Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001955-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001955-protein
Unique NameTCONS_00001955-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length317

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001955-protein ID=TCONS_00001955-protein|Name=TCONS_00001955-protein|organism=Clytia hemisphaerica|type=polypeptide|length=317bp
MNVTSCNDIMKMVQPSGTVSADLIHVILPNICGIIDSINASMVTFEERIF
YDHCCDPIPFMILNKTVNINNETHPEQLISDVCNYMHHNRNQQEEALYQE
ICLNSSTNNSSVLNPAWRLLTFIILSLLSPIGFFANVLILMTVYKIKHLR
NTTGYFICNLAVSDLLVIFQMLLFVTMYTSGAMSEASPRVQSFFFPTIDV
VIGSASLLHVTAVTMERGIAVSMPLRYPRYLNERTANRTIVGIWIYCLVL
LVMGLLRIPIVSDVYNSVFFFIAATLSFFIPCILVLVSYGFILVSALKNM
KMEKKISKVIVVISMXM
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_001009XLOC_001009Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001955TCONS_00001955Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: Biological Process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: Molecular Function
TermDefinition
GO:0004930G-protein coupled receptor activity
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0007186 G-protein coupled receptor signaling pathway
cellular_component GO:0016021 integral component of membrane
molecular_function GO:0004930 G-protein coupled receptor activity
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 153..174
score: 36.92
coord: 199..221
score: 24.43
coord: 235..256
score: 19.92
coord: 270..293
score: 23.22
coord: 120..144
score: 20.24
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 136..303
e-value: 4.2E-19
score: 68.7
NoneNo IPR availableGENE3D1.20.1070.10coord: 86..317
e-value: 5.2E-33
score: 113.7
NoneNo IPR availableSUPERFAMILY81321Family A G protein-coupled receptor-likecoord: 109..314
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 135..317
score: 22.879

Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00001955-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top