC ATGTAACAGCAGTAACTATGGAAAGAGGCATAGCTGTATCAATGCCTTTG AGATATCCAAGGTACCTTAATG

Coding sequence (CDS) from alignment at sc0000012:851175..874746-

>TCONS_00001955 ID=TCONS_00001955|Name=TCONS_00001955|organism=Clytia hemisphaerica|type=CDS|length=954bp|location=Sequence derived from alignment at sc0000012:851175..874746- (Clytia hemisphaerica)
ATGAACGTGACTTCATGTAATGATATCATGAAAATGGTACAACCTTCCGG
AACAGTGTCTGCAGATTTGATTCATGTCATCTTGCCAAATATTTGTGGTA
TAATTGACAGTATTAATGCATCTATGGTGACATTCGAGGAGAGAATCTTT
TACGATCATTGCTGTGACCCGATACCCTTTATGATCCTCAATAAGACTGT
AAATATAAATAATGAGACGCACCCAGAACAATTGATTAGTGACGTGTGTA
ATTATATGCACCATAATCGAAACCAACAAGAAGAAGCTCTCTACCAAGAG
ATCTGTTTAAATTCTTCAACAAATAATTCTTCCGTTTTAAATCCAGCATG
GCGACTATTGACATTCATCATTCTATCCTTGCTTTCACCGATCGGCTTCT
TTGCTAACGTTTTGATCCTTATGACCGTATACAAAATCAAACATCTTCGC
AATACCACTGGTTACTTCATCTGCAATCTGGCTGTTTCTGATCTTCTGGT
TATCTTTCAGATGCTACTATTTGTGACCATGTATACGTCTGGTGCAATGT
CAGAGGCGAGCCCACGAGTTCAAAGCTTTTTCTTTCCAACAATCGATGTC
GTTATTGGTTCAGCTTCGTTGCTACATGTAACAGCAGTGACTATGGAAAG
AGGCATAGCTGTATCAATGCCTTTGAGATATCCAAGGTACCTTAATGAAC
GAACAGCGAATCGTACCATTGTTGGAATCTGGATTTATTGTTTGGTGCTC
CTCGTCATGGGTTTATTACGAATACCGATTGTCAGCGACGTCTACAATTC
AGTGTTTTTCTTCATCGCTGCTACATTGAGCTTTTTCATCCCTTGTATAT
TAGTGCTTGTCTCTTACGGTTTTATACTGGTATCCGCGTTAAAGAATATG
AAAATGGAAAAGAAAATCAGCAAAGTTATCGTTGTCATATCTATGNACAT
GTAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_001009XLOC_001009Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001955-proteinTCONS_00001955-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001955-exon-sc0000012-1575043694:874646..874746TCONS_00001955-exon-sc0000012-1575043694:874646..874746Clytia hemisphaericaexon
TCONS_00001955-exon-sc0000012-1575043694:851175..852418TCONS_00001955-exon-sc0000012-1575043694:851175..852418Clytia hemisphaericaexon
TCONS_00001955-exon-sc0000012-1510915933:874646..874746TCONS_00001955-exon-sc0000012-1510915933:874646..874746Clytia hemisphaericaexon
TCONS_00001955-exon-sc0000012-1510915933:851175..852418TCONS_00001955-exon-sc0000012-1510915933:851175..852418Clytia hemisphaericaexon
TCONS_00001955-exon-sc0000012-1491911889:874646..874746TCONS_00001955-exon-sc0000012-1491911889:874646..874746Clytia hemisphaericaexon
TCONS_00001955-exon-sc0000012-1491911889:851175..852418TCONS_00001955-exon-sc0000012-1491911889:851175..852418Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000012supercontigsc0000012:851175..874746 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.473695 0.0985652 0.0841596 0 8.2758 5.50582 3.87916 3.93113 2.66302 4.08313 3.32126 3.22435 6.50903 5.1298 4.42395 5.24556 0.419056 0.565392 2.24172 2.25004 0.0977262 0 0.811244 1.2916 0.502961 0.778366 0.128469 0.22851 0.138653 0
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: Biological Process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: Molecular Function
TermDefinition
GO:0004930G-protein coupled receptor activity
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0007186 G-protein coupled receptor signaling pathway
cellular_component GO:0016021 integral component of membrane
molecular_function GO:0004930 G-protein coupled receptor activity
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00001955 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top