Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001950 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001950
Unique NameTCONS_00001950
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length5100

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001950 ID=TCONS_00001950|Name=TCONS_00001950|organism=Clytia hemisphaerica|type=transcript|length=5100bp
AAACAACCAATAATGGTAGAAAAGCTGCAGCAGATATTCATTTCTGATTT
CAAACGAATTTCAAGTGTGTAAAGACTAGACAGactGAGAAATGGTACGT
ACTGTACTTTGCCATCCATTTGTGGAGCAAAAGAATTTCACTGACCAATA
CGATGCATCGTGTATTTGCTGCACCAATGATGATAAAGTTCTCATTGGTT
CATTGTATGGTAGCATCAGCATAATTGATCTCAAAGGTGGTACACATAAT
GTTTTACACAAATTTCCTTCAAATGGAATCCCAATCAAAATGTTGTTTTC
TGATGATAAGCAATTCTTGGTGTCACTTGAATCTAAGCTTCAAGATTATC
GTGTTGGATTATCAGCTAGGGAAATGAACTGTCAAGCTAGAGTATATTCA
AATATTATGCTTGGTAACCCACAGAAGAATGTTGCCCCTTTAAGTAGCGG
GTATTCAATTAACCGACACAATAATAATCATACACGAAACAAGTTTTCTG
TTATTGATTTTGCTGGTTTACGTCAACCTGCAACTGATATTGCCCTATGT
AACTCTCGTCATAATGTTGCCATATCAAGTTCAAAGAAAATCTATCTTTA
CGCTTTCAAAGAAGTTATGTCTGCTGATTTACCAGAGGATGATAGTGTCC
TCACAATTGATTTCATACGCATGGTAGAAGTTGAAACCACTATCAATATA
AGAAGTGTAGCTTTTTCATTAAATTGGATTGCCTTTGCCTCCAAAACTGA
AATTCGTGTTATTCAAGTTTATCTTCACCAACCATCAGATGAAAAGGTTT
ATCAAGGAGAAGACGTTTCTGAACTTCTTGATGACTCAACAACCCAAACA
GACGGTCTTGAGAAAACCACAGTCTCAGTTCTCACATCAAAACCATCAAA
GTCAAATAACATGCCAGTACAAACGACGTTATGGGATTTTGACCAAGCTA
CTTCCACTTCATCAATCAATGAATTCGAATCTAAAGGTGGTCATGGTATG
ATGCAAATGCAATCTATCCAGGAAGAGAAACCTTACATTGATACTAAATC
ATCTTCCAAAGAAGTGACAGGTGAACATACAATCCTTGTTGGTCACCCAC
TATGTTGCTCGTTCCTTGGACAGATGCCCACCAAAGAAGGTCACGTCAAT
TATGCCACAGTCACCAGTACTACACATCTGTATCGAAGATTTGAGGAGGA
TGATATCTCTTTCTCGGGAAACACTGAAAGAATACATAGTCTACAATGGC
TGCCTATCTTTTTGGAAGaTATCGCTGAACACAAACAATTGGAAGTTGAG
GAGAAAATGCCATGGCCTTGGAATGCTTTCTTAAAACCACACTCCTTCCC
AGTTCTCCTCTCCATGCCTCTTTTTTTCTCAACTGGAACACATGGTTACC
TCTACGACACGTGGAACTCAAAAGGACTCATCTTAGACTACAGTTACACG
TCAGATTGTTTGAGTGCCAAACATACAAATTCACTTCTATACACTGTCAC
CAGTAATGGATTGGAGATTTTCACTTCTCGCCTTTATCCCTTTGTTTCTG
GATGTacaaaagaaatgtttaaaGAATGCAAGTTTTCCAAAAATGCCGAA
ATAGCTAATAAAGCAGCTGGTAAATCAAAACAACCTTATCGTGCTCGAGA
TCGTGGACCAACAGAGATCTTCCTGGAAACCAATTACTTCATGGATTACG
TGTCTGTCAATAAAGATCTCTCCATGATCGAAGATGGTGGACTGGGCCCT
AGTAATGATATTGAGCCAAGAAAAAGAACCCATTCTTCGGCCTATGATAG
ATACCCATATCAATGGCTTTTAAAGACTTGTCCACCGAAGGATCTGGAAA
CTTGTTTGGTTGGTATGTATCCATACCAAGATGTTGTTTGTGTGGCAACT
AGTATGTCCTTCGTCCTCATGTTCATCAAAGTCCCTAAAAGAACAAAaGA
GAAGGGCGGCGCAACATCATCACCATGGAGTGTATGCAGCTTCGAAAAAC
ACATCTCAACGGATGTGGGTCAAAAGATTACCAAACTAATTGAAGAAAGT
GAATTTTCGAATCCCATGGTGTATTATCATTTACTGTGTGAATCACATCT
TTTACTTTGTTGTGATTTGATGAGCAGACCAAACGATGAAATTTTGATCA
AAGCATTGAAATCATCAGCCGTCTCACTTGCAACCTTCTTAATGAGATGT
GAACCAAGTTTTGATTTCACCAGCGTCAAAGGGTACTTCGAAATGGCTGG
AATGCAACCTACAGCCGTCCTTGAACACATGAACAATGAAAACATAAGAC
TCGAGCGAAAGAAACACAGTTTTGGAACTGGAATGATTGAATATCTGAAC
AATACTCTATTCGGCAAAGAACAAGTACAATTCGATAAGAATATTTGTGA
TTTCATCATCAATGTGTATGGCAAGAATCATCCATCAATGCTAGCAAAAG
TGATCTTAAAATCCAATCTACCTCGTCTCTATTCAATTGaTTTATGTGTC
AAACTGATGAGCAAATACAAGcggaaaaaagaatcaaaagaaCAGAGACT
ACAACCACTGGACAGCTTATGTTTTGCTTACTTGCACATGGACTTGGGGA
ACCCAGGGCACGCGGAAGAGCTTTTGAAAGAACTGGAAAAGGACGATTTG
CTAAAGATTTGTATTTCAAATACTGAAGTGTTATTCAACTCACAATATCA
ATTGACGCCCATGGGACAGTTAATGAAGAAGCATTTCAAAGAGAGTTTCC
AGAGCATTGTAATTTCTCTGTTCGATACACGCACAATCGACTTGAATAAT
ATCCTTCAAATATTCCAGgCAAAAGGAAAGGCTGAAGACAATGAGAAAAG
AATTCCACTTGATCGACAAGCTTGTCAAATACTTGAAAATCTTCTAAATG
ATTCATCTCGTCGAAAGAGCTTCCAAGAAATTGCGGTGATCTTAGTGGAC
CAGTACTTACTGCGCATGAcaaagaaaatgaatactaaTGATGGTTGGAA
AATCAAACATAACCACGAGATCAAAGGCAATGGGCATTATGGTACACGCT
TCACTTGGCTCAATAAGTTAAAACCATTTTCAGGTGAATCACCTTCTCCG
CAAGACTGTATCATCctcaaaaacaatcaaaagtcaCGTTCAAATGACAC
TAGTGGTGGTACAGGACGAAAACAAAACGATCAACAAAGCATGGCTTTAT
CCTTACCAAGTACTGGATTGACCACCAGTAATCCTTCGTCACCATCCAGA
TCAAAGATTCTTTCACCATCATCGATGGATGACACAAATCATGAAACATC
CAAAATCTTGAAATCAAGAGAATTTTGTCCGTGTTGCTGTTGCAGTGAAA
TATTGATCAAATTTCAGTCATTGCTGTGTTCAAGATACAACCGAAAGGAG
TTCAGTTTACATGTCATCGAGAAATTGAAAGATTCAGATTTTGTTGGAAA
AGAAGCATTGTTGTTGCTGGCCTGGCCCAAAGCTGGAATGGCTCAAGAGG
CAGTTGATTATATCGTGGCGAATTACCCGGCGTTGATCCTACAGTATGCC
AAAGATATGTTCGATTGGAAAGCTCAgTGGCAACAACTTTTACAATGCTT
GCTGGAGTACATCAGAGCGAATAAATTTGAACCGTGGAACTATGATGTTT
ACATGGAAACACTGAAAGGTGTTTTGATGAGGTTGGCAAGAGCGTTTTCA
CCAAAAGACTTTCTCAACATGTTACCGTCAGATATGAATGTTAATTTCAT
GTTACCTTACCTGGCTGAATGCAATGAATTTCATCGATCTTCGTCGCTCA
AAAGTCAAATCTTACAAACTTATAAAACTCAAATCGAGAttcatgaaaac
ctttaaagaaattttattgcATTACTTTGGAGGTAAAAACTGTCTTTGAA
ATTGTTGAATGTGCTGGAACATTAACTAACCTTGATGATATAATACATAG
ACCCTGGTATTAAAAGATTGATGTAAAGCACCTCGAAGGACTTAGTGTTT
TAAATTAACTTCATGGTGAAGACATAATAATAATTATTTGCTTGACCCTC
GGAACTACACATATGCTGTTCGCTAGAATTTGAAAACTATATCTTTATAT
GCAAGATAACCTTGCTCACATATCTAGAATATTGTATACAGCACAAACAT
CAGCAGGATAGGTGCACGACTCAAACCTGTTGAACGCCTTTGTTTATACA
GTTATGTTTTGTTGTTGCGAATGCTAGTACTTCATGCCGACAAATTATCA
TGTTTGAATTTGAAACTGCTTACTGATTTTACTTATGGACGGGGCTCCAA
TCTCCAATCTCCAATATTGTTTGAGAAGTTGACATTTTTTGGTCTGCAAA
CATATGATTGTCACTCTTAAACGTCTTGAATAGAATTGAATATAATAAGG
AATACGAGGCTCACCCCCTTTCAGCGTGAAATATTTCCGCTAATTTCAAT
AGATCCACCATTTGCAGAATATAATGACAACAATATGGTCAATCATTCTA
AATTACCAAGCCCGGTAACGTCTTTACATAGAACTTTCTTTGGTTATCAC
TTGATCATGGCTCAATTGGTACCGTACCTAAGGCTAACTTTCCAAAAGTT
TGCTCAACATTCAAATGAAAACATATCCGCTGAGATCAAAAATTTCGAAA
CCTCCCAAATTATGTCAGCTTAGGTTTTAACTTATTTCAAAGTGGATATA
CCGCAGCACTATTCGAATATTTCCGATTTTGTCGCGTTTGATTGATGATT
GAAGTTTTGGATAGTAAGCCCTAAGAACGGTAATTGTTTTTCAACGAATT
TGGTTAAAAGCCTTTCTCGTTGTATAAAGATGTATCGGAGAGTCCACTCG
GAATCGAGAAGACTTCAAAAGGTATATatttagaaatttcattctGAATC
ATCGTTTATATTTCGAATAAGAATAAAgttgatcaaaatatttttaagtc
gGAAATTTTTGCACTTTggtattgtaatttttttgtacGATTTTTAGATA
ACTTATTATTTCACACggattatatttttttatgaaatagatAAAAGATT
TACGAGTTGATGTATGTATATAGCAGATAGAAATATTAATTTAAATCGAT
Run BLAST on NCBI

protein sequence of TCONS_00001950-protein

>TCONS_00001950-protein ID=TCONS_00001950-protein|Name=TCONS_00001950-protein|organism=Clytia hemisphaerica|type=polypeptide|length=1254bp
MVRTVLCHPFVEQKNFTDQYDASCICCTNDDKVLIGSLYGSISIIDLKGG
THNVLHKFPSNGIPIKMLFSDDKQFLVSLESKLQDYRVGLSAREMNCQAR
VYSNIMLGNPQKNVAPLSSGYSINRHNNNHTRNKFSVIDFAGLRQPATDI
ALCNSRHNVAISSSKKIYLYAFKEVMSADLPEDDSVLTIDFIRMVEVETT
INIRSVAFSLNWIAFASKTEIRVIQVYLHQPSDEKVYQGEDVSELLDDST
TQTDGLEKTTVSVLTSKPSKSNNMPVQTTLWDFDQATSTSSINEFESKGG
HGMMQMQSIQEEKPYIDTKSSSKEVTGEHTILVGHPLCCSFLGQMPTKEG
HVNYATVTSTTHLYRRFEEDDISFSGNTERIHSLQWLPIFLEDIAEHKQL
EVEEKMPWPWNAFLKPHSFPVLLSMPLFFSTGTHGYLYDTWNSKGLILDY
SYTSDCLSAKHTNSLLYTVTSNGLEIFTSRLYPFVSGCTKEMFKECKFSK
NAEIANKAAGKSKQPYRARDRGPTEIFLETNYFMDYVSVNKDLSMIEDGG
LGPSNDIEPRKRTHSSAYDRYPYQWLLKTCPPKDLETCLVGMYPYQDVVC
VATSMSFVLMFIKVPKRTKEKGGATSSPWSVCSFEKHISTDVGQKITKLI
EESEFSNPMVYYHLLCESHLLLCCDLMSRPNDEILIKALKSSAVSLATFL
MRCEPSFDFTSVKGYFEMAGMQPTAVLEHMNNENIRLERKKHSFGTGMIE
YLNNTLFGKEQVQFDKNICDFIINVYGKNHPSMLAKVILKSNLPRLYSID
LCVKLMSKYKRKKESKEQRLQPLDSLCFAYLHMDLGNPGHAEELLKELEK
DDLLKICISNTEVLFNSQYQLTPMGQLMKKHFKESFQSIVISLFDTRTID
LNNILQIFQAKGKAEDNEKRIPLDRQACQILENLLNDSSRRKSFQEIAVI
LVDQYLLRMTKKMNTNDGWKIKHNHEIKGNGHYGTRFTWLNKLKPFSGES
PSPQDCIILKNNQKSRSNDTSGGTGRKQNDQQSMALSLPSTGLTTSNPSS
PSRSKILSPSSMDDTNHETSKILKSREFCPCCCCSEILIKFQSLLCSRYN
RKEFSLHVIEKLKDSDFVGKEALLLLAWPKAGMAQEAVDYIVANYPALIL
QYAKDMFDWKAQWQQLLQCLLEYIRANKFEPWNYDVYMETLKGVLMRLAR
AFSPKDFLNMLPSDMNVNFMLPYLAECNEFHRSSSLKSQILQTYKTQIEI
HENL
Run BLAST on NCBI

transcript from alignment at sc0000012:666048..706669-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001950 ID=TCONS_00001950|Name=TCONS_00001950|organism=Clytia hemisphaerica|type=transcript|length=40622bp|location=Sequence derived from alignment at sc0000012:666048..706669- (Clytia hemisphaerica)
AAACAACCAATAATGGTAGAAAAGCTGCAGCAGATATTCATTTCTGATTT CAAACGAATTTCAAGTGTGTAAAGACTAGACAGGTAGGAACTTTCGGCTT CTGCACAGTTTTTAAGTCTTCTGAATGTGTAATTTTTATTCTTTAAGAGT ACCAGTAAATATCTTTCATGCTCCTTTGGCTTTGGTATTTTTAGGTTTTG TAGATCAAATACAGGTCTCTTTTAAAGCTTTTTTTTCCATTTAAATTTTT TTTTTTTTTTTTTTTTATTTCAATCTCTTTTATCACCAAGAATTGGTATA AATATACGCGTTAAAAATTTGTTCTCTAGATATATCATATAGATTATCTA CAAGTTTTCGTTTTTCATAGAAAAAAAAAAATGTTAAAAAGCCAGACGGT GTCAATCGAACAACTTCGAACAAAAATCGCAATCGAACCAATCGAACGTA ATCGAACGCGATCGGATAATTGCGATTCGATTGTCGAACGTAATCGAATC TCAATCGAACGGCCGATTCCTGGGTAATATTCGATTGCGTTCGAGTAAGG TTAGATTGGTTCGATTGATTGTTGACTATGTTCGATTGGTTCGATTGATA TTGTCAATTACATTGGATTAATCTTCGATATCGTTCGATTACGATTATGT ACGATGAGTTTGATTGCGATTAAATTAAATTGGATCACTCTGTTAGAGCT TCTTAGCGTGGGCGGCCGAGCGCTTAAGTACCATACTAAAGTGAATAAAA TCTAATACAATTGAATCAATCGAACGTAATCGAATACAATCGAACGTAAT CGAAGCAATCGAACAGCAAATCCTGGGTAATATTCGATTGCGATTCGATT GCGTTCGACAATCGAATTGCAATTATTCGATTGCGTTCAATTGCGCTCGA TTGATTCGGCGTTCGATTCGTTCGATTGACACCGTCTGGTAAGTATGTTA TCTAATAACTATATAGGATTCTTATACTAAAATTTCATGAAATTCTGATG AAGAGATTTTGAATAATAAAATCAAAACTGCCCTTTTCCAGCGAGCGCTT CGTGTTTTCTGCCTCTGAAAAACCGTAACTATTTTATGGCGCATGCNAAA GGAGAGATTGCGCTGTCAAACGGGGCCTACCCGAAGGTACTGCAGCAATC TTGCCTTCAGGACTACCACGTGGCCCCCATGAGGCCGAACGGCCTAAAAA AAAAAAAAAAAAAAATCTAGCGGAACCACACAAAGGAATCCCCGTTGATT TGAGATGCTCGGGGAATTGCTCCAAAAAGCGCTTGATAACCGAGAATATT GGAAAAGGGACTAAAAGAGAACAAAACAAAACAACACAAAAACCGCACAG TTCGTAGTTCGAAGTGTAAGATTCAAAGTACGTAGTGATGTCAAGCAAGT GATGTCGTATCAACCTGACAAAAAAAAAACAAAAAAAAAAAAAAACGATA TTCTAGCATAATAATATTTCAACAATAGTAAAAAGAAAAACTCCTAACAG AGACCACCACTAAACCAGGCTGGACAGAAATAGAATGCTTAGATGGGAAA CGGGCCTAAACTAGGGCTTGGTACACACATACACGAAATGATATGTAAAA TTCGAAAAACACGGGAGATTCCCCGATTGTGTAAACACACAATAATGGTG TTGAGCTTGAAAATCTTGAAAAATAGTAGTTGCTGGATTGAAAGTTACAC TGGGGTAGGCCTCACAAGGAGATTATGTAGAAGTAATAATTGATAAGTCT ATAATATAAAGTAATCTATGATGGTATAAATCTATGAAGCATTGCCTTCA GTTCTTTTCTATTCTCATAAATGTGCCAGTTAGTCAGTAAGTCATTCAAT TTCTGCTCAGTTTCCGGATCCAAGTTGTTTACTCCATCAACGATCATTCT ATATTTCAAGGTTGGGTTCAGAATTAAACTAACCAAATCAACATTTTCAG TAGAACAAATTTCAAAAACTTTTTTCATACAAGAGTAAGACTGACTTCCA CTGTGTAAGAGGTTGAAAAGATAATTCCGAGTAGTTTCGTTTTTCAAAAG TTGTTTGACAAAGTTGATTTTTCGTTGGTCCACCAAATGTGCTGTATCGT ATAGGTGGTAGTGCTTTAACAGTTCATTTGTTGAGTGTTTCGAGAGACCC AGCAAGCACTTGAGAGCCGACCGACATTGCCTATTCATCAGATCGGAGAA TGATTTATTAGTGTCCACTAATTCCATTCCGTAGAGCATCTTTGGAATTA CTATTGATTTGAATATGGTGGTGATTGTGTCTGGGTGTAATTTACGAATC CCGCTCGATACTAGGGACGAAGTCACCGCCCACAGTTCAGAAATGCGATC CTGTCTATGTCTGAGAAGGGAAATATGGTTTGAGTGGACTGACCAGGTGA AGCCAAGATGGNAAAAAAAAAAAAAAACGATATTCTAGCATAATAATATT TCAACAATAGTAAAAAGAAAAACTCCTAACAGAGACCACCACTAAACCAG GCTGGACAGAAATAGAATGCTTAGATGGGAAACGGGCCTAAACTAGGGCT TGGTACACACATACACGAAATGATATGTAAAATTCGAAAAACACGGGAGA TTCCCCGATTGTGTAAACACACAATAATGGTGTTGAGCTTGAAAATCTTG AAAAATAGTAGTTGCTGGATTGAAAGTTACACTGGGGTAGGCATCACAAG GAGATTATGTAGAAGTAATAATTGATAAGTCTATAATATAAAGTAATCTA TGATGGTATAAATCTATGAAGCATTGCCTTCAGTTCTTTTCTATTCTCAT AAATGTGCCAGTTAGTCAGTAAGTCATTCAATTTCTGCTCAGTTTCCGGA TCCAAGTTGTTTACTCCATCAACGATCATTCTATATTTCAAGGTTGGGTT CAGAATTAAACTAACCAAATCAACATTTTCAGTAGAACAAATTTCAAAAA CTTTTTTCATACAAGAGTAAGACTGACTTCCACTGTGTAAGAGGTTGAAA AGATAATTCCGAGTAGTTTCGTTTTTCAAAAGTTGTTTGACAAAGTTGAT TTTTCGTTGGTCCACCAAATGTGCTGTATCGTATAGGTGGTAGTGCTTTA ACAGTTCATTTGTTGAGTGTTTCGAGAGACCCAGCAAGCACTTGAGAGCC GACCGACATTGCCTATTCATCAGATCGGAGAATGATTTATTAGTGTCCAC TAATTCCATTCCGTAGAGCATCTTTGGAATTACTATTGATTTGAATATGG TGGTGATTGTGTCTGGGTGTAATTTACGAATCCCGCTCGATACTAGGGAC GAAGTCACCGCCCACAGTTCAGAAATGCGATCCTGTCTATGTCTGAGAAG AGAAATATGGTTTGAGTGGACTGACCAGGTGAAGCCAAGATGCTTGAGTT TTTTCTGTGGGTAAATTGTCTCGTTGTTCATTTTCAGTACAGGGTTGTCG ATTGGGCTGATTCCTGAGATCACAAATTGGGTTTTATTCTTGTCGCTGTT AAATTTGATGCCTTTCGGTAGGCCAAACCTGACACATTCATCGATCATGT ATTGTAGTTGGTATAGATTGGGGCTCATCAGGATTATGTCATCGGCAAAT ACTATAATGGAGGTGTTGATGCCTGGGGTAGATAGGTGCAAATCGATAGG TTTTGTATTCTCTGGATGAGTTCTTCTGTATACAGGTTGTATAGATATGG AGATATTATTGAGCCTTGTCGTACTCCTTGGGATAGTGTAAAACTGTTCG ATACTGTTCCTTTGTATTTCGTATTAGCTTCACCGTTCATGTAGAGGTTG ATGAGAAAACGAATGACCAATTTCGGAAGAGTGTTGTTTTGATGGAGTTT GTCAAATAGTTGATACCAATTGCAGCTGTCAAACGCTTTCTCGGCATCAA GGCTGCAAATGTACACTGGGGTCCCTTCGGTGTTATATTTCAAAATAGTA TCATTTATCAGAAATTCTGCGTGTAAAGTGGATGCATCTGATGCAAAGCC AAATTGAGCATTCTTATGATCCTTGAGTTGCGGACATTTATTTACAATTA TCTTTTCAATCAGTTTTGTTATTATGGGTATGAGACTAATGCCCCTATAG TTATTTGGGTCACTTACTGGTTTTCTGTACGATTTGATGACAGGAATAAT GTATGACCTTGAAAGTAGATTTGGTAATGATTCGTTTTGGAAAATATCAT TGATCAGCTGAGCTAGGTAAGATGATAGATTTTGACTGTACATAGCGTTG ATGAGATGTTCAGCTTTGATACCAAAAGGGTCCGGGGCTTTATTCTTGTT GAGGCCTTGGATGGCTGTTCTAACATCCATTTCGGTCACATAAAAGTCTC TATCCGAGTTGCTTAGGTCATCAAGGACTTCCTTAAGCAGCATATTTGAT TCATCATTGTTGATAATGTTCGTTCTTGGAGTATTCAACAGTTTGTTAAA ATGTGAACTAAATTCCTCTGTTATTTCTTTAACGGTTGTCTTGTTATTAA TTGTGTAGAGTTTTTGAGATGAATGTTTTGCTAGTTTAATTTTGGACCAG TAGGATCTTGGGTTAGATTTCTTTATTTTTTCTATGTTGATGTAATGGTC TACCACAGCCTGATTTTTGCATTTCTTGACTAGTGACCGAAAGTCTTTTC TTGCTAGTAGGTATCGGCAGAAGAATACGTTTTCAGGGTCCTTTTGGAAT CCATCTGCCTTCCAGTCATTAAATTTACTCTGAAGAATTTTTCTTTTCTG CGACAGTTCTTGGTTCCACCACGGTTTCGTTTTGATTTGGTGAAAGTCTC TATCAGATTTAATGTCATTGTACGCCTGGAGGGCACAGTTTTTCAGAATA GATTGTATCTGCTTGATATTGTTTTCGTCGTCATTTTCTATGTAGGTAGG TAGTTTTTCGTTTACGAGTGATTGGTATGTGGTTTGAAATAGTTCGTTTT TCCACATAAAGTTTGGAACAGAGTCCTTTTCTAGAATTTTGGATTGATGG TCTTGAGTGACGGCAGGGAAGTTGAATGTTGATGTGAGCGACCACCTGCC AGTAGTGTGACATAGGGTGACAGTCTAGAACNTGAAAGTCTCTATCAGAT TTAATGTCATTGTACGCCTGGAGGGCACAGTTTTTCAGAATAGATTGTAT CTGCTTGATATTGTTTTCGTCGTCATTTTCTATGTAGGTAGGTAGTTATC GTTTACGAGTGATTGGTATGTGGTTTGAAATAGTTCGTTTTTCCACATAA AGTTTGGAACAGAGTCCTTTTCTAGAATTTTGGATTGATGGTCTCGAGTG ACGGCGGTGAAGTTGAATGTTGATTTGACTGGCAGGTGGTCGCTCACATT GATAGGGTGACAGTCTAGAACATGCGTGTTCCTTGCAGAGATATTGAGCC CATGTGAGATGATGATGTGGTCAATGTATGATTTATTATCGAGTGAGGCA TGGTGATAAGTGAAATTGGGACCGCTTCCCTGGGTGATGTCGATGGGAGT TAGGTGGTAGAGCTCGATAAAGTCGTTGAGTATCGGTGTAAGTGGGTTGG GTTTAGAGAGTCTGACTGATGCATGGTTTGATGGGCAGGTCTGAAAGTCC CCAAAAGCAATAATTTCAGAGGTGTCCTCGAAATGGTTGATGATTCCACC AATAGATGCTAGTTGGGATGAAAAAGTATCTCGGTAGTTTTCTTTGTTTG ATACACACTGTAAATAAACTCCAATAAAAAGAATATCAATGGAGCCTACC AATGATTTGACAATGATGGTAAAATCCTCTTCTGGTATCAGTTCGGGGTT AGATACTTTGGTTCTTCTTAGTAGTAGGGCAGATCCTCCATGTGGTCGAC CAGTGATGCCCTGCTGAGCTGGTACAAAGAATAAGTGAAAGTCTTTATTG AAATTGTGTAGGATGTGTTTTTCTGCTGTGGTGATCCATAGCTCTGATAG AAAAATAAAGTCATTGTTTGTTATTAAGTTATTCACATATACAAAGTTGG CTTTGATACCATTACAGTTCAATGTTATAAGGTTACTGTTGCAAGAATCC ATTTAAACGGTATTGAGGGGTATGGTTGAAGCTGTCATAATGGTTTCGAT TGCCTGTATTTCTTTGGTTGTTATCATGCTCTGATTCTCTGTGTTGCTCG GATGGGTTTGATTTGGGGTGTTGTGTGGGTCTGTATGCAGACTTAGGTTT ACGGAACGGTCTGACAACCAAACCTTGAAACCATGTGTTCGGGTTCATGG CAATATCTTTCTGCTTAAAGTCTATGTCAATTTTAAATGACTTGTTGTAT TTGTTAGCTTTATTTAGTTGAATGTCTCTAATCTCTAATCCGCTTTCCTC CTTCAGTGTCCAACAGATCTCGTCCTCCGTTAGGTTAAGGTCAAAGCCGC CCACAAAGAAAGAGAGTGGTCTCGATGGGCCAGCGATTCGCTTGGTTGTG GTTTCCTTTTTCCCAAAGATAGGTTGACGTGGTTGTTGTCTCGCGTTTGG TGGTTTCAGATTGGGGTTTGATTCTTCCGTGGTCCTTAGAGCCGGTTTTG TGGTTTTCGGGGTATCCATTACTATCTGTGAATATGATGGTTTCCCGCCA GTTTGATGATGGTTGTTGATTTGGGGAGTGGATGGTATCATATTCGATGG GCCTGGAAATCTTGGTTGTTGTGGTAGGAAGCTCACTTCTGGAGATATCT GATCAAGGGGTATGTCCTTCAGTATTGTACATTGATGGTGGTTGCTCGAT GGAGTTTTTCTCTCAAGCTCAGAGATCTTTCTACTCAAGTTTTTGTTTTC CTTAAGGATTTCTGTCAGCTTTCCATCCAGTGAGGTAACCTTGTTTGATA GTTCTGTTATCTTATTCAGTAAATCTGCACTGTTCTTATCGACTATGTTG GTGTTGGTGTTAATATTATTGTTTGGTTTGCTGCTTTTTGTGATGTCACT TGCTAGCTTCTTGAGAATCTTATCCTCCCTTATGCTCAATCCGATTTTGT AAATGTCTTCTATTGCACATTTCAAGCTAGTTCTCTTTCTCAAACAAAGT TTTGGGTCTGTGTCAGTAAGTACGAATCCATTTGTTTGAAGTATGTCCTC AGAGAAGTGGTTGTAAAGGTATATGAATAGATTGTCTCTGAGTGAATTAA TTGCAGTGATATCGAGGGTCATGAAGGCATTCTCAAAGTCTTTTCTCGAT GCTCTGGAGAGGGTGTTTAGGTTGTTGACGAAGATGTCTGCAGATTGCTC ATTCGTGTTTGATATTATTTCTTCTGCTGCAGCCTGAAGTTGCGCAGCAG CATCCGCCATCTTGAAGTTGTAGTGTGTTGTAGTTGTAGTTGTAGTAAGT GTTTTTTGGATTATGTTTTTTTTGGCCATAAAAATCAGATAAGTTCTTAT TTGGGGGAAATTCCTTTTGTGGATTTTCAAGAAAAAAAAATGTATCAGTA TAGACCTAACTCTTCATATTATACCAGACCCGATCAATCGAACTTGTCGA ACCAATCGAACACAGTCGAACTAATCGAACTCCATTGAACGATTAAAGTT CGATTAAAAAAATTAATCGAACCTAATCGAACACTCACAATTTTTGAAGC AATAGTAGTTCGATTAGTTCGGTCAGTAAAAAGTTCGATTAGTTCGATGA TATTAAATCCTCATATCTTCCATCCCTCGTTTGCAAAAACTTTGTCCTGG CACGCGATTGCCATTTCGACAGTTCCCGGACTTAACAGCTTGACGTTTAT TGTACCCGGATATTTGTCTATCCGGAATAAAGTCCGTAGCCCCTCTGTTG CGATTTTGTACGCGGCCGAAGTGGCGGAATACTATGCCCCAACAAACCGC CTCTGGCGCTAAAAGGATACAGGAAAAGTGTGTAACCCATTATCGGAAGT AATTTCCCGACTTACATTCCGAATTTGGCTTTGAAAAGAAGCTAATATAC GGTGGCGGAGCAGCACAAACTTATCGAACAAAATTGGTTTATCGAACTGA TTGAACCAAAACCCATTGATCGAACTTAATCGAACACTCACAATCTTTTA AAAAATCTTAGAGTTCGATTAATTTTTTTAATCGAACTTTAATAGTTCGA TGGAGTTCGATTCGTTTGATTGTTCGATTGGTTCGACAAGTTCGATTGAT CGGGTCTGGTATATACAAAAATTACGGGAAACGCATATTTGGACTTTGTA CCCTGCTATTATGCTCATCCTGGCACGCAAGCATAACCATAAGCGCTATA AACAAGCACTTATTAGCTTATATAAAGTCCAGCAAAAGCTGGACAAAAAT TAGTTTTTTGAAGTTTGCAAAAAAACGCCACATACCGTCAACTGCTCGGC TAGTTCGAAACACACGGGTCATACAGGGTGACAGGGCAGCTCTGATAATC AAAGTAATTCAAACAGAAAATGTTTTAAAAACGCTAAAAATTATCGAAAA AATCAATTTGAAGGTGTTTTATTTATTTTTATAAATAGTCATATATGTGA CTATTTAAAACGTTAAAATCTAACAACATGCTAGGCTACGTCATATCTTC CTTCGTTTCGAGCGTAAAACTCCTACTCTTCGGACCATGAGCACTGCTCT TGTTTTGAATATTGAAATTCTCCAGATAAATTGCATGCGCACTGAGGTTT TAATGAAACAATAGAGAGTTTTGAAACCTAAGCCAATCAGCTGTGTTTTA AACATTCTTTTATTTAAAATCTCTATTGATAAACATCTTTTGTGAATGTT GTCTATTATGTTTGAACCTATTAATCCCCCGGTGGGGGTCACTAGTGGCC ACCTATAGCAGTGCCTATAGACCAAGAGTAAGGCCTAAAAGCCTGGATCT GTCTATTGTGTAGACTAACCACATGCTTTCCACGTGCTTTTGAAGTTTGC GATGTGTACAACGCAGACCAGAAAACACTGCAACATATTACATACATATA ACAAGCTTATATTATCAATAATATATACACTTTTAGTGCTAAATGCATGT TATATGTTATACATAAGTAATATACATATTACAATTCCCATCGCCTGAAA ACCGGGCTTTCTCAAAAATGATAGTACAGTTAAATCATATCTCATTATAT CTATGGCGCGCAAAGCGCCGATAAATACTATCTTGTTTAAAACAAAACTA TGTCATTTAAACCGATACTATCTCCTTGCCAAGATGCACGAAGGGCCCAC CCTATTTTGAAAAAAGGTTGTTTGTTGAAAAGGAGGAACAGACACTTTGA GAACATGGCCTCTTTGGCTAGTTCTTAAAAAAGCACGCTTTTTTTTTCTA AGCTCAAGTTACAACTCTTCATTACGCGGCTTTTTGATAAAACAGTATTT ATAACTCGTTTACTGTAACTTTTTTGAGTCTTTTCTGGGCGTAAGTTTCC AATGAACTTGTTTAGAAATGATAATTTCTTTTTAAACGAGATAGTTTCTT TTTAAATGAGATATCCCCTCCACCATCACCTTGAGAATGAACATAATTTT AATGGATAATAGCGTAAAAATGATGGTATTTTATAAATGTGTCAATATTT TCTACCTACCATTATTAATTTTTAATAAAAATGACATAATTATACACATA TCTCTAAAACCACTATCTTGCAGCATTATTTAATTGTTTTAAAACATCTC AATCTATATCCAGTCACATAATTTGCATATTTTTGAGTATGAAAATCCGT AGTGGAACTTTTTCTGACGCTGAGCCCAATGAAGTAGACTAGGAGCATTT GACGAGGTTGCCATTTTGAATAAAAATAACAAAAAAAATTCCATGTAACA AAAAAGCTACTCGGAGTTGCCAGACGGTGTCAATCAAGAAACTTCGAACA AAAAACGTGCGTTATCGAACGCGATCGAATAATTGGGATTCGATTGTCAA ACATATTTAATCAATCGATTGCATTTGAGTAAGGTTAGATTGGTTTGATT GATTGTCAATTACATTTGATTAATCTTCGATTTCGTTCAATTACGATAAT GTCTGACGAGTTTAATCGTGATTAAATTAAATTGGATCACTCTGTTAGAG CTTTTTAGCATGGGCGGCCGAGTGCTTAATAAGTACCCTACGAAAGCGAA TAAATTCTAATACAATTGAATCAATCGAACGCAATCAAACATAATTGAAT ACAATCAAATGTAATCGAAGCAATCGAACGGCAAATCCTAGGTAATATTC AATTGCGATTCGATTGCGTTTGACAATCGAATTGCAATTATTCAATTGTG TTCAATTGCGTTAAATTGATTCAGCGTTGGATCAAGGATTTATTATACAC TGGATATACAAGTAACAGATTTTTGCTGATTTCTCGTGTACTAGCTATGT CCGCAGTAATGATAGTATTGTACACTCTCCTTCCCTCATTAAATGATTTT TCGAAACATTTTAATTGCATTTCTCATCGAAAATCACTCATCCAATTTCC AAAAGATACTTAAATTTTCTTGTGAGAGTCGGATTCTTCCACTTAATTGA TAATTATAAGTCGTTATGACGTTTCAAGCTGTGAGAAAGATGTAAAAGAT ATGTTGTGTATAAGAAATTTAATGTTGACACCGGAAATTTTCAAACTTCA ACCTCAAAAAAACCACCTTGCCACCACATGCCTCCAAAGGATTTTTATAC CACAGTGGAGCCAAGACACTCAAGTCTTATGTATGTTAATTTCAGCTCTT CTGGGAACATTCTTGGAAAGATATTTCCAATTCAAAATTTTGTGTCACTA TAATGTCTAATGATGTTTTTTCTCACATTAGATTTCACAAATGTATCTGG CTTGGAATACTAGCCTTACTTTCAAACTTTTTTTTGAAAATGTACAAAAA GAAAGAGCTAGAGAACTTTTTGAAAATAAGACAGATAAACATTTTTAAAA TTAGACATCCTCGAGCCGCCATAACAGTTGTCCTTTGCGGACAAAGCCAG AACATCAATTGTTTTCTGAAACAAAGGAAATACAATGATCGCTCTCCATC GTTTTATGAGTCGCTTATCCAGTGTATAATAAATCTTTGGTTGGATTAGT TTGATTGACACCGTCTGGGAGTTGAAAAATATAATTACGAATGGGAAGTA CACATGAATAACAAATACCAGTGGATACCCCTTAAAACCACAAACTTAAT TTATAATTGTATAATTTCATAATCTAAGGCGAAACAAAAAAAATTTCTTG TTTCCGGAAACAGGCCGGGTGAAAATTTATTTTTTTCTGACCCGGCCGCA AACTTTCGTTTGTTAGTAGTCCGTACTTGTTGTAATTTAGGGCATAATTT ATGCTGTGTTTAAACATAAAAGTTATTCTTAAACTCTATTTCAATGAGCC ATAAATTATCAAAAATAGCAAAAAAAATTATTTTCCGGCCGGCCGCATGA TAACTTTTTTCCTTCACCCGCATTCCGGAAACAAAACATTTTTTATCACT CGCCTAATTTCAATAATTTTAATTATCGCAAAATGTCGTAAAATTCAAAG TTATTGAAAACTTTATCAAAAATCCCTTCGAAAAATCAAGTTTTTCAGAC CTAAAGATGACACATATCAATTTAAGGTCATAAGGTCACATTTTAGGTAC CTATAATTATGGTAGATACGAAAAAATCATTTTCTTTTCCATGGTTGCAC CCCAAAGAAATAAGGCCCTCAAAATTCTATTTTAAAGCTCATTTATGGTA GTGGCCAATAAAATCTGAAAATCGACTTTCTCAAAACTTGATCATATTCA GTCATATTGCATACTTAAATGTCACATGGAGATTTAGAAAAACAATAATA ACATACATCAAAAATGAAGTGAATAAAAGTTTTAACCCTTCAAAGCCGTT TTTTGACAAAAAAAAACAGGTGCAATTGCATTATGGGCATGAAATTCTGA AAAATACAAATATTGTTTTGGAAATGGATTTCTAGCAAGTATTTGATCAC TTGAATCATGGTTCAGCACCTGAATTGCAATTTCACAGTTTCAGTAAGTT GTGAACAAGGGGTTAATATTTGTAGGTTTTAAGGTGTTATTTGATTTTAA CGTACAGTTTCAAAAAGTTTTAGGTACTAATGATCTAAATGTAACATTAC TAACTTTGCAGTGAATCACTGTTCAAAATTTGAGACCAAAAGGACTATTC TATAAAAAGTTATTCAAGAAAACCAATTTGTAGGTTTTAAGGGGTAAATA GCTAAAAAATTGCATTTTTTCACAAAGCAATAAAAATTTTCTTAGCAGCT TTTACAAAAAACCATACCCAGGGAAGAAATTCATAAATAGCCTAGACTCA CCAGAAAAAGTTTCAGCCCTTATTGTTTTCTTTATCAGGATATGGGGGTA CCTTTTTTTGTTGTGGTTTTTAAGGGGTATCCACTGGTAAAAATACAACT GCTTCATTCTATTTTTACCTTCCTAAAACAACTACAATCTGGCAGACTCA TTACACACTCATTATTTGCTAATCCTATCACATCCCATCGGGTAATAAGC AGTTTTATAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNAATACACTTGTTAATTACTTTTATT ACTTTATTATTACTTTATTTTGCATGGCTATAAATGGATTATTAACCTCA GTAAGCCTGTCTCTCTGGAAAATATTGACCTTGGGCACACGTACCCTCGG TCAATATTTCCTCAGAGAGACCGGCTTTTCGGTTAATAATCCATAAAGGC GGCGGGGGCTCTCTAATTCTCCAATCAGCATGTGGTCATTTTGAATGAAA ACAAAAAAGTTTAAAAGGGCGCGCTATCAGTGAAAGTTATCGTGACATGT TATGACAGAAAGTATGATTGATAAACTTGTTGGAGTTACCAAAACAAATT TGTTGTCAAAGAGATTTAGTAACACTAAGTGAAAATACAGGCCAGATATC AACAAATTTTTTTAACAGCTATAATTCGTTATATAATTTCTTTGTGCAAC ACCAAAAGGTCAAAGGTCCCGTCCGTCACACATTTTCAGTTATAACTCAA GTTTGGTTAAAAAAAACGGCTTGTAATTTGCAAAGCATATACTTCCATTA TAGAGTAACATTTTTACATAAAATTGACAAGAATTTAGAAAGTCTAATTA AAAATTGAGTGGTAGGAAGACAGGCATATGCGTGACAAACGGGACGTCCC GTCATTTTTGCTAGTATTTCAAAGACGAAACAAACTATTAAAAAATGACT TAGTCCCGACTGATACTTTCTGCCACAGTATCAAATCCACAAAGACTTAA GCTCTAATACCTAACGTATCATTCTATGGTAATTTGAATACATTTTGCCT TGTTTACAAAACCACGGTACAGATTTGGCGCAATTCACCCTTTTGTTCTT TCACATTAACAAAAAAATAAGCGAGGGTGATTCCTTTTATATTTATTTTT GTTTGATTGTTTTGTACATCCTTTAGAGCACATTTTGTTAATGATGTATA CAAATATTTTTAATTGCATTCCCTCTCTCAGATTAAAAAGGTTTTTTTTT TCATTTCAGACTGAGAAATGGTACGTACTGTACTTTGCCATCCATTTGTG GAGCAAAAGAATTTCACTGACCAATACGATGCATCGTGTATTTGCTGCAC CAATGATGATAAAGTTCTCATTGGTTCATTGTATGGTAGCATCAGCATAA TTGATCTCAAAGGTGGTACACATAATGTTTTACACAAATTTCCTTCAAAT GGAATCCCAATCAAAATGTTGTTTTCTGATGATAAGCAATTCTTGGTGTC ACTTGAATCTAAGCTTCAAGATTATCGTGTTGGATTATCAGCTAGGGAAA TGAACTGTCAAGCTAGAGTATATTCAAATATTATGCTTGGTAACCCACAG AAGAATGTTGCCCCTTTAAGTAGCGGGTATTCAATTAACCGACACAATAA TAATCATACACGAAACAAGTTTTCTGTTATTGATTTTGCTGGTTTACGTC AACCTGCAACTGATATTGCCCTATGTAACTCTCGTCATAATGTTGCCATA TCAAGTTCAAAGAAAATCTATCTTTACGCTTTCAAAGAAGTTATGTCTGC TGATTTACCAGAGGATGATAGTGTCCTCACAATTGATTTCATACGCATGG TAGAAGTTGAAACCACTATCAATATAAGAAGTGTAGCTTTTTCATTAAAT TGGATTGCCTTTGCCTCCAAAACTGAAATTCGTGTTATTCAAGTTTATCT TCACCAACCATCAGATGAAAAGGTTTATCAAGGAGAAGACGTTTCTGAAC TTCTTGAGTAAGTCTTTTGCCACGCATAAAGTAATGATAATGCCACATTT CCTTACTTTATTTTTAAAGGGGCCTACGTCCCGAGAACCTCAATTTCAAA AACTCTTCAATAAGAAGACATAGGCCCTTTAAAAATAAGTTAGGGATCAT TTATTGTGACAATGACTCAATTTTTCTTAGTTTTTTTTGTATATAACTGT CCCAACATCTTCTTTGGGAACTTTTTCACATAGAAAAGGTATGGGTTCAA AAGTCTTTTTAATTATCTTTTGTACCTGTGAAGACAGTGTGATTTGTATA TTAAATGAAGATTCCATAACCTTTAGTGACTCAACAACCCAAACAGACGG TCTTGAGAAAACCACAGTCTCAGTTCTCACATCAAAACCATCAAAGTCAA ATAACATGCCAGTACAAACGACGTTATGGGATTTTGACCAAGCTACTTCC ACTTCATCAATCAATGAATTCGAATCTAAAGGTGGTCATGGTATGATGCA AATGCAATCTATCCAGGAAGAGAAACCTTACATTGATACTAAATCATCTT CCAAAGAAGTGACAGGTTTGTTTCACTATTGCTATTATCCTACATCCGAT TGATCATTAAAATGAACGTGCATGATGAAATCTATTTTTTAAACTTATTG AAATAGCTTTTGGAACAGCGATGCGGTTGAGTCTTCAAAACTCGAACTCG TACGTGGGACACAAATTTGTTTGGGGTATAGAAATTTTAAGATATGGAGT TGAGTTTATATATAAGGCATTGTTGGGAAGGCATTGCACTGAAGGGACCA GAAAACTTGCTAGAGTTACGGATATATTCGAGTAATGGAGGTTCGAGTTA AAAAGACTCCACTGTAATGAGTTGTATCTAATTGTTTCGTATCATACAAT CATGAAATCATTATTTGCAAAAGCTTCTGATGCCAGAAATTGTACACCTA AAGTATGGTATAGCAAAAAAAAAAAAAACAGAAAAAAAATTATTTCATCT TATTGTCAACAAAATTGACAGTGAAAATCTTATTTTACGTGTTTTTTACA CTTTTCGAAAAGTGAATTTTGACTTTAAAAGCTCATAAGTAGAGAACAAG TCGGTCAAATTTAAAAAGTGATGGCTCAAATTTAAAGTTAGGATATCTAC TTTCTAAATATCAAAACTCCAAGCACTTTGGGACATTTATTCGGCCTCAA GATGTCGGGAAACGTCTGAACTTTTTCGTGGGTCACCCGGTATAACTCGA ATGTCTCCTTAACTCGAACAGGTTTAATCGTCCCTTCAGTTAACAATGCC TTATAAATCAATTTTTATAACTAAAAATTTCCTTAACTTAAACAAATTTG TGGTCCCCGTGTGGGTTCGAGTTATGGCGACTCCACTATAGATTCATTTC TAGCCTTCCACTATACTTTTTTGGTTGAATCATTACATTTCAGGTGAACA TACAATCCTTGTTGGTCACCCACTATGTTGCTCGTTCCTTGGACAGATGC CCACCAAAGAAGGTCACGTCAATTATGCCACAGTCACCAGTACTACACAT CTGTATCGAAGATTTGAGGAGGATGATATCTCTTTCTCGGGAAACACTGA AAGAATACATAGTCTACAATGGCTGCCTATCTTTTTGGAAGGTTAGTGAC CTATTATATGGATACTTTCTTTATTGTAAAAGCTGTTACTGTTACATGAA GGCTACTAATTAATTTATGTTTTGGACCAAACGAATTTTGGATCTTTTGA CAAACCACTCAGATTGAATACTCCTGGTCTTGGTTGAGCTTAAGGCTTCT TTTGCTAGAAAGTTGTATACCTTGAATTTAGTTAAACTATCATATTTTGA ATGAAAGTAACGAAGTCGTAGTATTTTGTGAGCCATACGGTACATTATTG AAATAACTTCAAACATTTTTATTTGATATTGAATATAGATGCTTCTTGGT GTAATTAAGATTTTCCATCTTTTCATAAAAATACATTTTCTCTCTCTGAT CGTGGATACTTCCTCTTCTGTCTGAATGCCTAGTTTTCAGAAATTTTTTT TGTTTTACTTTTTCAGATATCGCTGAACACAAACAATTGGAAGTTGAGGA GAAAATGCCATGGCCTTGGAATGCTTTCTTAAAACCACACTCCTTCCCAG TTCTCCTCTCCATGCCTCTTTTTTTCTCAACTGGAACACATGGTTACCTC TACGACACGTGGAACTCAAAAGGACTCATCTTAGACTACAGTTACACGTC AGATTGTTTGAGTGCCAAACATACAAATTCACTTCTATACACTGTCACCA GTAATGGATTGGAGATTTTCACTTCTCGCCTTTATCCCTTTGTTTCTGGA TGTACAAAAGAAATGTTTAAAGAATGCAAGTTTTCCAAAAATGCCGAAAT AGCTAATAAAGGTAAGTATTGTTGCTCAGACCAGAACTAAAACAATCCCA TTTAATTTCTACGAATTATTTGTTTTTTACTAAAGGTCGGACGAAAAAAT TCGATCGAAGTCGATTTTTAAGAACTACAGTATTTATCATCCAATTTCCA CATCACTTTGAATTCATTGTTTTCCATTGCGGAAAAAAAGCTTATGACTT CTTTTAAAGGGAAATTCAACTATTTTATCTGTCAGATATCAGTGGGTTAT TCTAAGAAGAAATCCTGCTTGACATTGGCCATTTCACAGTCGAAATTAAA CATTGGTTGTGCTCCAGTAGCGACTTCTGGTTGGCCAGACGCAAAACTCT TCAAAAAATTTCAAAACTTTGGACCAATAGTAAATCGTCATTAGCGCGCA GTGGTCCTGATTACCCATTACGCTTTGCGACTGTGAAATGGCCTAATTAT ATTTTGAGGTTCTGCATCGATGATTACTTTTCTCTTATAGCAGCTGGTAA AGCAAAACAACCTTATCGTGCTCGAGATCGTGGACCAACAGAGATCTTCC TGGAAACCAATTACTTCATGGATTACGTGTCTGTCAATAAAGATCTCTCC ATGATCGAAGATGGTGGACTGGGCCCTAGTAATGATATTGAGCCAAGAAA AAGAACCCATTCTTCGGCCTATGATAGATACCCATATCAATGGCTTTTAA AGGTATGTAACCTTAACAATAACAAACTTCAACAAACCCTTGGATCCAGC CTATTACAATGAAAGTGTTAAAAGATCTAGCTCGTAGTTTTCAAGGATCT TTTAAAGGCTAACGAGTCGTTAAAGACCCTTATAGCTGAACCTTAAAGGT CGCGTTTTATCTTAGAAGAACTAACTGTATTCATTCCTTTTCAACTTGTT ATCTTACAATCAATTAATGAAAAAGCCTATTGTCAACTTAAGTTGAGCTA AAATCTGATAATTTCTGTCTTGATTGTGTATGTCTAAAAATGGTTGGGTT TGACTGAAATTTGGCAAGTTTGGAGGAATTTTTTTCTTTTTTTTGAAAAT TTTATATTTTTCGCGCGTAGGGGTGCGCTATTTACACTATTTACAACTAT TGAACCTTGGAATAGTTGAAAAATTGAGCTCTAATTGGTGTGCGTGTATA TTTATTGATGAAAATCTTTCCATCATTACAGACTTGTCCACCGAAGGATC TGGAAACTTGTTTGGTTGGTATGTATCCATACCAAGATGTTGTTTGTGTG GCAACTAGTATGTCCTTCGTCCTCATGTTCATCAAAGTCCCTAAAAGAAC AAAGTAAGTTTATTAAATTCGCCCTAGCAATAACTCTTGATAGACGGGGA CATACCTTTCGGTAATTGGTTCTAACAAAGTAAATAAGGAGCGGAGCTCA ATATGAGCATATCTATTTTTCTTATAGGCAACTACTTAATAAGAATTGAA TTAATAACTCATGATAAACGGGGATATATCTTTCGGTAATTAATCTTACA AAGTAAACGAGGGTCGACCTGGCTGCCTGTAATTTTTGGTCGTAGAAAGA TAAGAAAGCATTTTTGAAATCAGAAAAGTTCACAGTTCACAAATATTTTC TATTTCCAAAATTTTGAAAATTTTTCAGGCTCCAAATCTATTACTTAAAG GTATTACTTTTAACTATATCTTCTCTCCTTCAAGAGCAATCTATCAAAAC GTCCGGACTGCCAATTTTTTTGGAAAAGACTTTAAATTTAGGTTGGGTTA AATCCCAACCTAGGAATACCTTAAGAATATTTCATGATGAATTAAGAAGA TAAGATNTTCTTTTGCTAGAAAGTTGTATACCTTGAATTTAGTTAAACTA TCATATTTTGAATGAAAGTAACGAAGTCGTAGTATTTTGTGAGCCATACG GTACATTATTGAAATAACTTCAAACATTTTTATTTGATATTGAATATAGA TGCTTCTTGGTGTAATTAAGATTTTCCATCTTTTCATAAAAATACATTTT CTCTCTCTGATCGTGGATACTTCCTCTTCTGTCTGAATGCCTAGTTTTCA GAAATTTTTTTTGTTTTACTTTTTCAGATATCGCTGAACACAAACAATTG GAAGTTGAGGAGAAAATGCCATGGCCTTGGAATGCTTTCTTAAAACCACA CTCCTTCCCAGTTCTCCTCTCCATGCCTCTTTTTTTCTCAACTGGAACAC ATGGTTACCTCTACGACACGTGGAACTCAAAAGGACTCATCTTAGACTAC AGTTACACGTCAGATTGTTTGAGTGCCAAACATACAAATTCACTTCTATA CACTGTCACCAGTAATGGATTGGAGATTTTCACTTCTCGCCTTTATCCCT TTGTTTCTGGATGTACAAAAGAAATGTTTAAAGAATGCAAGTTTTCCAAA AATGCCGAAATAGCTAATAAAGGTAAGTATTGTTGCTCAGACCAGAACTA AAATAATCCCATTTAATTTCTACGAATTATTTGTTTTTTACTAAAGGTCG GACGAAAAAATTCGATCGAAGTCGATTTTTAAAATGAAACATAGGTAATC AGGACTGGTTGTGCTCCAGTAGCGACTTCTGGTTGGCCAGACGCAAAGCT CTTCAAAAAATTTCAAAACTTTACACATTACCCATTACGCTTTGCGACTG TGAAATGGCCTAATTATATTTTGAGGTTTGCATCGATGATTACTTTTCTC TTATAGCAGCTGGTAAATCAAAACAACCTTATCGTGCTCGAGATCGTGGA CCAACAGAGATCTTCCTGGAAACCAATTACTTCATGGATTACGTGTCTGT CAATAAAGATCTCTCCATGATCGAAGATGGTGGACTGGGCCCTAGTAATG ATATTGAGCCAAGAAAAAGAACCCATTCTTCGGCCTATGATAGATACCCA TATCAATGGCTTTTAAAGGTATGTAACCTTAACAATAACAAACTTCAACA AACCCTTGGATCCAGCCTATTACAATGAAAGTGTTAAAAGATCTAGCTCG TAGTTTTCAAGGATCTTTTAAAGGCTAACGAGTCGTTAAAGACCCTTATA GCTGAACCTTAAAGGTCGCGTTTTATCTTAGAAGAACTAACTGTATTCAT TCCTTTTCAACTTGTTATCTTACAATCAATTAATGAAAAAGCCTATTGTC AACTTAAGTTGAGCTAAAATCTGATAATTTCTGTCTTGATTGTGTATGTC TAAAAATGGTTGGGTTTGACTGAAATTTGGCAAGTTTGGAGGAATTTTTT TCTNATAATTTCTGTCTTGTGTATGTCCAAAAATGGTTGGGTTTGACTGA AATTTGGCACGTTTGGAGGAATTTTTTTCTTTTTTTGAAAATTTTATATT TTTCGCGCGTAGGGGTGCGCTATTTACACTATTTACAACTATTGAACCTT GGAATAGTTGAAAAATTGAGCTCTAATTGGTGTGCGTGTATATTTATTGA TGAAAATCTTTCCATCATTACAGACTTGTCCACCGAAGGATCTGGAAACT TGTTTGGTTGGTATGTATCCATACCAAGATGTTGTTTGTGTGGCAACTAG TATGTCCTTCGTCCTCATGTTCATCAAAGTCCCTAAAAGAACAAAGTAAG TTTATTAAATTCGCCCTAGCGAAAGTTAGATCATCAATAACTCTTGATAG ACGGGGACATATTTCGGTAATTGGTTCTAACAAAGTAAATAAGGAACGGA GCTCAATATGAGCATATCTATTTTTCTTATAGGCAACTACTTAATAAGAA TTGAATTAATAACTCATGATAAACGGGGATATATCTTTCGGTAATTAATC TTACAAAGTAAACGAGGGTCGACCTGGCTGCCTGTAATTTTTGGTCGTAG AAAGATAAGAAAGCATTTTTGAAATCAGAAAAGTTCACAGTTCACAAATA TTTTCTATTTCCAAAATTTTGAAAATTTTTCAGGCTCCAAATCTATTACT TAAAGGTATTACTTTTAACTATATCTTCTCTCCTTCAAGAGCAATCTATC AAAACGTCCGGACTGCCAATTTTTTTGGAAAAGACTTTAAATTTAGGTTG GGTTAAATCCCAACCTAGGAATACCTTAAGAATATTTCATGATGAATTAA GAAGATAAGATTATCCGTGATGTAATGGGAAAACACCATTCTTATAAAAA AGCGTGTATTGTGCACAAAGATTATATATAAAAACTTGTAGACGAAATAA TGCTCCGATATAAAGTTCTTTCTGGTTCTTTTCGTATTTTTTTCCAATTT CCGTTTTATTCCGATCAACATAACTTAAGACGATATTACGTACGCTCTCA ACTTAAAATTTTATAAAAATTCTCACATTTTCAAAAATCCCCTCTCAGAA AAGGTCCCAACATCGATTGTCTTAACACCCTGATCGAAAAATTGATAGAA AAATTCTCTCACTCCTTCCAAATGAACAATACTAAGACCTAGTATTATCA TTTTTTGTCTTTTTTCAGAGAGAAGGGCGGCGCAACATCATCACCATGGA GTGTATGCAGCTTCGAAAAACACATCTCAACGGATGTGGGTCAAAAGATT ACCAAACTAATTGAAGAAAGTGAATTTTCGAATCCCATGGTGTATTATCA TTTACTGTGTGAATCACATCTTTTACTTTGTTGTGATTTGATGAGCAGAC CAAACGATGAAATTTTGATCAAAGCATTGAAATCATCAGCCGTCTCACTT GCAACCTTCTTAATGAGGTAGTTTGTTCTACTTTATCGGGAAAATAAACC CGTAAAAAGGCAAATGGATAAATCTCTTGTCTGATCTTAAATATCGCCAG GATGATCGATACATATTATTCTCAAAAGAAAGTCATCTTTAAAGTCTGTG TCACAGACCCGGCGAGGCCCCAACCCCACTTGAAAATTTGCCCAATATTT GTTCTCGGTAGAAAAAAATACTCTATAATCTCACCTTCAGTGGAAAATTG ACTTAACATTGTCCTCCAAACCTTTTCCCGCTGGAATTTTTGAACTGCGG GAACAATTAGAATTTTTTTCCCTATTTGATTTTTAGAAGTTTTTTTACAC TGATAGCTCAACCGGGGCTGCAAGACGCCCTCTTGTTATAATCTTTTTCG ACTAGACTTTTTACAACTCTTTTTTTTCAGATGTGAACCAAGTTTTGATT TCACCAGCGTCAAAGGGTACTTCGAAATGGCTGGAATGCAACCTACAGCC GTCCTTGAACACATGAACAATGAAAACATAAGACTCGAGCGAAAGGTTAG TTGAATTTCATCTGGTTTAGTTTGTGACCGCAGTCAGAGGCGGCTCGAGG GCTCCTCTTTCGATAGCTGTCGATCCAAAAGAAGGAGAGGGGTGCCACTC CTTCTTCCTTGACTGCTCCACTTACCTTCGATCCTTCTCAAGCATCTAGC AGAGTTGCAGTACTGAGGTACAAAGTCTTTGGTATGACCCAGTCGGGGAT TGAACCAACGATCTTGTACACCTTAACCGGATGCTCTACCATTGTACTAC TTAATCTTGTACCATAGATTATATTTTTATGGAAATTTAATTTGAATTAC GCTGAGAAGCCCAGGAGACTTTGGAATTCCAAAACTTACCTTGGGTTGGG CACTACCCAATTGATATTTAAAGAAAAAACGCTCAAATTTAAGGGATTTA AGGTGCGATAAATTTTTCTCGCTTGGAATGACTTGCAATAGCGTATACGA TGCCTTCTAAAAGAGGCGGGAAATTTCAATACAGTTTTCCCACAGTAACG ATTTCCTTCCTGAAGTATCGCGTAAGAGTAATTTGACTTTCTATCTTTTC TTTGTCAAGAAACACAGTTTTGGAACTGGAATGATTGAATATCTGAACAA TACTCTATTCGGCAAAGAACAAGTACAATTCGATAAGGTATTACTTTATA CTATATACTGTACATATTTATGTGAACCAGTACATGTGGTGTACAGAACA ATTTAATAAAAATTCAATAAGCCTCAAATTTCAAATTTGACTGCCAGTGA AATGAACCAATTGGAGAACATTTTTAAGCGATGAGGCCCGAGACTTACTC AAAATCCCATTTACAGCTTTTACATCTTGTCACCTGGTGTAGCAAACAAA AAGCATACTTTTGATATCAAACAACTAAACGCTATTACCACAGCTATATA TTATTTCCATTCAGAATATTTGTGATTTCATCATCAATGTGTATGGCAAG AATCATCCATCAATGCTAGCAAAAGTGATCTTAAAATCCAATCTACCTCG TCTCTATTCAATTGGTACAGGCAAATAATATTTAAACATAAATGCTGATC TAAACGAGATTGCCTAGAACATTGAGTTTTGTAAGCGTTATCAAGCAATA TCGCGTACACATTTTTCACAAATTACGTTATGAGCAACACTTGCCTCGTT TTCAAACTATTGCTATGGTAATTGATTCCCAATGGAGTTCATAAAAAGTT GACTCTATTCATAGATGTATCACTTGAAGACTGAAGGGATTTAATCACCC TGGCAATAGTTTCAAAACGAGGCAGTCGTTCCAATCAATATAATTTATGA AAAGGCCTAAACTGTGAATAAATTCGGTAATCGATAACCGACTTGGGGTC GTTAACATAACAATCGATAATTTTTCTTTTTGTTTATAGATTTATGTGTC AAACTGATGAGCAAATACAAGCGGAAAAAAGAATCAAAAGAACAGAGGTG AGTACACTTTTTCCAAAATCTCTTAATAGCTTTTCAATAAGGGATGCATC CACTACACAATATATCGTCAGGCAATATATTGCGAAGTGCTCACGATATA TTGAAGAGGTGTCTGCGATTGTCCGCCTGAATTCGCAACATTCCAACAAT ATAACAATAAGGGGTTGTCTACACACAGAAAATTCCTCTTCATAATAGAG TACCTGTTGTTTACTTCATATACATTTTACGGTCCACAAACCATATTCTT GCATATTGTTCGCCGATATTTTATGTATATTAGGTAGCCCCAACGTTTTC TTCAAACACCAGTCATCAAGCATTTAAAAAATGTCTTTTATCTGTTCTCT TTATCATATATAAAACAGCAATGGAAAAAAGTCAATTAGGAATTACGTAG TTGTACTTGCATCTATATATTGTGGATTAACACGCTCAGCGACGTGGTCT GCTTTTGAGGAGACTGGTAACGCAAAAACGTGGAAAATTCTTTTCTGGCA CACGCCATTCTTAAGCGGTATGTGGAAGCAAAATTTCCCCCAAAAAACCC ATTCAATGCGGAGACATTTTCCTAGAGTCTCTAAGGTAAACTGCAAGCTA TTTTTATGTACCCAACCAATTGACAAATATTTCATTANCTAGAGTCTCTA AGGTAAACTGCAAGCTATTTTTATGTACCCAACCAATTGACGAATATTTC ATTTCTTCAATACAAAAATACGTTTTTTAATTTAGACTACAACCACTGGA CAGCTTATGTTTTGCTTACTTGCACATGGACTTGGGGAACCCAGGGCACG CGGAAGAGCTTTTGAAAGAACTGGAAAAGGTGAAAAACCTTCGACATTAT CACATTAAGAGATTTGTGAAAACATCATGTATCTTATCACTTCAGCTTGT TGGCAATTTGCTTCGATTAGTCTAAGCTCATTCAAACTAAATCTCCCTGC TTTGGCTTTCGCTATCTTTTTTAGTAGTCAGGGTGCGAATGCCTCATTAA ATTTGGTTTATGCTGAAATCATACAGGCACAGTTCATTTTCATGAGACCA AATCTGAAAACAACGCACCTCTATCTAATATCAATTAATTAATCTTTTTT TTAACAGGACGATTTGCTAAAGATTTGTATTTCAAATACTGAAGTGTTAT TCAACTCACAATATCAATTGACGCCCATGGGACAGGTAGGTAGAATCAAA GTCGTATTATTTGATAAAAAAGGTGGATTCCCTACAAAGATTTAAAAGAC CACAATTGATTTTTAAATGTTCCAATAAGGCTGGGAATATAGCATGGATA CCACTAAACCTTTACCAAATCGAAATATCCAATGAAACAAGATTATTATG ATTACTTTTGACTTAAAGGTCTTTTGTCTCCCATAAAAAACGTCACCAGA ATGTTCTTACCGACTTGAAAATCCATCTATCGATAAACTTTTGTTTGTAG TTAATGAAGAAGCATTTCAAAGAGAGTTTCCAGAGCATTGTAATTTCTCT GTTCGATACACGCACAATCGACTTGAATAATATCCTTCAAATATTCCAGG TACGTTTGATTTATTCTAGTTTGTAGTTAACTTTTTTTTTCCTTTTGTGT TCAAAGTTTTGTAACTGAAAAATGAAAATTCATTTGAACACTGCTTCTGC CAACAAAGATTTACAGTGTCAACAGTAAACGGATTGGTAGTCAAAATCTT CTCTTTTTTTCCAGGCAAAAGGAAAGGCTGAAGACAATGAGAAAAGAATT CCACTTGATCGACAAGCTTGTCAAATACTTGAAAATCTTCTAAATGGTAC ACTTTCTTCGGAAATCTTTTAGGATTTAGGGTTTGATTGTCCTGATTCTA CCCTTTCGTAGTTCTTAATAGTAGCTCATTAATAATTGTCACAGCTAACA CAACAACAAACGTATTTAACATTCATGAGGGTCTGAGTTCAGCAACTAAG TTTCAAGCTCTGCTTCCTGAAATGCGTTCTTTATACCTAAATTAGTTGGT CGTAATATTGTAAATCATTTGTCCTTCCCCCGGAAAACTTTAAAGTTTTC AAAAACTTTTTATTTTATTTAAAGCGAGGCCATTTTCACAAACTTTCAGA TTCATCTCGTCGAAAGAGCTTCCAAGAAATTGCGGTAAAGATTGTCTAGA AATTTTTTTGTATTTTTGTCATGCTTTTAGTGGAGGGCCAAATCTAAGGA TCCGTGGCATTCTAATTTAGGACACAAACATTAGGCTAAAGTCTGACGTT ACAGTCAAAACTGTAAAGCTAAAAAAGTGAGTAAAAAATTTTCTTTTACA GTCAAAACTGTAAAGCTAAAAAAGTGAGTAAAAAATTTTCTTTTACCATG GGCAGTTTTTCAAAACCTTAGTAGTCATTTTGAATAACTCATGTGATTGC ACCCTAGAAAATATATCAAGGATCCTAAGGTTTGGCACACTACTATTTGT CTTGTTTTATGATTAAAATCAAGTCAAATTCAGTGTCGAAAGCGATGTTT TTTCATATTTTAGCTATGGTGGGCCAAGCCTTTCTAATTAACATCTACTT CGATTTTTTACTGAGCAAAATAGGACAGACCCTGACATTTACTTTATGTA ACTCACTATTTGCTAAACAGTAAAGTCAATTGGCTCATTGGTAAAAAGTA CTCCAGACAATTTTCATCTCGAAAGTTCATCATCTGTTTTACTACCTCTA CCTTTTAGGTGATCTTAGTGGACCAGTACTTACTGCGCATGACAAAGAAA ATGAATACTAATGATGGTTGGAAAATCAAACATAACCACGAGGTAATTGA TCACTGTCTTCTAATACTTAGTTATCGCAAATTAAACACTGTTATACCTC AAAAGGCTTGTGTTTTAAGCTTTCAACCTTGTAAACACCAACGTTCACTT GGCGTTAATACGCCATATAGGTTACGAATATTGACAAAACGTTGAAAATA GTCAGCTGAATAAATAGCAAAGAGATTTACACCAATTAGGATGTAGGTAG CCTATACCAATGCTGAACTGTCGGATTTTAACTTTGTGTAAAATCTTTCT CTGAACTGGTTTGAATGCTGAAATAGAATATGTGTGACACGATAAAGGTG AGAAATGTCTTAGACATGGAATGGTGCCTGATCGTAAAAAGCCATACTTC TCTTTTTCGCGAAGCAGAGTTCGCTACAATATGCTAGGACTTTTCTTTTC CACTGTATACTCTTTGATGCATTATGAGTATCGAATGAATTGTTTTTAGA TCAAAGGCAATGGGCATTATGGTACACGCTTCACTTGGCTCAATAAGTTA AAACCATTTTCAGGTATTTTCTATATTTTACCATTTTTTTGTTACAGTAA TGAATTCCATCACATAAGACCATGATGCAAACTTTTGCCATCTAAGACTT TTGTTTTGAAATTTTTGTTCCAGATTTCACTCATTATATTCCAGTTAGCC CAAGATTTAAGTTCATACTTCATAATGAACATTTTTTAATATCTTACATT GGAAATTTTTCAAGGTGAATCACCTTCTCCGCAAGACTGTATCATCCTCA AAAACAATCAAAAGTCACGTTCAAATGACACTAGTGGTGGTACAGGACGA AAACAAAACGATCAACAAAGCATGGCTTTATCCTTACCAAGTACTGGATT GACCACCAGTAATCCTTCGTCACCATCCAGATCAAAGATTCTTTCACCAT CATCGATGGATGACACAAATCATGAAACATCCAAAATCTTGAAATCAAGA GAATTTTGTCCGTGTTGCTGTTGCAGTGAAATATTGATCAAATTTCAGGT GGGTTTGTTATTACTCTGATAAGTTTTATTTTTTTCATTCAGCATTGTTT TATGACTATTGAAATTTTGCTAATTGGTATAGCTTTGTTTTAGGCTACTG GTATCCACTAACGGATTCGTGCTCCTGCGGTTTTGTAGAGGTTTGCGATT CAAACTAGCTTTGTTTCACAATATTTGAAATTTGAAATCGCGAATTCTGC CTATGTATATTTATTGCATGTGATTGGATGTAAACGTTGCTCTTAATGTA GGGAACCCTAAATTAACAAGCAGAATAAATGATACCTTTCAGCCAACTTA TTAATTCAACTTATATGTTATTTGACTTTTTCTCACCGTATTTCAGTCAT TGCTGTGTTCAAGATACAACCGAAAGGAGTTCAGTTTACATGTCATCGAG AAATTGAAAGATTCAGATTTTGTTGGAAAAGAAGCATTGTTGTTGCTGGC CTGGCCCAAAGCTGGAATGGCTCAAGAGGTTTGCTTTCATNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGAACAGTCG ACTCAAAGAATTTTTTAAATGTAACAATTAAATTTTCAATAATGTGAAAT AATGAAATGAAAATCAAAGACTTTCGGGATCATAATAGAGATCCTCCTTC TTGGGCTCCTTAAATTTGGATGCCAGGAAAAGGTTGGTGATGTGTTTGCG ATACTCCGGGTCCTCAGTTTTCGGATTCAAGTTAAATGGAACGGCTTTCT TATTGGATTGCTCTGAAGGTGTAGAGCCACTTCGGTTGGCATTACTGGAA TGAATGTTAGCGGCCTGAATTGGTGCCAATTGCCCTGTGGGACGGTATTT GAAGGTCCGTTTACCCGTTCTTTTACTGTCTCGGCATCCTTGCAGAATCT TGAAACATTCGGAGCCTTCCTCTGTATACCGGATAGCATTTTTCATGAAG TTATCATAATGGTTCGGGTCGGCGCCGTGTTCCAAGAGGGTGAGTAGAAG ATCAGGGCGTTGTGCTTGGGCGGCTAAGATCAACGGTGTTCTAAAAAAAA GACTGAAAGAGTTATTTTCTGTTTTTATTTGCTGAATCAGAAGCTACTTT TTCAAAGGTCAGAAGATTTTCAAGATTACCATCCTATCCTCTAACAGACC ATACTGCTTTGTAGAGGTCTGCATCTCGACCATGCTGCTTCAATTAGACC ATGAGCACGTTCCTAGACAGGGTTCAGACAGACCCTGGAAAACCTGGAAA ACCTGGAAATATGATAAATTTTCAGAAAAATCAGGGAAACTCAGGGAAAC CCAGGGAAAAAATTTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCAGGGAAACTCAGGGAATTT TATTTTTTGAAGAATGAATTTAAAATTTTTAAAGTTTTTTCTTAGATTCA TTTAGATTTTTGCTAACAACAAAACTTACTAGTTTTAAAAGATACTAATT TAAGTAGATTGTTGGCAGAGATATATTTTTTGTCTTGAAAATATGCTGGA ATGTGTTCGTCTTCAATTTTAGTGTTGTGTTTGCAGTAGTTTATTCAATT TATCTAGATGATAGGTGCTAATCAAGTAGATTGTTGTCTTGACAGAGAGA AAGACACTTACTAATAAGGTTTTATTTTTTTTTAGAAATAAGTAAAAATG AGTAAGCAAGAAAAAACATATTTTCAAGACAATTGGTCAGAAATAGACGA GTCTAAAGATTGGATTGCTCGATCATCAGTTAATACTCAAGCAAGGTGCA AGCGTTGTCACAAGACTTTTGCGCTATCAAATATGGGAGTTCAGGCACTT AGAAGTCACGCATCTGGAAAGAAACATAAAGAGATAACACAGAAAGTGTC TTCCTTTTTTAAAACGAAACCAGTTAAAGAGTCGTCACATGAGCAGAAAT CAAAAGAGGATAACGAAAGGACAAAAAAGTCTCAAACAAGTATAGAATTG ACTCTTACTTCTGTGCAGATGTTACCAAAGCGGAGATTCGGTGGGCTCTA GATGGTATACTGAAGGGAAACTCGAACAATCAAAACGCTAACATCAGTCC CCTCCTTAATGCATGTTTTCCTGGTCATGAAACGATCAAGTTATTTTCAC TAGGAGCTGATAAGTTACGATACTCTTGCAATTATGGTTTAGCTCCATAT TTTCGTTCCATTCTTCAAGACGAAGTTAAAAAATCTGAAATCTATGTCAT GTCTTTCGATGAAAGTCTTAATGATGTANNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNTTTCAAGGTCTAGGGTTTAAATA CCTTAAATATGAACGTTTTGGGACTTCAAAGTCCACCATTTTCAACATTT TACTGCATAAAATTTGAAAAATTTTGAGACTCAAATCTGTATTTGCAGTT TTCTCAAAATGGAAAAAACAGATTTAAAAGTTTTTTTAGTTTTAAAGTGT TTATTCATATGCAGTATTTGTAGCTTTAATTTTTACCTTAGGTTCACCAT TTGATTTGTGTGCCTTTTGTTTAAAGATACATCTCTTTTGACTCTGCTTA GTTTTTATGGTTTGCTTGATACTCAGGGAAAAAAAAGCTAAAAAATAGCT AAAATGAGGAATTTCTCAGGGAAAAAACCTTTGAAAATTGATTAAAATTC AGGGAAACTCAGGGAATTTTATTTTCGAAGGTCTGTCTGAACCCTGCTAG AATAAAGGAGGTAACTCAAATTCTACTTCAAATATCCCAGTCTTACCTTT TGTCGGCTTCAACGGCATCGACATCAACCATACCTGGTTCCAATATCATT TGTATCACTTTCACGTTTGTCACGTGTTTTTTTGTGACCACAGCTTGATG GAGTAAAGACATTCTGTTACTTCCCATGTCAGTATCACGGATGCCACGCC CATTATACAAATACTCGATTATTTCGAAAGCGTCATCGCCATATTCAGTG ATGGCGTACTCGATAGCGTTTCGCTCATCCCGACATGTGACGCGAGCTAT AGCGCCTGCTTGTACCAGAAGGCGTACGCATGCTAGCGATTTCATATCGA TCGCTTTGAACAGTGCTGTCTTGTCGTGTTTGTCCTTGATGTTTAAATTG ATACCGCGAATATCAAGAAGGATTTTTAACATACGGTAATCGGCCCAAGA GGCGGCAAAGTGAAGAGCTGTTCTGCCGAATTTATCCGTCCTGTTAACTT TGCCATGTTTTGATGGATCCTGAAGATACTTTTTGAGCTTTTGATGCTTA CCTTTCCAGGCAAGTCTGTAAAAAAAAGAAATTCAGATTTTTATTGCTTC GTTTACTTGAAATACTACGGTTCAAATTATGACCTCTTTTACAAAAGCAG TTCTCCAAAATTATTACTGCTGTTTACATAGGTATTGTTGTCTAAAAAAG ATTTTCTTTTCCCATGCCATTAGATTAAAAATTCATTTGAAAAGAGTTAA TGTTAAAATGCTTACCTCATCAACGTTGACAATTTGTCCTCTTTGACCGT ACAATTGGGGTATGCACCATCTAACAACTTTCTGCGGATGCGCTTCTCAC CTTTGGAGTTGATCCTGTCTTCACTTTGCCAAGTGGTCTTATGTTCTTTC AGATTATCTAAATAATCCTGAGCCTTTTGTCCGTTGCTGGTGACAGATAC TGAAGATCCGGGTCTTGCAGAGCATGTTCTTGATTGATGAGTACTATAGA CAGAGCTTGAAGTGCTGGCTCTTGACACTGCTCGGGAATGCGTACTACTG TTAATAATACTCAGTAGTTTGACCGGTTGGCTTTTTCGAGTTTCTCTGTC AGCTTTGAATTGGTTTAATCGGCCAACCACGTTTTTTGCGTTTTGCTCTT GGAAGCCATATCCAATATCTGGAATTTGAGCATGCTCCACATACGGTATT TCATGGTTTTCCTTTTCCGGCCAATCAAAAGTCGTGTCCGATGACATTAA ACTCAAACTGGAAGCTGTTGGTTTAAGATCGATGATCCCAACGTTTTTAA TAGGGCTTGTCAAAAGTATTCTATACATGCGATGAAGGTCTTCTGGAGAC GGAGCACGTGGTAAAGGTATAACCTCATTGACAATATCTGCGTCGTTGTA ATCCTCAAGATCGATAACTTCGAGGTCGTTATCGAATCTTACACGGTATA GAGCTTCAGTTCTTGGCATCGTGTATACTTTTCGACGAATTCCTTTAATA TAAAATCAATTATAATTAACCATTAATCCGATATTCAGGGCGGTGAGAAA TGTTTTGATGACTAATTGTCTTTTTAGTTGATAATTATTTTTAGTATTCA AAAGCTTAAAGACTTTAAAGAACTGACAAACATTAAAACATGTAAAAACA AAATCAAATTTCGTAAAATTTTAAGGTCGGTCGAGCCCATATAAACAGGT TTGATTTTACAATAAGCAAAATAAAATAAAAGACTTACCTAGGGGTGGTG TAAAGGGCGCTACGATGGTGGTACGTGAAACTTCTCCTTTGTAAACACTG GTGACGGAAATACCAGACTCTGTTGAACATAAGGAGATTGTGTCTGCATC ACTTTCATCATCTCGAAATTGCATCCTGGTTTGCGTTCGTGTGGGCGCCG GTAGGTTACCAGGGCATGTAAGGACACGTGCAGTGCGTGGCCGTTTTGGT GCAACGCCTACAGTATGTGATGGAATTATTTGTAGTTCCGAAGTCTCGAC TTCTTCAGTTTTACCACTCGGGTGAATGACAGGAAGACGAGTCTCTGAAC AGGGCACTGGTGATTGTTTGCCAGTTTGATGTTCTTGACAAAGCTGGTCA TAAATATCTTTCATTGTAAGTGATACGTCACTTCCGTGCAATGCCTTGTT TCGTTTCTTCTCTTCTTTTCTCTTCTCCTTGCGCGAGTTGGTTTTTCGGG TAAAAGTTGTTTTTAACTTTTTTTTGATGCCCATTGTAAAGAAACAGGTG TAACTTGGATAAACGATTTCAAATAACCTCAAATATAAACAAAAAAGGGT CGCTGACCTGCGATTAAACCAAACAATGGTTAGCGACTTGTAGAAACGTT ATCTGAAGACGCCAAAAGACAAACGTTGGTCGTTATGAAGATATCTGCGA TGGAAACTTTATACTCAACGATCAGCAATACGTGATAGACGATCTGCGAC ACTTGATCAGCAATGATAAGACAAATGATAAACAAAATCTCATAAAAAGA TGCAAAAAAATTCCAAATAATCGGCTTTCTTCGTTGCGTACTCGACGAAA TTTCCTTGGAATATGAGATACTTGGTTCAATGTAGTTGACGTCAAATAAA ACTTTATTTAAAATTGACGTCAAAACTTTCCAATCAAAAAATAACTTTTC ACCAATCAAAATGGTGGACGTAGTTATGGAGTTCTCTCACTGTTCTCGAT CGATTTGACTGGATTGAACAGTCCGTTTGTCTCCAGACCAGTCAAATTGA TCGTATTTGGCCATTTCACTCTTCCGTCTTCCAGAAAGAAACCTTAAAAA AAAGAGCTCGAATTTCTGCTTTTAAACCTACAACTTTGTGATGATGCAAT CAAACCAAAAGATAAACGCTTGGAAATGCTCACAGCTTTTAAAATATTTC CATCAACTTTGATAAAAAACTTTATCCACCACACCGGAGAATTTGATTGA TAATGTTCGAAGCCTCTTCTTTCGTTAGCTCACCTATAGGGTGCCGTTCT TTCTAACAACCCTTGATCTTCCTCTTTGACTGTTGACAATTAAGCTGAGT ATCAATCAAGTACCATTTTTCGAGTCTTTTGGTATGATCCAGCCAGAAGT TGAAACTTGTGTACCGTATCAATGAGCTAATAGATGTTTATCTCCGAGTA GATTCTGATTACTCGGCGCTGGCACGCATACACTCCAAAGATCATGTCTC CATAAGAGAATTTTCCCGTTTGGCGTTTCGGGATGAATATTAAAACATTA GAACCCAGTCGCTTTCCTTTTCGGTTTCAAGCAAAAGGCAACGCGGTCTT GATTACCAGGCCAAATCGTCGCAATTCGCCATATCCTTCGAAGAGCGTGG TATGCGTAGAATGGATGACAATATATGCTGATTGATGATGTTGTCGCCGG AGCCAACCATTTATAGTCTTTGATTCGATTCGTGATATTGATTAAGTATT GTTTTATAGGGAAGCACGCAAAAAAAAAACGATTGTTAGCCACTAATTTC GAATTTGGCATACGACCAGGTTATTTTGGGTCTTTCCGTACAGAAAATTA TGTAATGAATATCATGAATCACGTGAGAAAATATTCAAAACATTTACATT TTCATTTTGGTTTATTGTAGGCAGTTGATTATATCGTGGCGAATTACCCG GCGTTGATCCTACAGTATGCCAAAGATATGTTCGATTGGAAAGCTCAGGT AAATTTTTTATTCATGTTATTCATGACGAAATGTTTCGTACGGAAAGCAC TTAAGAAAGGCCGGGTGTTTGCTACTAAATTTCAATTCGAATAATGAAAC TAGTGGCAAACGCCCGGGTTATTTTGGGTGCTTCCGTATAAAACATTACG TCATGAATATCGTGAATTCGACTGCAAATAATTGCAGACTCAAAACAGAT TTATTTATTACAATTAGAATTTCTTTACCATACAAAAAGAAATTGTTAAA CTCCGGTTAAGGAGTTTCTTAAAATAAGTATTTTTCATTTGTAATTGTGC GTACATCCGATCAATCGCGATAATCGGGCTCGTTTTTCCGATTTCCCGAT TTGGTTTGTGTTTGCGCTCGCACCTACTAGGATATACTCTTTTAAATCTT ATGTTAGACATATTAAGAAAGACTGACCCATGACAATTACCGGAGTTTGC AGCCGTCATTACGGCTGTTTTATTTTAATATAATATTTATAATGTGGGTT AATGAATTTTTGAAAATCTGAAGCATTTAGAATAGAGTAGTATCTCAGTT ATGATATAGAGTGGTCTATAGCTAAGTTACTTACTTTTGTATCTCCCTAG TGGCAACAACTTTTACAATGCTTGCTGGAGTACATCAGAGCGAATAAATT TGAACCGTGGAACTATGATGTTTACATGGAAACACTGAAAGGTATAAACA TTTTTTGCGGGGATTGAAGTTCGGGTTATTTAGTAACATACGTCAATTTT TTCGACTGATTTTCGAAAAAATGTCACGTCAATCCAATGATTTCTCATTA GCAAAAATGTATACCCCTTAACCCTTTAGCCTCGCTTTTGATCTGAAATG TACCAGATTGGTAAACTAACATGAAATGATTTAATTCATAACAAATATCG GGATTTTGAATAATTCTAATATCGGCTTTTTTACGGACAGGCCCTTGTTA GACTGTATTGGTAATGACCACAGATATCTTATATACCCGGGGGGTACTAG GGTTGGCGAATGACGTTAGGTGCTGGGGACCTCCGAAAACCGACCCTTAG AGAGACTGATTTTTGCTGAAAAAGTGACCCTTAGAGAGACTTTTTGAATT TTTTTCTTTAGATTTTGAAAAAAGTCATACCCTTACAGAGACTTTATTAC AATTTTTTCTCTGAAATTCAAAAGATTTCCTAAAATTCCTGAATTTTCCG ACCCTTAGAGAGACTAAATTTAAAACTTTCTGCTTTTTCCGACCCTTAGA GAGACTTTGAAAGGTGAAAAAACCGACCCTTACCGTCCGCACATACCCAT CATCCATTTTTGCCTAAGTGCCCCCCCCCCGGGCTTATATAAAACACTAG ATGGAACTTTTCCTACCCTATTTGAAGCAAAATAATTCGCCATCTCGGTA GTCTAGCAAGCTAGACGACTAATTTATACATAGTAGAAATAAAGCAAAAA GTAATGAATGGAACAATTTTAGTCGTCTAGAAACCTTTGTGCACTAACTC CAAACAAAAGAAAAGTGTCAATATTTGCGATTATAATTTTTTCCTGCTCA AAATAATTCTTGAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNTCTTCCAGTCGTTTATACAAACTAAATCCCGTATTATTATTATTATT AGTATTGGTATTATTAGTATTACATGCATTATAAACGACTCCAGTCTACC ATCTCGGATGAAGTGACGTCAAAATTTAATTTGCGAGATCCTTGAAATTT TGAAGTCATTGCAGTGTCTAAAGAGTTTTAACAGTGAAAACCAATGTTTC TACTGTGACCTACTTTCAGCAAAGATGGCGCATTATTTTGCTTCACCTGT CTTTGCTTAGATTAGAGACTACTTTTGGCTGAACTTTGCTTTTTGATAAT TTTTTATGACGCTGAGTCCAGTGAAGTAGACTAGGAGCGTTTGGCGAGAA AATATTAAAAAGCCAAATAACAATAAGACTACTAGCTTTAAGTGGGCCCC GGGCTAGTCTTTGCTCGGGAAAGATTAGAGAGTATTTTATCTAGTGCTTT ATATAAGATATCTGTGGTAATGACAGGAAAGATTACAATAAGCTACCTCC GTCTAAAAGGATTTGAAAATCTTCTCTACTTTTCACACAGGTGTTTTGAT GAGGTTGGCAAGAGCGTTTTCACCAAAAGACTTTCTCAACATGTTACCGT CAGATATGAATGTTAATTTCATGTTACCTTACCTGGCTGAATGCAATGAA TTTCATCGATCTTCGTCGCTCAAAAGTCAAATCTTACAAACTTATAAAAC TCAAATCGAGATTCATGAAAACCTTTAAAGAAATTTTATTGCATTACTTT GGAGGTAAAAACTGTCTTTGAAATTGTTGAATGTGCTGGAACATTAACTA ACCTTGATGATATAATACATAGACCCTGGTATTAAAAGATTGATGTAAAG CACCTCGAAGGACTTAGTGTTTTAAATTAACTTCATGGTGAAGACATAAT AATAATTATTTGCTTGACCCTCGGAACTACACATATGCTGTTCGCTAGAA TTTGAAAACTATATCTTTATATGCAAGATAACCTTGCTCACATATCTAGA ATATTGTATACAGCACAAACATCAGCAGGATAGGTGCACGACTCAAACCT GTTGAACGCCTTTGTTTATACAGTTATGTTTTGTTGTTGCGAATGCTAGT ACTTCATGCCGACAAATTATCATGTTTGAATTTGAAACTGCTTACTGATT TTACTTATGGACGGGGCTCCAATCTCCAATCTCCAATATTGTTTGAGAAG TTGACATTTTTTGGTCTGCAAACATATGATTGTCACTCTTAAACGTCTTG AATAGAATTGAATATAATAAGGAATACGAGGCTCACCCCCTTTCAGCGTG AAATATTTCCGCTAATTTCAATAGATCCACCATTTGCAGAATATAATGAC AACAATATGGTCAATCATTCTAAATTACCAAGCCCGGTAACGTCTTTACA TAGAACTTTCTTTGGTTATCACTTGATCATGGCTCAATTGGTACCGTACC TAAGGCTAACTTTCCAAAAGTTTGCTCAACATTCAAATGAAAACATATCC GCTGAGATCAAAAATTTCGAAACCTCCCAAATTATGTCAGCTTAGGTTTT AACTTATTTCAAAGTGGATATACCGCAGCACTATTCGAATATTTCCGATT TTGTCGCGTTTGATTGATGATTGAAGTTTTGGATAGTAAGCCCTAAGAAC GGTAATTGTTTTTCAACGAATTTGGTTAAAAGCCTTTCTCGTTGTATAAA GATGTATCGGAGAGTCCACTCGGAATCGAGAAGACTTCAAAAGGTATATA TTTAGAAATTTCATTCTGAATCATCGTTTATATTTCGAATAAGAATAAAG TTGATCAAAATATTTTTAAGTCGGAAATTTTTGCACTTTGGTATTGTAAT TTTTTTGTACGATTTTTAGATAACTTATTATTTCACACGGATTATATTTT TTTATGAAATAGATAAAAGATTTACGAGTTGATGTATGTATATAGCAGAT AGAAATATTAATTTAAATCGAT

Coding sequence (CDS) from alignment at sc0000012:666048..706669-

>TCONS_00001950 ID=TCONS_00001950|Name=TCONS_00001950|organism=Clytia hemisphaerica|type=CDS|length=86595bp|location=Sequence derived from alignment at sc0000012:666048..706669- (Clytia hemisphaerica)
GTGTTTTGATGAGGTTGGCAAGAGCGTTTTCACCAAAAGACTTTCTCAAC
ATGTTACCGTCAGATATGAATGTTAATTTCATGTTACCTTACCTGGCTGA
ATGCAATGAATTTCATCGATCTTCGTCGCTCAAAAGTCAAATCTTACAAA
CTTATAAAACTCAAATCGAGATTCATGAAAACCTTTAATGGCAACAACTT
TTACAATGCTTGCTGGAGTACATCAGAGCGAATAAATTTGAACCGTGGAA
CTATGATGTTTACATGGAAACACTGAAAGGCAGTTGATTATATCGTGGCG
AATTACCCGGCGTTGATCCTACAGTATGCCAAAGATATGTTCGATTGGAA
AGCTCAGTCATTGCTGTGTTCAAGATACAACCGAAAGGAGTTCAGTTTAC
ATGTCATCGAGAAATTGAAAGATTCAGATTTTGTTGGAAAAGAAGCATTG
TTGTTGCTGGCCTGGCCCAAAGCTGGAATGGCTCAAGAGGTGAATCACCT
TCTCCGCAAGACTGTATCATCCTCAAAAACAATCAAAAGTCACGTTCAAA
TGACACTAGTGGTGGTACAGGACGAAAACAAAACGATCAACAAAGCATGG
CTTTATCCTTACCAAGTACTGGATTGACCACCAGTAATCCTTCGTCACCA
TCCAGATCAAAGATTCTTTCACCATCATCGATGGATGACACAAATCATGA
AACATCCAAAATCTTGAAATCAAGAGAATTTTGTCCGTGTTGCTGTTGCA
GTGAAATATTGATCAAATTTCAGATCAAAGGCAATGGGCATTATGGTACA
CGCTTCACTTGGCTCAATAAGTTAAAACCATTTTCAGGTGATCTTAGTGG
ACCAGTACTTACTGCGCATGACAAAGAAAATGAATACTAATGATGGTTGG
AAAATCAAACATAACCACGAGATTCATCTCGTCGAAAGAGCTTCCAAGAA
ATTGCGGCAAAAGGAAAGGCTGAAGACAATGAGAAAAGAATTCCACTTGA
TCGACAAGCTTGTCAAATACTTGAAAATCTTCTAAATGTTAATGAAGAAG
CATTTCAAAGAGAGTTTCCAGAGCATTGTAATTTCTCTGTTCGATACACG
CACAATCGACTTGAATAATATCCTTCAAATATTCCAGGACGATTTGCTAA
AGATTTGTATTTCAAATACTGAAGTGTTATTCAACTCACAATATCAATTG
ACGCCCATGGGACAGACTACAACCACTGGACAGCTTATGTTTTGCTTACT
TGCACATGGACTTGGGGAACCCAGGGCACGCGGAAGAGCTTTTGAAAGAA
CTGGAAAAGATTTATGTGTCAAACTGATGAGCAAATACAAGCGGAAAAAA
GAATCAAAAGAACAGAGAATATTTGTGATTTCATCATCAATGTGTATGGC
AAGAATCATCCATCAATGCTAGCAAAAGTGATCTTAAAATCCAATCTACC
TCGTCTCTATTCAATTGAAACACAGTTTTGGAACTGGAATGATTGAATAT
CTGAACAATACTCTATTCGGCAAAGAACAAGTACAATTCGATAAGATGTG
AACCAAGTTTTGATTTCACCAGCGTCAAAGGGTACTTCGAAATGGCTGGA
ATGCAACCTACAGCCGTCCTTGAACACATGAACAATGAAAACATAAGACT
CGAGCGAAAGAGAGAAGGGCGGCGCAACATCATCACCATGGAGTGTATGC
AGCTTCGAAAAACACATCTCAACGGATGTGGGTCAAAAGATTACCAAACT
AATTGAAGAAAGTGAATTTTCGAATCCCATGGTGTATTATCATTTACTGT
GTGAATCACATCTTTTACTTTGTTGTGATTTGATGAGCAGACCAAACGAT
GAAATTTTGATCAAAGCATTGAAATCATCAGCCGTCTCACTTGCAACCTT
CTTAATGAGACTTGTCCACCGAAGGATCTGGAAACTTGTTTGGTTGGTAT
GTATCCATACCAAGATGTTGTTTGTGTGGCAACTAGTATGTCCTTCGTCC
TCATGTTCATCAAAGTCCCTAAAAGAACAAACAGCTGGTAAATCAAAACA
ACCTTATCGTGCTCGAGATCGTGGACCAACAGAGATCTTCCTGGAAACCA
ATTACTTCATGGATTACGTGTCTGTCAATAAAGATCTCTCCATGATCGAA
GATGGTGGACTGGGCCCTAGTAATGATATTGAGCCAAGAAAAAGAACCCA
TTCTTCGGCCTATGATAGATACCCATATCAATGGCTTTTAAAGATATCGC
TGAACACAAACAATTGGAAGTTGAGGAGAAAATGCCATGGCCTTGGAATG
CTTTCTTAAAACCACACTCCTTCCCAGTTCTCCTCTCCATGCCTCTTTTT
TTCTCAACTGGAACACATGGTTACCTCTACGACACGTGGAACTCAAAAGG
ACTCATCTTAGACTACAGTTACACGTCAGATTGTTTGAGTGCCAAACATA
CAAATTCACTTCTATACACTGTCACCAGTAATGGATTGGAGATTTTCACT
TCTCGCCTTTATCCCTTTGTTTCTGGATGTACAAAAGAAATGTTTAAAGA
ATGCAAGTTTTCCAAAAATGCCGAAATAGCTAATAAAGGTGAACATACAA
TCCTTGTTGGTCACCCACTATGTTGCTCGTTCCTTGGACAGATGCCCACC
AAAGAAGGTCACGTCAATTATGCCACAGTCACCAGTACTACACATCTGTA
TCGAAGATTTGAGGAGGATGATATCTCTTTCTCGGGAAACACTGAAAGAA
TACATAGTCTACAATGGCTGCCTATCTTTTTGGAAGTGACTCAACAACCC
AAACAGACGGTCTTGAGAAAACCACAGTCTCAGTTCTCACATCAAAACCA
TCAAAGTCAAATAACATGCCAGTACAAACGACGTTATGGGATTTTGACCA
AGCTACTTCCACTTCATCAATCAATGAATTCGAATCTAAAGGTGGTCATG
GTATGATGCAAATGCAATCTATCCAGGAAGAGAAACCTTACATTGATACT
AAATCATCTTCCAAAGAAGTGACAGATGGTACGTACTGTACTTTGCCATC
CATTTGTGGAGCAAAAGAATTTCACTGACCAATACGATGCATCGTGTATT
TGCTGCACCAATGATGATAAAGTTCTCATTGGTTCATTGTATGGTAGCAT
CAGCATAATTGATCTCAAAGGTGGTACACATAATGTTTTACACAAATTTC
CTTCAAATGGAATCCCAATCAAAATGTTGTTTTCTGATGATAAGCAATTC
TTGGTGTCACTTGAATCTAAGCTTCAAGATTATCGTGTTGGATTATCAGC
TAGGGAAATGAACTGTCAAGCTAGAGTATATTCAAATATTATGCTTGGTA
ACCCACAGAAGAATGTTGCCCCTTTAAGTAGCGGGTATTCAATTAACCGA
CACAATAATAATCATACACGAAACAAGTTTTCTGTTATTGATTTTGCTGG
TTTACGTCAACCTGCAACTGATATTGCCCTATGTAACTCTCGTCATAATG
TTGCCATATCAAGTTCAAAGAAAATCTATCTTTACGCTTTCAAAGAAGTT
ATGTCTGCTGATTTACCAGAGGATGATAGTGTCCTCACAATTGATTTCAT
ACGCATGGTAGAAGTTGAAACCACTATCAATATAAGAAGTGTAGCTTTTT
CATTAAATTGGATTGCCTTTGCCTCCAAAACTGAAATTCGTGTTATTCAA
GTTTATCTTCACCAACCATCAGATGAAAAGGTTTATCAAGGAGAAGACGT
TTCTGAACTTCTTGAGTGTTTTGATGAGGTTGGCAAGAGCGTTTTCACCA
AAAGACTTTCTCAACATGTTACCGTCAGATATGAATGTTAATTTCATGTT
ACCTTACCTGGCTGAATGCAATGAATTTCATCGATCTTCGTCGCTCAAAA
GTCAAATCTTACAAACTTATAAAACTCAAATCGAGATTCATGAAAACCTT
TAATGGCAACAACTTTTACAATGCTTGCTGGAGTACATCAGAGCGAATAA
ATTTGAACCGTGGAACTATGATGTTTACATGGAAACACTGAAAGGCAGTT
GATTATATCGTGGCGAATTACCCGGCGTTGATCCTACAGTATGCCAAAGA
TATGTTCGATTGGAAAGCTCAGTCATTGCTGTGTTCAAGATACAACCGAA
AGGAGTTCAGTTTACATGTCATCGAGAAATTGAAAGATTCAGATTTTGTT
GGAAAAGAAGCATTGTTGTTGCTGGCCTGGCCCAAAGCTGGAATGGCTCA
AGAGGTGAATCACCTTCTCCGCAAGACTGTATCATCCTCAAAAACAATCA
AAAGTCACGTTCAAATGACACTAGTGGTGGTACAGGACGAAAACAAAACG
ATCAACAAAGCATGGCTTTATCCTTACCAAGTACTGGATTGACCACCAGT
AATCCTTCGTCACCATCCAGATCAAAGATTCTTTCACCATCATCGATGGA
TGACACAAATCATGAAACATCCAAAATCTTGAAATCAAGAGAATTTTGTC
CGTGTTGCTGTTGCAGTGAAATATTGATCAAATTTCAGATCAAAGGCAAT
GGGCATTATGGTACACGCTTCACTTGGCTCAATAAGTTAAAACCATTTTC
AGGTGATCTTAGTGGACCAGTACTTACTGCGCATGACAAAGAAAATGAAT
ACTAATGATGGTTGGAAAATCAAACATAACCACGAGATTCATCTCGTCGA
AAGAGCTTCCAAGAAATTGCGGCAAAAGGAAAGGCTGAAGACAATGAGAA
AAGAATTCCACTTGATCGACAAGCTTGTCAAATACTTGAAAATCTTCTAA
ATGTTAATGAAGAAGCATTTCAAAGAGAGTTTCCAGAGCATTGTAATTTC
TCTGTTCGATACACGCACAATCGACTTGAATAATATCCTTCAAATATTCC
AGGACGATTTGCTAAAGATTTGTATTTCAAATACTGAAGTGTTATTCAAC
TCACAATATCAATTGACGCCCATGGGACAGACTACAACCACTGGACAGCT
TATGTTTTGCTTACTTGCACATGGACTTGGGGAACCCAGGGCACGCGGAA
GAGCTTTTGAAAGAACTGGAAAAGATTTATGTGTCAAACTGATGAGCAAA
TACAAGCGGAAAAAAGAATCAAAAGAACAGAGAATATTTGTGATTTCATC
ATCAATGTGTATGGCAAGAATCATCCATCAATGCTAGCAAAAGTGATCTT
AAAATCCAATCTACCTCGTCTCTATTCAATTGAAACACAGTTTTGGAACT
GGAATGATTGAATATCTGAACAATACTCTATTCGGCAAAGAACAAGTACA
ATTCGATAAGATGTGAACCAAGTTTTGATTTCACCAGCGTCAAAGGGTAC
TTCGAAATGGCTGGAATGCAACCTACAGCCGTCCTTGAACACATGAACAA
TGAAAACATAAGACTCGAGCGAAAGAGAGAAGGGCGGCGCAACATCATCA
CCATGGAGTGTATGCAGCTTCGAAAAACACATCTCAACGGATGTGGGTCA
AAAGATTACCAAACTAATTGAAGAAAGTGAATTTTCGAATCCCATGGTGT
ATTATCATTTACTGTGTGAATCACATCTTTTACTTTGTTGTGATTTGATG
AGCAGACCAAACGATGAAATTTTGATCAAAGCATTGAAATCATCAGCCGT
CTCACTTGCAACCTTCTTAATGAGACTTGTCCACCGAAGGATCTGGAAAC
TTGTTTGGTTGGTATGTATCCATACCAAGATGTTGTTTGTGTGGCAACTA
GTATGTCCTTCGTCCTCATGTTCATCAAAGTCCCTAAAAGAACAAACAGC
TGGTAAATCAAAACAACCTTATCGTGCTCGAGATCGTGGACCAACAGAGA
TCTTCCTGGAAACCAATTACTTCATGGATTACGTGTCTGTCAATAAAGAT
CTCTCCATGATCGAAGATGGTGGACTGGGCCCTAGTAATGATATTGAGCC
AAGAAAAAGAACCCATTCTTCGGCCTATGATAGATACCCATATCAATGGC
TTTTAAAGATATCGCTGAACACAAACAATTGGAAGTTGAGGAGAAAATGC
CATGGCCTTGGAATGCTTTCTTAAAACCACACTCCTTCCCAGTTCTCCTC
TCCATGCCTCTTTTTTTCTCAACTGGAACACATGGTTACCTCTACGACAC
GTGGAACTCAAAAGGACTCATCTTAGACTACAGTTACACGTCAGATTGTT
TGAGTGCCAAACATACAAATTCACTTCTATACACTGTCACCAGTAATGGA
TTGGAGATTTTCACTTCTCGCCTTTATCCCTTTGTTTCTGGATGTACAAA
AGAAATGTTTAAAGAATGCAAGTTTTCCAAAAATGCCGAAATAGCTAATA
AAGGTGAACATACAATCCTTGTTGGTCACCCACTATGTTGCTCGTTCCTT
GGACAGATGCCCACCAAAGAAGGTCACGTCAATTATGCCACAGTCACCAG
TACTACACATCTGTATCGAAGATTTGAGGAGGATGATATCTCTTTCTCGG
GAAACACTGAAAGAATACATAGTCTACAATGGCTGCCTATCTTTTTGGAA
GTGACTCAACAACCCAAACAGACGGTCTTGAGAAAACCACAGTCTCAGTT
CTCACATCAAAACCATCAAAGTCAAATAACATGCCAGTACAAACGACGTT
ATGGGATTTTGACCAAGCTACTTCCACTTCATCAATCAATGAATTCGAAT
CTAAAGGTGGTCATGGTATGATGCAAATGCAATCTATCCAGGAAGAGAAA
CCTTACATTGATACTAAATCATCTTCCAAAGAAGTGACAGATGGTACGTA
CTGTACTTTGCCATCCATTTGTGGAGCAAAAGAATTTCACTGACCAATAC
GATGCATCGTGTATTTGCTGCACCAATGATGATAAAGTTCTCATTGGTTC
ATTGTATGGTAGCATCAGCATAATTGATCTCAAAGGTGGTACACATAATG
TTTTACACAAATTTCCTTCAAATGGAATCCCAATCAAAATGTTGTTTTCT
GATGATAAGCAATTCTTGGTGTCACTTGAATCTAAGCTTCAAGATTATCG
TGTTGGATTATCAGCTAGGGAAATGAACTGTCAAGCTAGAGTATATTCAA
ATATTATGCTTGGTAACCCACAGAAGAATGTTGCCCCTTTAAGTAGCGGG
TATTCAATTAACCGACACAATAATAATCATACACGAAACAAGTTTTCTGT
TATTGATTTTGCTGGTTTACGTCAACCTGCAACTGATATTGCCCTATGTA
ACTCTCGTCATAATGTTGCCATATCAAGTTCAAAGAAAATCTATCTTTAC
GCTTTCAAAGAAGTTATGTCTGCTGATTTACCAGAGGATGATAGTGTCCT
CACAATTGATTTCATACGCATGGTAGAAGTTGAAACCACTATCAATATAA
GAAGTGTAGCTTTTTCATTAAATTGGATTGCCTTTGCCTCCAAAACTGAA
ATTCGTGTTATTCAAGTTTATCTTCACCAACCATCAGATGAAAAGGTTTA
TCAAGGAGAAGACGTTTCTGAACTTCTTGAGTGTTTTGATGAGGTTGGCA
AGAGCGTTTTCACCAAAAGACTTTCTCAACATGTTACCGTCAGATATGAA
TGTTAATTTCATGTTACCTTACCTGGCTGAATGCAATGAATTTCATCGAT
CTTCGTCGCTCAAAAGTCAAATCTTACAAACTTATAAAACTCAAATCGAG
ATTCATGAAAACCTTTAATGGCAACAACTTTTACAATGCTTGCTGGAGTA
CATCAGAGCGAATAAATTTGAACCGTGGAACTATGATGTTTACATGGAAA
CACTGAAAGGCAGTTGATTATATCGTGGCGAATTACCCGGCGTTGATCCT
ACAGTATGCCAAAGATATGTTCGATTGGAAAGCTCAGTCATTGCTGTGTT
CAAGATACAACCGAAAGGAGTTCAGTTTACATGTCATCGAGAAATTGAAA
GATTCAGATTTTGTTGGAAAAGAAGCATTGTTGTTGCTGGCCTGGCCCAA
AGCTGGAATGGCTCAAGAGGTGAATCACCTTCTCCGCAAGACTGTATCAT
CCTCAAAAACAATCAAAAGTCACGTTCAAATGACACTAGTGGTGGTACAG
GACGAAAACAAAACGATCAACAAAGCATGGCTTTATCCTTACCAAGTACT
GGATTGACCACCAGTAATCCTTCGTCACCATCCAGATCAAAGATTCTTTC
ACCATCATCGATGGATGACACAAATCATGAAACATCCAAAATCTTGAAAT
CAAGAGAATTTTGTCCGTGTTGCTGTTGCAGTGAAATATTGATCAAATTT
CAGATCAAAGGCAATGGGCATTATGGTACACGCTTCACTTGGCTCAATAA
GTTAAAACCATTTTCAGGTGATCTTAGTGGACCAGTACTTACTGCGCATG
ACAAAGAAAATGAATACTAATGATGGTTGGAAAATCAAACATAACCACGA
GATTCATCTCGTCGAAAGAGCTTCCAAGAAATTGCGGCAAAAGGAAAGGC
TGAAGACAATGAGAAAAGAATTCCACTTGATCGACAAGCTTGTCAAATAC
TTGAAAATCTTCTAAATGTTAATGAAGAAGCATTTCAAAGAGAGTTTCCA
GAGCATTGTAATTTCTCTGTTCGATACACGCACAATCGACTTGAATAATA
TCCTTCAAATATTCCAGGACGATTTGCTAAAGATTTGTATTTCAAATACT
GAAGTGTTATTCAACTCACAATATCAATTGACGCCCATGGGACAGACTAC
AACCACTGGACAGCTTATGTTTTGCTTACTTGCACATGGACTTGGGGAAC
CCAGGGCACGCGGAAGAGCTTTTGAAAGAACTGGAAAAGATTTATGTGTC
AAACTGATGAGCAAATACAAGCGGAAAAAAGAATCAAAAGAACAGAGAAT
ATTTGTGATTTCATCATCAATGTGTATGGCAAGAATCATCCATCAATGCT
AGCAAAAGTGATCTTAAAATCCAATCTACCTCGTCTCTATTCAATTGAAA
CACAGTTTTGGAACTGGAATGATTGAATATCTGAACAATACTCTATTCGG
CAAAGAACAAGTACAATTCGATAAGATGTGAACCAAGTTTTGATTTCACC
AGCGTCAAAGGGTACTTCGAAATGGCTGGAATGCAACCTACAGCCGTCCT
TGAACACATGAACAATGAAAACATAAGACTCGAGCGAAAGAGAGAAGGGC
GGCGCAACATCATCACCATGGAGTGTATGCAGCTTCGAAAAACACATCTC
AACGGATGTGGGTCAAAAGATTACCAAACTAATTGAAGAAAGTGAATTTT
CGAATCCCATGGTGTATTATCATTTACTGTGTGAATCACATCTTTTACTT
TGTTGTGATTTGATGAGCAGACCAAACGATGAAATTTTGATCAAAGCATT
GAAATCATCAGCCGTCTCACTTGCAACCTTCTTAATGAGACTTGTCCACC
GAAGGATCTGGAAACTTGTTTGGTTGGTATGTATCCATACCAAGATGTTG
TTTGTGTGGCAACTAGTATGTCCTTCGTCCTCATGTTCATCAAAGTCCCT
AAAAGAACAAACAGCTGGTAAATCAAAACAACCTTATCGTGCTCGAGATC
GTGGACCAACAGAGATCTTCCTGGAAACCAATTACTTCATGGATTACGTG
TCTGTCAATAAAGATCTCTCCATGATCGAAGATGGTGGACTGGGCCCTAG
TAATGATATTGAGCCAAGAAAAAGAACCCATTCTTCGGCCTATGATAGAT
ACCCATATCAATGGCTTTTAAAGATATCGCTGAACACAAACAATTGGAAG
TTGAGGAGAAAATGCCATGGCCTTGGAATGCTTTCTTAAAACCACACTCC
TTCCCAGTTCTCCTCTCCATGCCTCTTTTTTTCTCAACTGGAACACATGG
TTACCTCTACGACACGTGGAACTCAAAAGGACTCATCTTAGACTACAGTT
ACACGTCAGATTGTTTGAGTGCCAAACATACAAATTCACTTCTATACACT
GTCACCAGTAATGGATTGGAGATTTTCACTTCTCGCCTTTATCCCTTTGT
TTCTGGATGTACAAAAGAAATGTTTAAAGAATGCAAGTTTTCCAAAAATG
CCGAAATAGCTAATAAAGGTGAACATACAATCCTTGTTGGTCACCCACTA
TGTTGCTCGTTCCTTGGACAGATGCCCACCAAAGAAGGTCACGTCAATTA
TGCCACAGTCACCAGTACTACACATCTGTATCGAAGATTTGAGGAGGATG
ATATCTCTTTCTCGGGAAACACTGAAAGAATACATAGTCTACAATGGCTG
CCTATCTTTTTGGAAGTGACTCAACAACCCAAACAGACGGTCTTGAGAAA
ACCACAGTCTCAGTTCTCACATCAAAACCATCAAAGTCAAATAACATGCC
AGTACAAACGACGTTATGGGATTTTGACCAAGCTACTTCCACTTCATCAA
TCAATGAATTCGAATCTAAAGGTGGTCATGGTATGATGCAAATGCAATCT
ATCCAGGAAGAGAAACCTTACATTGATACTAAATCATCTTCCAAAGAAGT
GACAGATGGTACGTACTGTACTTTGCCATCCATTTGTGGAGCAAAAGAAT
TTCACTGACCAATACGATGCATCGTGTATTTGCTGCACCAATGATGATAA
AGTTCTCATTGGTTCATTGTATGGTAGCATCAGCATAATTGATCTCAAAG
GTGGTACACATAATGTTTTACACAAATTTCCTTCAAATGGAATCCCAATC
AAAATGTTGTTTTCTGATGATAAGCAATTCTTGGTGTCACTTGAATCTAA
GCTTCAAGATTATCGTGTTGGATTATCAGCTAGGGAAATGAACTGTCAAG
CTAGAGTATATTCAAATATTATGCTTGGTAACCCACAGAAGAATGTTGCC
CCTTTAAGTAGCGGGTATTCAATTAACCGACACAATAATAATCATACACG
AAACAAGTTTTCTGTTATTGATTTTGCTGGTTTACGTCAACCTGCAACTG
ATATTGCCCTATGTAACTCTCGTCATAATGTTGCCATATCAAGTTCAAAG
AAAATCTATCTTTACGCTTTCAAAGAAGTTATGTCTGCTGATTTACCAGA
GGATGATAGTGTCCTCACAATTGATTTCATACGCATGGTAGAAGTTGAAA
CCACTATCAATATAAGAAGTGTAGCTTTTTCATTAAATTGGATTGCCTTT
GCCTCCAAAACTGAAATTCGTGTTATTCAAGTTTATCTTCACCAACCATC
AGATGAAAAGGTTTATCAAGGAGAAGACGTTTCTGAACTTCTTGAGTGTT
TTGATGAGGTTGGCAAGAGCGTTTTCACCAAAAGACTTTCTCAACATGTT
ACCGTCAGATATGAATGTTAATTTCATGTTACCTTACCTGGCTGAATGCA
ATGAATTTCATCGATCTTCGTCGCTCAAAAGTCAAATCTTACAAACTTAT
AAAACTCAAATCGAGATTCATGAAAACCTTTAATGGCAACAACTTTTACA
ATGCTTGCTGGAGTACATCAGAGCGAATAAATTTGAACCGTGGAACTATG
ATGTTTACATGGAAACACTGAAAGGCAGTTGATTATATCGTGGCGAATTA
CCCGGCGTTGATCCTACAGTATGCCAAAGATATGTTCGATTGGAAAGCTC
AGTCATTGCTGTGTTCAAGATACAACCGAAAGGAGTTCAGTTTACATGTC
ATCGAGAAATTGAAAGATTCAGATTTTGTTGGAAAAGAAGCATTGTTGTT
GCTGGCCTGGCCCAAAGCTGGAATGGCTCAAGAGGTGAATCACCTTCTCC
GCAAGACTGTATCATCCTCAAAAACAATCAAAAGTCACGTTCAAATGACA
CTAGTGGTGGTACAGGACGAAAACAAAACGATCAACAAAGCATGGCTTTA
TCCTTACCAAGTACTGGATTGACCACCAGTAATCCTTCGTCACCATCCAG
ATCAAAGATTCTTTCACCATCATCGATGGATGACACAAATCATGAAACAT
CCAAAATCTTGAAATCAAGAGAATTTTGTCCGTGTTGCTGTTGCAGTGAA
ATATTGATCAAATTTCAGATCAAAGGCAATGGGCATTATGGTACACGCTT
CACTTGGCTCAATAAGTTAAAACCATTTTCAGGTGATCTTAGTGGACCAG
TACTTACTGCGCATGACAAAGAAAATGAATACTAATGATGGTTGGAAAAT
CAAACATAACCACGAGATTCATCTCGTCGAAAGAGCTTCCAAGAAATTGC
GGCAAAAGGAAAGGCTGAAGACAATGAGAAAAGAATTCCACTTGATCGAC
AAGCTTGTCAAATACTTGAAAATCTTCTAAATGTTAATGAAGAAGCATTT
CAAAGAGAGTTTCCAGAGCATTGTAATTTCTCTGTTCGATACACGCACAA
TCGACTTGAATAATATCCTTCAAATATTCCAGGACGATTTGCTAAAGATT
TGTATTTCAAATACTGAAGTGTTATTCAACTCACAATATCAATTGACGCC
CATGGGACAGACTACAACCACTGGACAGCTTATGTTTTGCTTACTTGCAC
ATGGACTTGGGGAACCCAGGGCACGCGGAAGAGCTTTTGAAAGAACTGGA
AAAGATTTATGTGTCAAACTGATGAGCAAATACAAGCGGAAAAAAGAATC
AAAAGAACAGAGAATATTTGTGATTTCATCATCAATGTGTATGGCAAGAA
TCATCCATCAATGCTAGCAAAAGTGATCTTAAAATCCAATCTACCTCGTC
TCTATTCAATTGAAACACAGTTTTGGAACTGGAATGATTGAATATCTGAA
CAATACTCTATTCGGCAAAGAACAAGTACAATTCGATAAGATGTGAACCA
AGTTTTGATTTCACCAGCGTCAAAGGGTACTTCGAAATGGCTGGAATGCA
ACCTACAGCCGTCCTTGAACACATGAACAATGAAAACATAAGACTCGAGC
GAAAGAGAGAAGGGCGGCGCAACATCATCACCATGGAGTGTATGCAGCTT
CGAAAAACACATCTCAACGGATGTGGGTCAAAAGATTACCAAACTAATTG
AAGAAAGTGAATTTTCGAATCCCATGGTGTATTATCATTTACTGTGTGAA
TCACATCTTTTACTTTGTTGTGATTTGATGAGCAGACCAAACGATGAAAT
TTTGATCAAAGCATTGAAATCATCAGCCGTCTCACTTGCAACCTTCTTAA
TGAGACTTGTCCACCGAAGGATCTGGAAACTTGTTTGGTTGGTATGTATC
CATACCAAGATGTTGTTTGTGTGGCAACTAGTATGTCCTTCGTCCTCATG
TTCATCAAAGTCCCTAAAAGAACAAACAGCTGGTAAATCAAAACAACCTT
ATCGTGCTCGAGATCGTGGACCAACAGAGATCTTCCTGGAAACCAATTAC
TTCATGGATTACGTGTCTGTCAATAAAGATCTCTCCATGATCGAAGATGG
TGGACTGGGCCCTAGTAATGATATTGAGCCAAGAAAAAGAACCCATTCTT
CGGCCTATGATAGATACCCATATCAATGGCTTTTAAAGATATCGCTGAAC
ACAAACAATTGGAAGTTGAGGAGAAAATGCCATGGCCTTGGAATGCTTTC
TTAAAACCACACTCCTTCCCAGTTCTCCTCTCCATGCCTCTTTTTTTCTC
AACTGGAACACATGGTTACCTCTACGACACGTGGAACTCAAAAGGACTCA
TCTTAGACTACAGTTACACGTCAGATTGTTTGAGTGCCAAACATACAAAT
TCACTTCTATACACTGTCACCAGTAATGGATTGGAGATTTTCACTTCTCG
CCTTTATCCCTTTGTTTCTGGATGTACAAAAGAAATGTTTAAAGAATGCA
AGTTTTCCAAAAATGCCGAAATAGCTAATAAAGGTGAACATACAATCCTT
GTTGGTCACCCACTATGTTGCTCGTTCCTTGGACAGATGCCCACCAAAGA
AGGTCACGTCAATTATGCCACAGTCACCAGTACTACACATCTGTATCGAA
GATTTGAGGAGGATGATATCTCTTTCTCGGGAAACACTGAAAGAATACAT
AGTCTACAATGGCTGCCTATCTTTTTGGAAGTGACTCAACAACCCAAACA
GACGGTCTTGAGAAAACCACAGTCTCAGTTCTCACATCAAAACCATCAAA
GTCAAATAACATGCCAGTACAAACGACGTTATGGGATTTTGACCAAGCTA
CTTCCACTTCATCAATCAATGAATTCGAATCTAAAGGTGGTCATGGTATG
ATGCAAATGCAATCTATCCAGGAAGAGAAACCTTACATTGATACTAAATC
ATCTTCCAAAGAAGTGACAGATGGTACGTACTGTACTTTGCCATCCATTT
GTGGAGCAAAAGAATTTCACTGACCAATACGATGCATCGTGTATTTGCTG
CACCAATGATGATAAAGTTCTCATTGGTTCATTGTATGGTAGCATCAGCA
TAATTGATCTCAAAGGTGGTACACATAATGTTTTACACAAATTTCCTTCA
AATGGAATCCCAATCAAAATGTTGTTTTCTGATGATAAGCAATTCTTGGT
GTCACTTGAATCTAAGCTTCAAGATTATCGTGTTGGATTATCAGCTAGGG
AAATGAACTGTCAAGCTAGAGTATATTCAAATATTATGCTTGGTAACCCA
CAGAAGAATGTTGCCCCTTTAAGTAGCGGGTATTCAATTAACCGACACAA
TAATAATCATACACGAAACAAGTTTTCTGTTATTGATTTTGCTGGTTTAC
GTCAACCTGCAACTGATATTGCCCTATGTAACTCTCGTCATAATGTTGCC
ATATCAAGTTCAAAGAAAATCTATCTTTACGCTTTCAAAGAAGTTATGTC
TGCTGATTTACCAGAGGATGATAGTGTCCTCACAATTGATTTCATACGCA
TGGTAGAAGTTGAAACCACTATCAATATAAGAAGTGTAGCTTTTTCATTA
AATTGGATTGCCTTTGCCTCCAAAACTGAAATTCGTGTTATTCAAGTTTA
TCTTCACCAACCATCAGATGAAAAGGTTTATCAAGGAGAAGACGTTTCTG
AACTTCTTGAGTGTTTTGATGAGGTTGGCAAGAGCGTTTTCACCAAAAGA
CTTTCTCAACATGTTACCGTCAGATATGAATGTTAATTTCATGTTACCTT
ACCTGGCTGAATGCAATGAATTTCATCGATCTTCGTCGCTCAAAAGTCAA
ATCTTACAAACTTATAAAACTCAAATCGAGATTCATGAAAACCTTTAATG
GCAACAACTTTTACAATGCTTGCTGGAGTACATCAGAGCGAATAAATTTG
AACCGTGGAACTATGATGTTTACATGGAAACACTGAAAGGCAGTTGATTA
TATCGTGGCGAATTACCCGGCGTTGATCCTACAGTATGCCAAAGATATGT
TCGATTGGAAAGCTCAGTCATTGCTGTGTTCAAGATACAACCGAAAGGAG
TTCAGTTTACATGTCATCGAGAAATTGAAAGATTCAGATTTTGTTGGAAA
AGAAGCATTGTTGTTGCTGGCCTGGCCCAAAGCTGGAATGGCTCAAGAGG
TGAATCACCTTCTCCGCAAGACTGTATCATCCTCAAAAACAATCAAAAGT
CACGTTCAAATGACACTAGTGGTGGTACAGGACGAAAACAAAACGATCAA
CAAAGCATGGCTTTATCCTTACCAAGTACTGGATTGACCACCAGTAATCC
TTCGTCACCATCCAGATCAAAGATTCTTTCACCATCATCGATGGATGACA
CAAATCATGAAACATCCAAAATCTTGAAATCAAGAGAATTTTGTCCGTGT
TGCTGTTGCAGTGAAATATTGATCAAATTTCAGATCAAAGGCAATGGGCA
TTATGGTACACGCTTCACTTGGCTCAATAAGTTAAAACCATTTTCAGGTG
ATCTTAGTGGACCAGTACTTACTGCGCATGACAAAGAAAATGAATACTAA
TGATGGTTGGAAAATCAAACATAACCACGAGATTCATCTCGTCGAAAGAG
CTTCCAAGAAATTGCGGCAAAAGGAAAGGCTGAAGACAATGAGAAAAGAA
TTCCACTTGATCGACAAGCTTGTCAAATACTTGAAAATCTTCTAAATGTT
AATGAAGAAGCATTTCAAAGAGAGTTTCCAGAGCATTGTAATTTCTCTGT
TCGATACACGCACAATCGACTTGAATAATATCCTTCAAATATTCCAGGAC
GATTTGCTAAAGATTTGTATTTCAAATACTGAAGTGTTATTCAACTCACA
ATATCAATTGACGCCCATGGGACAGACTACAACCACTGGACAGCTTATGT
TTTGCTTACTTGCACATGGACTTGGGGAACCCAGGGCACGCGGAAGAGCT
TTTGAAAGAACTGGAAAAGATTTATGTGTCAAACTGATGAGCAAATACAA
GCGGAAAAAAGAATCAAAAGAACAGAGAATATTTGTGATTTCATCATCAA
TGTGTATGGCAAGAATCATCCATCAATGCTAGCAAAAGTGATCTTAAAAT
CCAATCTACCTCGTCTCTATTCAATTGAAACACAGTTTTGGAACTGGAAT
GATTGAATATCTGAACAATACTCTATTCGGCAAAGAACAAGTACAATTCG
ATAAGATGTGAACCAAGTTTTGATTTCACCAGCGTCAAAGGGTACTTCGA
AATGGCTGGAATGCAACCTACAGCCGTCCTTGAACACATGAACAATGAAA
ACATAAGACTCGAGCGAAAGAGAGAAGGGCGGCGCAACATCATCACCATG
GAGTGTATGCAGCTTCGAAAAACACATCTCAACGGATGTGGGTCAAAAGA
TTACCAAACTAATTGAAGAAAGTGAATTTTCGAATCCCATGGTGTATTAT
CATTTACTGTGTGAATCACATCTTTTACTTTGTTGTGATTTGATGAGCAG
ACCAAACGATGAAATTTTGATCAAAGCATTGAAATCATCAGCCGTCTCAC
TTGCAACCTTCTTAATGAGACTTGTCCACCGAAGGATCTGGAAACTTGTT
TGGTTGGTATGTATCCATACCAAGATGTTGTTTGTGTGGCAACTAGTATG
TCCTTCGTCCTCATGTTCATCAAAGTCCCTAAAAGAACAAACAGCTGGTA
AATCAAAACAACCTTATCGTGCTCGAGATCGTGGACCAACAGAGATCTTC
CTGGAAACCAATTACTTCATGGATTACGTGTCTGTCAATAAAGATCTCTC
CATGATCGAAGATGGTGGACTGGGCCCTAGTAATGATATTGAGCCAAGAA
AAAGAACCCATTCTTCGGCCTATGATAGATACCCATATCAATGGCTTTTA
AAGATATCGCTGAACACAAACAATTGGAAGTTGAGGAGAAAATGCCATGG
CCTTGGAATGCTTTCTTAAAACCACACTCCTTCCCAGTTCTCCTCTCCAT
GCCTCTTTTTTTCTCAACTGGAACACATGGTTACCTCTACGACACGTGGA
ACTCAAAAGGACTCATCTTAGACTACAGTTACACGTCAGATTGTTTGAGT
GCCAAACATACAAATTCACTTCTATACACTGTCACCAGTAATGGATTGGA
GATTTTCACTTCTCGCCTTTATCCCTTTGTTTCTGGATGTACAAAAGAAA
TGTTTAAAGAATGCAAGTTTTCCAAAAATGCCGAAATAGCTAATAAAGGT
GAACATACAATCCTTGTTGGTCACCCACTATGTTGCTCGTTCCTTGGACA
GATGCCCACCAAAGAAGGTCACGTCAATTATGCCACAGTCACCAGTACTA
CACATCTGTATCGAAGATTTGAGGAGGATGATATCTCTTTCTCGGGAAAC
ACTGAAAGAATACATAGTCTACAATGGCTGCCTATCTTTTTGGAAGTGAC
TCAACAACCCAAACAGACGGTCTTGAGAAAACCACAGTCTCAGTTCTCAC
ATCAAAACCATCAAAGTCAAATAACATGCCAGTACAAACGACGTTATGGG
ATTTTGACCAAGCTACTTCCACTTCATCAATCAATGAATTCGAATCTAAA
GGTGGTCATGGTATGATGCAAATGCAATCTATCCAGGAAGAGAAACCTTA
CATTGATACTAAATCATCTTCCAAAGAAGTGACAGATGGTACGTACTGTA
CTTTGCCATCCATTTGTGGAGCAAAAGAATTTCACTGACCAATACGATGC
ATCGTGTATTTGCTGCACCAATGATGATAAAGTTCTCATTGGTTCATTGT
ATGGTAGCATCAGCATAATTGATCTCAAAGGTGGTACACATAATGTTTTA
CACAAATTTCCTTCAAATGGAATCCCAATCAAAATGTTGTTTTCTGATGA
TAAGCAATTCTTGGTGTCACTTGAATCTAAGCTTCAAGATTATCGTGTTG
GATTATCAGCTAGGGAAATGAACTGTCAAGCTAGAGTATATTCAAATATT
ATGCTTGGTAACCCACAGAAGAATGTTGCCCCTTTAAGTAGCGGGTATTC
AATTAACCGACACAATAATAATCATACACGAAACAAGTTTTCTGTTATTG
ATTTTGCTGGTTTACGTCAACCTGCAACTGATATTGCCCTATGTAACTCT
CGTCATAATGTTGCCATATCAAGTTCAAAGAAAATCTATCTTTACGCTTT
CAAAGAAGTTATGTCTGCTGATTTACCAGAGGATGATAGTGTCCTCACAA
TTGATTTCATACGCATGGTAGAAGTTGAAACCACTATCAATATAAGAAGT
GTAGCTTTTTCATTAAATTGGATTGCCTTTGCCTCCAAAACTGAAATTCG
TGTTATTCAAGTTTATCTTCACCAACCATCAGATGAAAAGGTTTATCAAG
GAGAAGACGTTTCTGAACTTCTTGAGTGTTTTGATGAGGTTGGCAAGAGC
GTTTTCACCAAAAGACTTTCTCAACATGTTACCGTCAGATATGAATGTTA
ATTTCATGTTACCTTACCTGGCTGAATGCAATGAATTTCATCGATCTTCG
TCGCTCAAAAGTCAAATCTTACAAACTTATAAAACTCAAATCGAGATTCA
TGAAAACCTTTAATGGCAACAACTTTTACAATGCTTGCTGGAGTACATCA
GAGCGAATAAATTTGAACCGTGGAACTATGATGTTTACATGGAAACACTG
AAAGGCAGTTGATTATATCGTGGCGAATTACCCGGCGTTGATCCTACAGT
ATGCCAAAGATATGTTCGATTGGAAAGCTCAGTCATTGCTGTGTTCAAGA
TACAACCGAAAGGAGTTCAGTTTACATGTCATCGAGAAATTGAAAGATTC
AGATTTTGTTGGAAAAGAAGCATTGTTGTTGCTGGCCTGGCCCAAAGCTG
GAATGGCTCAAGAGGTGAATCACCTTCTCCGCAAGACTGTATCATCCTCA
AAAACAATCAAAAGTCACGTTCAAATGACACTAGTGGTGGTACAGGACGA
AAACAAAACGATCAACAAAGCATGGCTTTATCCTTACCAAGTACTGGATT
GACCACCAGTAATCCTTCGTCACCATCCAGATCAAAGATTCTTTCACCAT
CATCGATGGATGACACAAATCATGAAACATCCAAAATCTTGAAATCAAGA
GAATTTTGTCCGTGTTGCTGTTGCAGTGAAATATTGATCAAATTTCAGAT
CAAAGGCAATGGGCATTATGGTACACGCTTCACTTGGCTCAATAAGTTAA
AACCATTTTCAGGTGATCTTAGTGGACCAGTACTTACTGCGCATGACAAA
GAAAATGAATACTAATGATGGTTGGAAAATCAAACATAACCACGAGATTC
ATCTCGTCGAAAGAGCTTCCAAGAAATTGCGGCAAAAGGAAAGGCTGAAG
ACAATGAGAAAAGAATTCCACTTGATCGACAAGCTTGTCAAATACTTGAA
AATCTTCTAAATGTTAATGAAGAAGCATTTCAAAGAGAGTTTCCAGAGCA
TTGTAATTTCTCTGTTCGATACACGCACAATCGACTTGAATAATATCCTT
CAAATATTCCAGGACGATTTGCTAAAGATTTGTATTTCAAATACTGAAGT
GTTATTCAACTCACAATATCAATTGACGCCCATGGGACAGACTACAACCA
CTGGACAGCTTATGTTTTGCTTACTTGCACATGGACTTGGGGAACCCAGG
GCACGCGGAAGAGCTTTTGAAAGAACTGGAAAAGATTTATGTGTCAAACT
GATGAGCAAATACAAGCGGAAAAAAGAATCAAAAGAACAGAGAATATTTG
TGATTTCATCATCAATGTGTATGGCAAGAATCATCCATCAATGCTAGCAA
AAGTGATCTTAAAATCCAATCTACCTCGTCTCTATTCAATTGAAACACAG
TTTTGGAACTGGAATGATTGAATATCTGAACAATACTCTATTCGGCAAAG
AACAAGTACAATTCGATAAGATGTGAACCAAGTTTTGATTTCACCAGCGT
CAAAGGGTACTTCGAAATGGCTGGAATGCAACCTACAGCCGTCCTTGAAC
ACATGAACAATGAAAACATAAGACTCGAGCGAAAGAGAGAAGGGCGGCGC
AACATCATCACCATGGAGTGTATGCAGCTTCGAAAAACACATCTCAACGG
ATGTGGGTCAAAAGATTACCAAACTAATTGAAGAAAGTGAATTTTCGAAT
CCCATGGTGTATTATCATTTACTGTGTGAATCACATCTTTTACTTTGTTG
TGATTTGATGAGCAGACCAAACGATGAAATTTTGATCAAAGCATTGAAAT
CATCAGCCGTCTCACTTGCAACCTTCTTAATGAGACTTGTCCACCGAAGG
ATCTGGAAACTTGTTTGGTTGGTATGTATCCATACCAAGATGTTGTTTGT
GTGGCAACTAGTATGTCCTTCGTCCTCATGTTCATCAAAGTCCCTAAAAG
AACAAACAGCTGGTAAATCAAAACAACCTTATCGTGCTCGAGATCGTGGA
CCAACAGAGATCTTCCTGGAAACCAATTACTTCATGGATTACGTGTCTGT
CAATAAAGATCTCTCCATGATCGAAGATGGTGGACTGGGCCCTAGTAATG
ATATTGAGCCAAGAAAAAGAACCCATTCTTCGGCCTATGATAGATACCCA
TATCAATGGCTTTTAAAGATATCGCTGAACACAAACAATTGGAAGTTGAG
GAGAAAATGCCATGGCCTTGGAATGCTTTCTTAAAACCACACTCCTTCCC
AGTTCTCCTCTCCATGCCTCTTTTTTTCTCAACTGGAACACATGGTTACC
TCTACGACACGTGGAACTCAAAAGGACTCATCTTAGACTACAGTTACACG
TCAGATTGTTTGAGTGCCAAACATACAAATTCACTTCTATACACTGTCAC
CAGTAATGGATTGGAGATTTTCACTTCTCGCCTTTATCCCTTTGTTTCTG
GATGTACAAAAGAAATGTTTAAAGAATGCAAGTTTTCCAAAAATGCCGAA
ATAGCTAATAAAGGTGAACATACAATCCTTGTTGGTCACCCACTATGTTG
CTCGTTCCTTGGACAGATGCCCACCAAAGAAGGTCACGTCAATTATGCCA
CAGTCACCAGTACTACACATCTGTATCGAAGATTTGAGGAGGATGATATC
TCTTTCTCGGGAAACACTGAAAGAATACATAGTCTACAATGGCTGCCTAT
CTTTTTGGAAGTGACTCAACAACCCAAACAGACGGTCTTGAGAAAACCAC
AGTCTCAGTTCTCACATCAAAACCATCAAAGTCAAATAACATGCCAGTAC
AAACGACGTTATGGGATTTTGACCAAGCTACTTCCACTTCATCAATCAAT
GAATTCGAATCTAAAGGTGGTCATGGTATGATGCAAATGCAATCTATCCA
GGAAGAGAAACCTTACATTGATACTAAATCATCTTCCAAAGAAGTGACAG
ATGGTACGTACTGTACTTTGCCATCCATTTGTGGAGCAAAAGAATTTCAC
TGACCAATACGATGCATCGTGTATTTGCTGCACCAATGATGATAAAGTTC
TCATTGGTTCATTGTATGGTAGCATCAGCATAATTGATCTCAAAGGTGGT
ACACATAATGTTTTACACAAATTTCCTTCAAATGGAATCCCAATCAAAAT
GTTGTTTTCTGATGATAAGCAATTCTTGGTGTCACTTGAATCTAAGCTTC
AAGATTATCGTGTTGGATTATCAGCTAGGGAAATGAACTGTCAAGCTAGA
GTATATTCAAATATTATGCTTGGTAACCCACAGAAGAATGTTGCCCCTTT
AAGTAGCGGGTATTCAATTAACCGACACAATAATAATCATACACGAAACA
AGTTTTCTGTTATTGATTTTGCTGGTTTACGTCAACCTGCAACTGATATT
GCCCTATGTAACTCTCGTCATAATGTTGCCATATCAAGTTCAAAGAAAAT
CTATCTTTACGCTTTCAAAGAAGTTATGTCTGCTGATTTACCAGAGGATG
ATAGTGTCCTCACAATTGATTTCATACGCATGGTAGAAGTTGAAACCACT
ATCAATATAAGAAGTGTAGCTTTTTCATTAAATTGGATTGCCTTTGCCTC
CAAAACTGAAATTCGTGTTATTCAAGTTTATCTTCACCAACCATCAGATG
AAAAGGTTTATCAAGGAGAAGACGTTTCTGAACTTCTTGAGTGTTTTGAT
GAGGTTGGCAAGAGCGTTTTCACCAAAAGACTTTCTCAACATGTTACCGT
CAGATATGAATGTTAATTTCATGTTACCTTACCTGGCTGAATGCAATGAA
TTTCATCGATCTTCGTCGCTCAAAAGTCAAATCTTACAAACTTATAAAAC
TCAAATCGAGATTCATGAAAACCTTTAATGGCAACAACTTTTACAATGCT
TGCTGGAGTACATCAGAGCGAATAAATTTGAACCGTGGAACTATGATGTT
TACATGGAAACACTGAAAGGCAGTTGATTATATCGTGGCGAATTACCCGG
CGTTGATCCTACAGTATGCCAAAGATATGTTCGATTGGAAAGCTCAGTCA
TTGCTGTGTTCAAGATACAACCGAAAGGAGTTCAGTTTACATGTCATCGA
GAAATTGAAAGATTCAGATTTTGTTGGAAAAGAAGCATTGTTGTTGCTGG
CCTGGCCCAAAGCTGGAATGGCTCAAGAGGTGAATCACCTTCTCCGCAAG
ACTGTATCATCCTCAAAAACAATCAAAAGTCACGTTCAAATGACACTAGT
GGTGGTACAGGACGAAAACAAAACGATCAACAAAGCATGGCTTTATCCTT
ACCAAGTACTGGATTGACCACCAGTAATCCTTCGTCACCATCCAGATCAA
AGATTCTTTCACCATCATCGATGGATGACACAAATCATGAAACATCCAAA
ATCTTGAAATCAAGAGAATTTTGTCCGTGTTGCTGTTGCAGTGAAATATT
GATCAAATTTCAGATCAAAGGCAATGGGCATTATGGTACACGCTTCACTT
GGCTCAATAAGTTAAAACCATTTTCAGGTGATCTTAGTGGACCAGTACTT
ACTGCGCATGACAAAGAAAATGAATACTAATGATGGTTGGAAAATCAAAC
ATAACCACGAGATTCATCTCGTCGAAAGAGCTTCCAAGAAATTGCGGCAA
AAGGAAAGGCTGAAGACAATGAGAAAAGAATTCCACTTGATCGACAAGCT
TGTCAAATACTTGAAAATCTTCTAAATGTTAATGAAGAAGCATTTCAAAG
AGAGTTTCCAGAGCATTGTAATTTCTCTGTTCGATACACGCACAATCGAC
TTGAATAATATCCTTCAAATATTCCAGGACGATTTGCTAAAGATTTGTAT
TTCAAATACTGAAGTGTTATTCAACTCACAATATCAATTGACGCCCATGG
GACAGACTACAACCACTGGACAGCTTATGTTTTGCTTACTTGCACATGGA
CTTGGGGAACCCAGGGCACGCGGAAGAGCTTTTGAAAGAACTGGAAAAGA
TTTATGTGTCAAACTGATGAGCAAATACAAGCGGAAAAAAGAATCAAAAG
AACAGAGAATATTTGTGATTTCATCATCAATGTGTATGGCAAGAATCATC
CATCAATGCTAGCAAAAGTGATCTTAAAATCCAATCTACCTCGTCTCTAT
TCAATTGAAACACAGTTTTGGAACTGGAATGATTGAATATCTGAACAATA
CTCTATTCGGCAAAGAACAAGTACAATTCGATAAGATGTGAACCAAGTTT
TGATTTCACCAGCGTCAAAGGGTACTTCGAAATGGCTGGAATGCAACCTA
CAGCCGTCCTTGAACACATGAACAATGAAAACATAAGACTCGAGCGAAAG
AGAGAAGGGCGGCGCAACATCATCACCATGGAGTGTATGCAGCTTCGAAA
AACACATCTCAACGGATGTGGGTCAAAAGATTACCAAACTAATTGAAGAA
AGTGAATTTTCGAATCCCATGGTGTATTATCATTTACTGTGTGAATCACA
TCTTTTACTTTGTTGTGATTTGATGAGCAGACCAAACGATGAAATTTTGA
TCAAAGCATTGAAATCATCAGCCGTCTCACTTGCAACCTTCTTAATGAGA
CTTGTCCACCGAAGGATCTGGAAACTTGTTTGGTTGGTATGTATCCATAC
CAAGATGTTGTTTGTGTGGCAACTAGTATGTCCTTCGTCCTCATGTTCAT
CAAAGTCCCTAAAAGAACAAACAGCTGGTAAATCAAAACAACCTTATCGT
GCTCGAGATCGTGGACCAACAGAGATCTTCCTGGAAACCAATTACTTCAT
GGATTACGTGTCTGTCAATAAAGATCTCTCCATGATCGAAGATGGTGGAC
TGGGCCCTAGTAATGATATTGAGCCAAGAAAAAGAACCCATTCTTCGGCC
TATGATAGATACCCATATCAATGGCTTTTAAAGATATCGCTGAACACAAA
CAATTGGAAGTTGAGGAGAAAATGCCATGGCCTTGGAATGCTTTCTTAAA
ACCACACTCCTTCCCAGTTCTCCTCTCCATGCCTCTTTTTTTCTCAACTG
GAACACATGGTTACCTCTACGACACGTGGAACTCAAAAGGACTCATCTTA
GACTACAGTTACACGTCAGATTGTTTGAGTGCCAAACATACAAATTCACT
TCTATACACTGTCACCAGTAATGGATTGGAGATTTTCACTTCTCGCCTTT
ATCCCTTTGTTTCTGGATGTACAAAAGAAATGTTTAAAGAATGCAAGTTT
TCCAAAAATGCCGAAATAGCTAATAAAGGTGAACATACAATCCTTGTTGG
TCACCCACTATGTTGCTCGTTCCTTGGACAGATGCCCACCAAAGAAGGTC
ACGTCAATTATGCCACAGTCACCAGTACTACACATCTGTATCGAAGATTT
GAGGAGGATGATATCTCTTTCTCGGGAAACACTGAAAGAATACATAGTCT
ACAATGGCTGCCTATCTTTTTGGAAGTGACTCAACAACCCAAACAGACGG
TCTTGAGAAAACCACAGTCTCAGTTCTCACATCAAAACCATCAAAGTCAA
ATAACATGCCAGTACAAACGACGTTATGGGATTTTGACCAAGCTACTTCC
ACTTCATCAATCAATGAATTCGAATCTAAAGGTGGTCATGGTATGATGCA
AATGCAATCTATCCAGGAAGAGAAACCTTACATTGATACTAAATCATCTT
CCAAAGAAGTGACAGATGGTACGTACTGTACTTTGCCATCCATTTGTGGA
GCAAAAGAATTTCACTGACCAATACGATGCATCGTGTATTTGCTGCACCA
ATGATGATAAAGTTCTCATTGGTTCATTGTATGGTAGCATCAGCATAATT
GATCTCAAAGGTGGTACACATAATGTTTTACACAAATTTCCTTCAAATGG
AATCCCAATCAAAATGTTGTTTTCTGATGATAAGCAATTCTTGGTGTCAC
TTGAATCTAAGCTTCAAGATTATCGTGTTGGATTATCAGCTAGGGAAATG
AACTGTCAAGCTAGAGTATATTCAAATATTATGCTTGGTAACCCACAGAA
GAATGTTGCCCCTTTAAGTAGCGGGTATTCAATTAACCGACACAATAATA
ATCATACACGAAACAAGTTTTCTGTTATTGATTTTGCTGGTTTACGTCAA
CCTGCAACTGATATTGCCCTATGTAACTCTCGTCATAATGTTGCCATATC
AAGTTCAAAGAAAATCTATCTTTACGCTTTCAAAGAAGTTATGTCTGCTG
ATTTACCAGAGGATGATAGTGTCCTCACAATTGATTTCATACGCATGGTA
GAAGTTGAAACCACTATCAATATAAGAAGTGTAGCTTTTTCATTAAATTG
GATTGCCTTTGCCTCCAAAACTGAAATTCGTGTTATTCAAGTTTATCTTC
ACCAACCATCAGATGAAAAGGTTTATCAAGGAGAAGACGTTTCTGAACTT
CTTGAGTGTTTTGATGAGGTTGGCAAGAGCGTTTTCACCAAAAGACTTTC
TCAACATGTTACCGTCAGATATGAATGTTAATTTCATGTTACCTTACCTG
GCTGAATGCAATGAATTTCATCGATCTTCGTCGCTCAAAAGTCAAATCTT
ACAAACTTATAAAACTCAAATCGAGATTCATGAAAACCTTTAATGGCAAC
AACTTTTACAATGCTTGCTGGAGTACATCAGAGCGAATAAATTTGAACCG
TGGAACTATGATGTTTACATGGAAACACTGAAAGGCAGTTGATTATATCG
TGGCGAATTACCCGGCGTTGATCCTACAGTATGCCAAAGATATGTTCGAT
TGGAAAGCTCAGTCATTGCTGTGTTCAAGATACAACCGAAAGGAGTTCAG
TTTACATGTCATCGAGAAATTGAAAGATTCAGATTTTGTTGGAAAAGAAG
CATTGTTGTTGCTGGCCTGGCCCAAAGCTGGAATGGCTCAAGAGGTGAAT
CACCTTCTCCGCAAGACTGTATCATCCTCAAAAACAATCAAAAGTCACGT
TCAAATGACACTAGTGGTGGTACAGGACGAAAACAAAACGATCAACAAAG
CATGGCTTTATCCTTACCAAGTACTGGATTGACCACCAGTAATCCTTCGT
CACCATCCAGATCAAAGATTCTTTCACCATCATCGATGGATGACACAAAT
CATGAAACATCCAAAATCTTGAAATCAAGAGAATTTTGTCCGTGTTGCTG
TTGCAGTGAAATATTGATCAAATTTCAGATCAAAGGCAATGGGCATTATG
GTACACGCTTCACTTGGCTCAATAAGTTAAAACCATTTTCAGGTGATCTT
AGTGGACCAGTACTTACTGCGCATGACAAAGAAAATGAATACTAATGATG
GTTGGAAAATCAAACATAACCACGAGATTCATCTCGTCGAAAGAGCTTCC
AAGAAATTGCGGCAAAAGGAAAGGCTGAAGACAATGAGAAAAGAATTCCA
CTTGATCGACAAGCTTGTCAAATACTTGAAAATCTTCTAAATGTTAATGA
AGAAGCATTTCAAAGAGAGTTTCCAGAGCATTGTAATTTCTCTGTTCGAT
ACACGCACAATCGACTTGAATAATATCCTTCAAATATTCCAGGACGATTT
GCTAAAGATTTGTATTTCAAATACTGAAGTGTTATTCAACTCACAATATC
AATTGACGCCCATGGGACAGACTACAACCACTGGACAGCTTATGTTTTGC
TTACTTGCACATGGACTTGGGGAACCCAGGGCACGCGGAAGAGCTTTTGA
AAGAACTGGAAAAGATTTATGTGTCAAACTGATGAGCAAATACAAGCGGA
AAAAAGAATCAAAAGAACAGAGAATATTTGTGATTTCATCATCAATGTGT
ATGGCAAGAATCATCCATCAATGCTAGCAAAAGTGATCTTAAAATCCAAT
CTACCTCGTCTCTATTCAATTGAAACACAGTTTTGGAACTGGAATGATTG
AATATCTGAACAATACTCTATTCGGCAAAGAACAAGTACAATTCGATAAG
ATGTGAACCAAGTTTTGATTTCACCAGCGTCAAAGGGTACTTCGAAATGG
CTGGAATGCAACCTACAGCCGTCCTTGAACACATGAACAATGAAAACATA
AGACTCGAGCGAAAGAGAGAAGGGCGGCGCAACATCATCACCATGGAGTG
TATGCAGCTTCGAAAAACACATCTCAACGGATGTGGGTCAAAAGATTACC
AAACTAATTGAAGAAAGTGAATTTTCGAATCCCATGGTGTATTATCATTT
ACTGTGTGAATCACATCTTTTACTTTGTTGTGATTTGATGAGCAGACCAA
ACGATGAAATTTTGATCAAAGCATTGAAATCATCAGCCGTCTCACTTGCA
ACCTTCTTAATGAGACTTGTCCACCGAAGGATCTGGAAACTTGTTTGGTT
GGTATGTATCCATACCAAGATGTTGTTTGTGTGGCAACTAGTATGTCCTT
CGTCCTCATGTTCATCAAAGTCCCTAAAAGAACAAACAGCTGGTAAATCA
AAACAACCTTATCGTGCTCGAGATCGTGGACCAACAGAGATCTTCCTGGA
AACCAATTACTTCATGGATTACGTGTCTGTCAATAAAGATCTCTCCATGA
TCGAAGATGGTGGACTGGGCCCTAGTAATGATATTGAGCCAAGAAAAAGA
ACCCATTCTTCGGCCTATGATAGATACCCATATCAATGGCTTTTAAAGAT
ATCGCTGAACACAAACAATTGGAAGTTGAGGAGAAAATGCCATGGCCTTG
GAATGCTTTCTTAAAACCACACTCCTTCCCAGTTCTCCTCTCCATGCCTC
TTTTTTTCTCAACTGGAACACATGGTTACCTCTACGACACGTGGAACTCA
AAAGGACTCATCTTAGACTACAGTTACACGTCAGATTGTTTGAGTGCCAA
ACATACAAATTCACTTCTATACACTGTCACCAGTAATGGATTGGAGATTT
TCACTTCTCGCCTTTATCCCTTTGTTTCTGGATGTACAAAAGAAATGTTT
AAAGAATGCAAGTTTTCCAAAAATGCCGAAATAGCTAATAAAGGTGAACA
TACAATCCTTGTTGGTCACCCACTATGTTGCTCGTTCCTTGGACAGATGC
CCACCAAAGAAGGTCACGTCAATTATGCCACAGTCACCAGTACTACACAT
CTGTATCGAAGATTTGAGGAGGATGATATCTCTTTCTCGGGAAACACTGA
AAGAATACATAGTCTACAATGGCTGCCTATCTTTTTGGAAGTGACTCAAC
AACCCAAACAGACGGTCTTGAGAAAACCACAGTCTCAGTTCTCACATCAA
AACCATCAAAGTCAAATAACATGCCAGTACAAACGACGTTATGGGATTTT
GACCAAGCTACTTCCACTTCATCAATCAATGAATTCGAATCTAAAGGTGG
TCATGGTATGATGCAAATGCAATCTATCCAGGAAGAGAAACCTTACATTG
ATACTAAATCATCTTCCAAAGAAGTGACAGATGGTACGTACTGTACTTTG
CCATCCATTTGTGGAGCAAAAGAATTTCACTGACCAATACGATGCATCGT
GTATTTGCTGCACCAATGATGATAAAGTTCTCATTGGTTCATTGTATGGT
AGCATCAGCATAATTGATCTCAAAGGTGGTACACATAATGTTTTACACAA
ATTTCCTTCAAATGGAATCCCAATCAAAATGTTGTTTTCTGATGATAAGC
AATTCTTGGTGTCACTTGAATCTAAGCTTCAAGATTATCGTGTTGGATTA
TCAGCTAGGGAAATGAACTGTCAAGCTAGAGTATATTCAAATATTATGCT
TGGTAACCCACAGAAGAATGTTGCCCCTTTAAGTAGCGGGTATTCAATTA
ACCGACACAATAATAATCATACACGAAACAAGTTTTCTGTTATTGATTTT
GCTGGTTTACGTCAACCTGCAACTGATATTGCCCTATGTAACTCTCGTCA
TAATGTTGCCATATCAAGTTCAAAGAAAATCTATCTTTACGCTTTCAAAG
AAGTTATGTCTGCTGATTTACCAGAGGATGATAGTGTCCTCACAATTGAT
TTCATACGCATGGTAGAAGTTGAAACCACTATCAATATAAGAAGTGTAGC
TTTTTCATTAAATTGGATTGCCTTTGCCTCCAAAACTGAAATTCGTGTTA
TTCAAGTTTATCTTCACCAACCATCAGATGAAAAGGTTTATCAAGGAGAA
GACGTTTCTGAACTTCTTGAGTGTTTTGATGAGGTTGGCAAGAGCGTTTT
CACCAAAAGACTTTCTCAACATGTTACCGTCAGATATGAATGTTAATTTC
ATGTTACCTTACCTGGCTGAATGCAATGAATTTCATCGATCTTCGTCGCT
CAAAAGTCAAATCTTACAAACTTATAAAACTCAAATCGAGATTCATGAAA
ACCTTTAATGGCAACAACTTTTACAATGCTTGCTGGAGTACATCAGAGCG
AATAAATTTGAACCGTGGAACTATGATGTTTACATGGAAACACTGAAAGG
CAGTTGATTATATCGTGGCGAATTACCCGGCGTTGATCCTACAGTATGCC
AAAGATATGTTCGATTGGAAAGCTCAGTCATTGCTGTGTTCAAGATACAA
CCGAAAGGAGTTCAGTTTACATGTCATCGAGAAATTGAAAGATTCAGATT
TTGTTGGAAAAGAAGCATTGTTGTTGCTGGCCTGGCCCAAAGCTGGAATG
GCTCAAGAGGTGAATCACCTTCTCCGCAAGACTGTATCATCCTCAAAAAC
AATCAAAAGTCACGTTCAAATGACACTAGTGGTGGTACAGGACGAAAACA
AAACGATCAACAAAGCATGGCTTTATCCTTACCAAGTACTGGATTGACCA
CCAGTAATCCTTCGTCACCATCCAGATCAAAGATTCTTTCACCATCATCG
ATGGATGACACAAATCATGAAACATCCAAAATCTTGAAATCAAGAGAATT
TTGTCCGTGTTGCTGTTGCAGTGAAATATTGATCAAATTTCAGATCAAAG
GCAATGGGCATTATGGTACACGCTTCACTTGGCTCAATAAGTTAAAACCA
TTTTCAGGTGATCTTAGTGGACCAGTACTTACTGCGCATGACAAAGAAAA
TGAATACTAATGATGGTTGGAAAATCAAACATAACCACGAGATTCATCTC
GTCGAAAGAGCTTCCAAGAAATTGCGGCAAAAGGAAAGGCTGAAGACAAT
GAGAAAAGAATTCCACTTGATCGACAAGCTTGTCAAATACTTGAAAATCT
TCTAAATGTTAATGAAGAAGCATTTCAAAGAGAGTTTCCAGAGCATTGTA
ATTTCTCTGTTCGATACACGCACAATCGACTTGAATAATATCCTTCAAAT
ATTCCAGGACGATTTGCTAAAGATTTGTATTTCAAATACTGAAGTGTTAT
TCAACTCACAATATCAATTGACGCCCATGGGACAGACTACAACCACTGGA
CAGCTTATGTTTTGCTTACTTGCACATGGACTTGGGGAACCCAGGGCACG
CGGAAGAGCTTTTGAAAGAACTGGAAAAGATTTATGTGTCAAACTGATGA
GCAAATACAAGCGGAAAAAAGAATCAAAAGAACAGAGAATATTTGTGATT
TCATCATCAATGTGTATGGCAAGAATCATCCATCAATGCTAGCAAAAGTG
ATCTTAAAATCCAATCTACCTCGTCTCTATTCAATTGAAACACAGTTTTG
GAACTGGAATGATTGAATATCTGAACAATACTCTATTCGGCAAAGAACAA
GTACAATTCGATAAGATGTGAACCAAGTTTTGATTTCACCAGCGTCAAAG
GGTACTTCGAAATGGCTGGAATGCAACCTACAGCCGTCCTTGAACACATG
AACAATGAAAACATAAGACTCGAGCGAAAGAGAGAAGGGCGGCGCAACAT
CATCACCATGGAGTGTATGCAGCTTCGAAAAACACATCTCAACGGATGTG
GGTCAAAAGATTACCAAACTAATTGAAGAAAGTGAATTTTCGAATCCCAT
GGTGTATTATCATTTACTGTGTGAATCACATCTTTTACTTTGTTGTGATT
TGATGAGCAGACCAAACGATGAAATTTTGATCAAAGCATTGAAATCATCA
GCCGTCTCACTTGCAACCTTCTTAATGAGACTTGTCCACCGAAGGATCTG
GAAACTTGTTTGGTTGGTATGTATCCATACCAAGATGTTGTTTGTGTGGC
AACTAGTATGTCCTTCGTCCTCATGTTCATCAAAGTCCCTAAAAGAACAA
ACAGCTGGTAAATCAAAACAACCTTATCGTGCTCGAGATCGTGGACCAAC
AGAGATCTTCCTGGAAACCAATTACTTCATGGATTACGTGTCTGTCAATA
AAGATCTCTCCATGATCGAAGATGGTGGACTGGGCCCTAGTAATGATATT
GAGCCAAGAAAAAGAACCCATTCTTCGGCCTATGATAGATACCCATATCA
ATGGCTTTTAAAGATATCGCTGAACACAAACAATTGGAAGTTGAGGAGAA
AATGCCATGGCCTTGGAATGCTTTCTTAAAACCACACTCCTTCCCAGTTC
TCCTCTCCATGCCTCTTTTTTTCTCAACTGGAACACATGGTTACCTCTAC
GACACGTGGAACTCAAAAGGACTCATCTTAGACTACAGTTACACGTCAGA
TTGTTTGAGTGCCAAACATACAAATTCACTTCTATACACTGTCACCAGTA
ATGGATTGGAGATTTTCACTTCTCGCCTTTATCCCTTTGTTTCTGGATGT
ACAAAAGAAATGTTTAAAGAATGCAAGTTTTCCAAAAATGCCGAAATAGC
TAATAAAGGTGAACATACAATCCTTGTTGGTCACCCACTATGTTGCTCGT
TCCTTGGACAGATGCCCACCAAAGAAGGTCACGTCAATTATGCCACAGTC
ACCAGTACTACACATCTGTATCGAAGATTTGAGGAGGATGATATCTCTTT
CTCGGGAAACACTGAAAGAATACATAGTCTACAATGGCTGCCTATCTTTT
TGGAAGTGACTCAACAACCCAAACAGACGGTCTTGAGAAAACCACAGTCT
CAGTTCTCACATCAAAACCATCAAAGTCAAATAACATGCCAGTACAAACG
ACGTTATGGGATTTTGACCAAGCTACTTCCACTTCATCAATCAATGAATT
CGAATCTAAAGGTGGTCATGGTATGATGCAAATGCAATCTATCCAGGAAG
AGAAACCTTACATTGATACTAAATCATCTTCCAAAGAAGTGACAGATGGT
ACGTACTGTACTTTGCCATCCATTTGTGGAGCAAAAGAATTTCACTGACC
AATACGATGCATCGTGTATTTGCTGCACCAATGATGATAAAGTTCTCATT
GGTTCATTGTATGGTAGCATCAGCATAATTGATCTCAAAGGTGGTACACA
TAATGTTTTACACAAATTTCCTTCAAATGGAATCCCAATCAAAATGTTGT
TTTCTGATGATAAGCAATTCTTGGTGTCACTTGAATCTAAGCTTCAAGAT
TATCGTGTTGGATTATCAGCTAGGGAAATGAACTGTCAAGCTAGAGTATA
TTCAAATATTATGCTTGGTAACCCACAGAAGAATGTTGCCCCTTTAAGTA
GCGGGTATTCAATTAACCGACACAATAATAATCATACACGAAACAAGTTT
TCTGTTATTGATTTTGCTGGTTTACGTCAACCTGCAACTGATATTGCCCT
ATGTAACTCTCGTCATAATGTTGCCATATCAAGTTCAAAGAAAATCTATC
TTTACGCTTTCAAAGAAGTTATGTCTGCTGATTTACCAGAGGATGATAGT
GTCCTCACAATTGATTTCATACGCATGGTAGAAGTTGAAACCACTATCAA
TATAAGAAGTGTAGCTTTTTCATTAAATTGGATTGCCTTTGCCTCCAAAA
CTGAAATTCGTGTTATTCAAGTTTATCTTCACCAACCATCAGATGAAAAG
GTTTATCAAGGAGAAGACGTTTCTGAACTTCTTGAGTGTTTTGATGAGGT
TGGCAAGAGCGTTTTCACCAAAAGACTTTCTCAACATGTTACCGTCAGAT
ATGAATGTTAATTTCATGTTACCTTACCTGGCTGAATGCAATGAATTTCA
TCGATCTTCGTCGCTCAAAAGTCAAATCTTACAAACTTATAAAACTCAAA
TCGAGATTCATGAAAACCTTTAATGGCAACAACTTTTACAATGCTTGCTG
GAGTACATCAGAGCGAATAAATTTGAACCGTGGAACTATGATGTTTACAT
GGAAACACTGAAAGGCAGTTGATTATATCGTGGCGAATTACCCGGCGTTG
ATCCTACAGTATGCCAAAGATATGTTCGATTGGAAAGCTCAGTCATTGCT
GTGTTCAAGATACAACCGAAAGGAGTTCAGTTTACATGTCATCGAGAAAT
TGAAAGATTCAGATTTTGTTGGAAAAGAAGCATTGTTGTTGCTGGCCTGG
CCCAAAGCTGGAATGGCTCAAGAGGTGAATCACCTTCTCCGCAAGACTGT
ATCATCCTCAAAAACAATCAAAAGTCACGTTCAAATGACACTAGTGGTGG
TACAGGACGAAAACAAAACGATCAACAAAGCATGGCTTTATCCTTACCAA
GTACTGGATTGACCACCAGTAATCCTTCGTCACCATCCAGATCAAAGATT
CTTTCACCATCATCGATGGATGACACAAATCATGAAACATCCAAAATCTT
GAAATCAAGAGAATTTTGTCCGTGTTGCTGTTGCAGTGAAATATTGATCA
AATTTCAGATCAAAGGCAATGGGCATTATGGTACACGCTTCACTTGGCTC
AATAAGTTAAAACCATTTTCAGGTGATCTTAGTGGACCAGTACTTACTGC
GCATGACAAAGAAAATGAATACTAATGATGGTTGGAAAATCAAACATAAC
CACGAGATTCATCTCGTCGAAAGAGCTTCCAAGAAATTGCGGCAAAAGGA
AAGGCTGAAGACAATGAGAAAAGAATTCCACTTGATCGACAAGCTTGTCA
AATACTTGAAAATCTTCTAAATGTTAATGAAGAAGCATTTCAAAGAGAGT
TTCCAGAGCATTGTAATTTCTCTGTTCGATACACGCACAATCGACTTGAA
TAATATCCTTCAAATATTCCAGGACGATTTGCTAAAGATTTGTATTTCAA
ATACTGAAGTGTTATTCAACTCACAATATCAATTGACGCCCATGGGACAG
ACTACAACCACTGGACAGCTTATGTTTTGCTTACTTGCACATGGACTTGG
GGAACCCAGGGCACGCGGAAGAGCTTTTGAAAGAACTGGAAAAGATTTAT
GTGTCAAACTGATGAGCAAATACAAGCGGAAAAAAGAATCAAAAGAACAG
AGAATATTTGTGATTTCATCATCAATGTGTATGGCAAGAATCATCCATCA
ATGCTAGCAAAAGTGATCTTAAAATCCAATCTACCTCGTCTCTATTCAAT
TGAAACACAGTTTTGGAACTGGAATGATTGAATATCTGAACAATACTCTA
TTCGGCAAAGAACAAGTACAATTCGATAAGATGTGAACCAAGTTTTGATT
TCACCAGCGTCAAAGGGTACTTCGAAATGGCTGGAATGCAACCTACAGCC
GTCCTTGAACACATGAACAATGAAAACATAAGACTCGAGCGAAAGAGAGA
AGGGCGGCGCAACATCATCACCATGGAGTGTATGCAGCTTCGAAAAACAC
ATCTCAACGGATGTGGGTCAAAAGATTACCAAACTAATTGAAGAAAGTGA
ATTTTCGAATCCCATGGTGTATTATCATTTACTGTGTGAATCACATCTTT
TACTTTGTTGTGATTTGATGAGCAGACCAAACGATGAAATTTTGATCAAA
GCATTGAAATCATCAGCCGTCTCACTTGCAACCTTCTTAATGAGACTTGT
CCACCGAAGGATCTGGAAACTTGTTTGGTTGGTATGTATCCATACCAAGA
TGTTGTTTGTGTGGCAACTAGTATGTCCTTCGTCCTCATGTTCATCAAAG
TCCCTAAAAGAACAAACAGCTGGTAAATCAAAACAACCTTATCGTGCTCG
AGATCGTGGACCAACAGAGATCTTCCTGGAAACCAATTACTTCATGGATT
ACGTGTCTGTCAATAAAGATCTCTCCATGATCGAAGATGGTGGACTGGGC
CCTAGTAATGATATTGAGCCAAGAAAAAGAACCCATTCTTCGGCCTATGA
TAGATACCCATATCAATGGCTTTTAAAGATATCGCTGAACACAAACAATT
GGAAGTTGAGGAGAAAATGCCATGGCCTTGGAATGCTTTCTTAAAACCAC
ACTCCTTCCCAGTTCTCCTCTCCATGCCTCTTTTTTTCTCAACTGGAACA
CATGGTTACCTCTACGACACGTGGAACTCAAAAGGACTCATCTTAGACTA
CAGTTACACGTCAGATTGTTTGAGTGCCAAACATACAAATTCACTTCTAT
ACACTGTCACCAGTAATGGATTGGAGATTTTCACTTCTCGCCTTTATCCC
TTTGTTTCTGGATGTACAAAAGAAATGTTTAAAGAATGCAAGTTTTCCAA
AAATGCCGAAATAGCTAATAAAGGTGAACATACAATCCTTGTTGGTCACC
CACTATGTTGCTCGTTCCTTGGACAGATGCCCACCAAAGAAGGTCACGTC
AATTATGCCACAGTCACCAGTACTACACATCTGTATCGAAGATTTGAGGA
GGATGATATCTCTTTCTCGGGAAACACTGAAAGAATACATAGTCTACAAT
GGCTGCCTATCTTTTTGGAAGTGACTCAACAACCCAAACAGACGGTCTTG
AGAAAACCACAGTCTCAGTTCTCACATCAAAACCATCAAAGTCAAATAAC
ATGCCAGTACAAACGACGTTATGGGATTTTGACCAAGCTACTTCCACTTC
ATCAATCAATGAATTCGAATCTAAAGGTGGTCATGGTATGATGCAAATGC
AATCTATCCAGGAAGAGAAACCTTACATTGATACTAAATCATCTTCCAAA
GAAGTGACAGATGGTACGTACTGTACTTTGCCATCCATTTGTGGAGCAAA
AGAATTTCACTGACCAATACGATGCATCGTGTATTTGCTGCACCAATGAT
GATAAAGTTCTCATTGGTTCATTGTATGGTAGCATCAGCATAATTGATCT
CAAAGGTGGTACACATAATGTTTTACACAAATTTCCTTCAAATGGAATCC
CAATCAAAATGTTGTTTTCTGATGATAAGCAATTCTTGGTGTCACTTGAA
TCTAAGCTTCAAGATTATCGTGTTGGATTATCAGCTAGGGAAATGAACTG
TCAAGCTAGAGTATATTCAAATATTATGCTTGGTAACCCACAGAAGAATG
TTGCCCCTTTAAGTAGCGGGTATTCAATTAACCGACACAATAATAATCAT
ACACGAAACAAGTTTTCTGTTATTGATTTTGCTGGTTTACGTCAACCTGC
AACTGATATTGCCCTATGTAACTCTCGTCATAATGTTGCCATATCAAGTT
CAAAGAAAATCTATCTTTACGCTTTCAAAGAAGTTATGTCTGCTGATTTA
CCAGAGGATGATAGTGTCCTCACAATTGATTTCATACGCATGGTAGAAGT
TGAAACCACTATCAATATAAGAAGTGTAGCTTTTTCATTAAATTGGATTG
CCTTTGCCTCCAAAACTGAAATTCGTGTTATTCAAGTTTATCTTCACCAA
CCATCAGATGAAAAGGTTTATCAAGGAGAAGACGTTTCTGAACTTCTTGA
GTGTTTTGATGAGGTTGGCAAGAGCGTTTTCACCAAAAGACTTTCTCAAC
ATGTTACCGTCAGATATGAATGTTAATTTCATGTTACCTTACCTGGCTGA
ATGCAATGAATTTCATCGATCTTCGTCGCTCAAAAGTCAAATCTTACAAA
CTTATAAAACTCAAATCGAGATTCATGAAAACCTTTAATGGCAACAACTT
TTACAATGCTTGCTGGAGTACATCAGAGCGAATAAATTTGAACCGTGGAA
CTATGATGTTTACATGGAAACACTGAAAGGCAGTTGATTATATCGTGGCG
AATTACCCGGCGTTGATCCTACAGTATGCCAAAGATATGTTCGATTGGAA
AGCTCAGTCATTGCTGTGTTCAAGATACAACCGAAAGGAGTTCAGTTTAC
ATGTCATCGAGAAATTGAAAGATTCAGATTTTGTTGGAAAAGAAGCATTG
TTGTTGCTGGCCTGGCCCAAAGCTGGAATGGCTCAAGAGGTGAATCACCT
TCTCCGCAAGACTGTATCATCCTCAAAAACAATCAAAAGTCACGTTCAAA
TGACACTAGTGGTGGTACAGGACGAAAACAAAACGATCAACAAAGCATGG
CTTTATCCTTACCAAGTACTGGATTGACCACCAGTAATCCTTCGTCACCA
TCCAGATCAAAGATTCTTTCACCATCATCGATGGATGACACAAATCATGA
AACATCCAAAATCTTGAAATCAAGAGAATTTTGTCCGTGTTGCTGTTGCA
GTGAAATATTGATCAAATTTCAGATCAAAGGCAATGGGCATTATGGTACA
CGCTTCACTTGGCTCAATAAGTTAAAACCATTTTCAGGTGATCTTAGTGG
ACCAGTACTTACTGCGCATGACAAAGAAAATGAATACTAATGATGGTTGG
AAAATCAAACATAACCACGAGATTCATCTCGTCGAAAGAGCTTCCAAGAA
ATTGCGGCAAAAGGAAAGGCTGAAGACAATGAGAAAAGAATTCCACTTGA
TCGACAAGCTTGTCAAATACTTGAAAATCTTCTAAATGTTAATGAAGAAG
CATTTCAAAGAGAGTTTCCAGAGCATTGTAATTTCTCTGTTCGATACACG
CACAATCGACTTGAATAATATCCTTCAAATATTCCAGGACGATTTGCTAA
AGATTTGTATTTCAAATACTGAAGTGTTATTCAACTCACAATATCAATTG
ACGCCCATGGGACAGACTACAACCACTGGACAGCTTATGTTTTGCTTACT
TGCACATGGACTTGGGGAACCCAGGGCACGCGGAAGAGCTTTTGAAAGAA
CTGGAAAAGATTTATGTGTCAAACTGATGAGCAAATACAAGCGGAAAAAA
GAATCAAAAGAACAGAGAATATTTGTGATTTCATCATCAATGTGTATGGC
AAGAATCATCCATCAATGCTAGCAAAAGTGATCTTAAAATCCAATCTACC
TCGTCTCTATTCAATTGAAACACAGTTTTGGAACTGGAATGATTGAATAT
CTGAACAATACTCTATTCGGCAAAGAACAAGTACAATTCGATAAGATGTG
AACCAAGTTTTGATTTCACCAGCGTCAAAGGGTACTTCGAAATGGCTGGA
ATGCAACCTACAGCCGTCCTTGAACACATGAACAATGAAAACATAAGACT
CGAGCGAAAGAGAGAAGGGCGGCGCAACATCATCACCATGGAGTGTATGC
AGCTTCGAAAAACACATCTCAACGGATGTGGGTCAAAAGATTACCAAACT
AATTGAAGAAAGTGAATTTTCGAATCCCATGGTGTATTATCATTTACTGT
GTGAATCACATCTTTTACTTTGTTGTGATTTGATGAGCAGACCAAACGAT
GAAATTTTGATCAAAGCATTGAAATCATCAGCCGTCTCACTTGCAACCTT
CTTAATGAGACTTGTCCACCGAAGGATCTGGAAACTTGTTTGGTTGGTAT
GTATCCATACCAAGATGTTGTTTGTGTGGCAACTAGTATGTCCTTCGTCC
TCATGTTCATCAAAGTCCCTAAAAGAACAAACAGCTGGTAAATCAAAACA
ACCTTATCGTGCTCGAGATCGTGGACCAACAGAGATCTTCCTGGAAACCA
ATTACTTCATGGATTACGTGTCTGTCAATAAAGATCTCTCCATGATCGAA
GATGGTGGACTGGGCCCTAGTAATGATATTGAGCCAAGAAAAAGAACCCA
TTCTTCGGCCTATGATAGATACCCATATCAATGGCTTTTAAAGATATCGC
TGAACACAAACAATTGGAAGTTGAGGAGAAAATGCCATGGCCTTGGAATG
CTTTCTTAAAACCACACTCCTTCCCAGTTCTCCTCTCCATGCCTCTTTTT
TTCTCAACTGGAACACATGGTTACCTCTACGACACGTGGAACTCAAAAGG
ACTCATCTTAGACTACAGTTACACGTCAGATTGTTTGAGTGCCAAACATA
CAAATTCACTTCTATACACTGTCACCAGTAATGGATTGGAGATTTTCACT
TCTCGCCTTTATCCCTTTGTTTCTGGATGTACAAAAGAAATGTTTAAAGA
ATGCAAGTTTTCCAAAAATGCCGAAATAGCTAATAAAGGTGAACATACAA
TCCTTGTTGGTCACCCACTATGTTGCTCGTTCCTTGGACAGATGCCCACC
AAAGAAGGTCACGTCAATTATGCCACAGTCACCAGTACTACACATCTGTA
TCGAAGATTTGAGGAGGATGATATCTCTTTCTCGGGAAACACTGAAAGAA
TACATAGTCTACAATGGCTGCCTATCTTTTTGGAAGTGACTCAACAACCC
AAACAGACGGTCTTGAGAAAACCACAGTCTCAGTTCTCACATCAAAACCA
TCAAAGTCAAATAACATGCCAGTACAAACGACGTTATGGGATTTTGACCA
AGCTACTTCCACTTCATCAATCAATGAATTCGAATCTAAAGGTGGTCATG
GTATGATGCAAATGCAATCTATCCAGGAAGAGAAACCTTACATTGATACT
AAATCATCTTCCAAAGAAGTGACAGATGGTACGTACTGTACTTTGCCATC
CATTTGTGGAGCAAAAGAATTTCACTGACCAATACGATGCATCGTGTATT
TGCTGCACCAATGATGATAAAGTTCTCATTGGTTCATTGTATGGTAGCAT
CAGCATAATTGATCTCAAAGGTGGTACACATAATGTTTTACACAAATTTC
CTTCAAATGGAATCCCAATCAAAATGTTGTTTTCTGATGATAAGCAATTC
TTGGTGTCACTTGAATCTAAGCTTCAAGATTATCGTGTTGGATTATCAGC
TAGGGAAATGAACTGTCAAGCTAGAGTATATTCAAATATTATGCTTGGTA
ACCCACAGAAGAATGTTGCCCCTTTAAGTAGCGGGTATTCAATTAACCGA
CACAATAATAATCATACACGAAACAAGTTTTCTGTTATTGATTTTGCTGG
TTTACGTCAACCTGCAACTGATATTGCCCTATGTAACTCTCGTCATAATG
TTGCCATATCAAGTTCAAAGAAAATCTATCTTTACGCTTTCAAAGAAGTT
ATGTCTGCTGATTTACCAGAGGATGATAGTGTCCTCACAATTGATTTCAT
ACGCATGGTAGAAGTTGAAACCACTATCAATATAAGAAGTGTAGCTTTTT
CATTAAATTGGATTGCCTTTGCCTCCAAAACTGAAATTCGTGTTATTCAA
GTTTATCTTCACCAACCATCAGATGAAAAGGTTTATCAAGGAGAAGACGT
TTCTGAACTTCTTGAGTGTTTTGATGAGGTTGGCAAGAGCGTTTTCACCA
AAAGACTTTCTCAACATGTTACCGTCAGATATGAATGTTAATTTCATGTT
ACCTTACCTGGCTGAATGCAATGAATTTCATCGATCTTCGTCGCTCAAAA
GTCAAATCTTACAAACTTATAAAACTCAAATCGAGATTCATGAAAACCTT
TAATGGCAACAACTTTTACAATGCTTGCTGGAGTACATCAGAGCGAATAA
ATTTGAACCGTGGAACTATGATGTTTACATGGAAACACTGAAAGGCAGTT
GATTATATCGTGGCGAATTACCCGGCGTTGATCCTACAGTATGCCAAAGA
TATGTTCGATTGGAAAGCTCAGTCATTGCTGTGTTCAAGATACAACCGAA
AGGAGTTCAGTTTACATGTCATCGAGAAATTGAAAGATTCAGATTTTGTT
GGAAAAGAAGCATTGTTGTTGCTGGCCTGGCCCAAAGCTGGAATGGCTCA
AGAGGTGAATCACCTTCTCCGCAAGACTGTATCATCCTCAAAAACAATCA
AAAGTCACGTTCAAATGACACTAGTGGTGGTACAGGACGAAAACAAAACG
ATCAACAAAGCATGGCTTTATCCTTACCAAGTACTGGATTGACCACCAGT
AATCCTTCGTCACCATCCAGATCAAAGATTCTTTCACCATCATCGATGGA
TGACACAAATCATGAAACATCCAAAATCTTGAAATCAAGAGAATTTTGTC
CGTGTTGCTGTTGCAGTGAAATATTGATCAAATTTCAGATCAAAGGCAAT
GGGCATTATGGTACACGCTTCACTTGGCTCAATAAGTTAAAACCATTTTC
AGGTGATCTTAGTGGACCAGTACTTACTGCGCATGACAAAGAAAATGAAT
ACTAATGATGGTTGGAAAATCAAACATAACCACGAGATTCATCTCGTCGA
AAGAGCTTCCAAGAAATTGCGGCAAAAGGAAAGGCTGAAGACAATGAGAA
AAGAATTCCACTTGATCGACAAGCTTGTCAAATACTTGAAAATCTTCTAA
ATGTTAATGAAGAAGCATTTCAAAGAGAGTTTCCAGAGCATTGTAATTTC
TCTGTTCGATACACGCACAATCGACTTGAATAATATCCTTCAAATATTCC
AGGACGATTTGCTAAAGATTTGTATTTCAAATACTGAAGTGTTATTCAAC
TCACAATATCAATTGACGCCCATGGGACAGACTACAACCACTGGACAGCT
TATGTTTTGCTTACTTGCACATGGACTTGGGGAACCCAGGGCACGCGGAA
GAGCTTTTGAAAGAACTGGAAAAGATTTATGTGTCAAACTGATGAGCAAA
TACAAGCGGAAAAAAGAATCAAAAGAACAGAGAATATTTGTGATTTCATC
ATCAATGTGTATGGCAAGAATCATCCATCAATGCTAGCAAAAGTGATCTT
AAAATCCAATCTACCTCGTCTCTATTCAATTGAAACACAGTTTTGGAACT
GGAATGATTGAATATCTGAACAATACTCTATTCGGCAAAGAACAAGTACA
ATTCGATAAGATGTGAACCAAGTTTTGATTTCACCAGCGTCAAAGGGTAC
TTCGAAATGGCTGGAATGCAACCTACAGCCGTCCTTGAACACATGAACAA
TGAAAACATAAGACTCGAGCGAAAGAGAGAAGGGCGGCGCAACATCATCA
CCATGGAGTGTATGCAGCTTCGAAAAACACATCTCAACGGATGTGGGTCA
AAAGATTACCAAACTAATTGAAGAAAGTGAATTTTCGAATCCCATGGTGT
ATTATCATTTACTGTGTGAATCACATCTTTTACTTTGTTGTGATTTGATG
AGCAGACCAAACGATGAAATTTTGATCAAAGCATTGAAATCATCAGCCGT
CTCACTTGCAACCTTCTTAATGAGACTTGTCCACCGAAGGATCTGGAAAC
TTGTTTGGTTGGTATGTATCCATACCAAGATGTTGTTTGTGTGGCAACTA
GTATGTCCTTCGTCCTCATGTTCATCAAAGTCCCTAAAAGAACAAACAGC
TGGTAAATCAAAACAACCTTATCGTGCTCGAGATCGTGGACCAACAGAGA
TCTTCCTGGAAACCAATTACTTCATGGATTACGTGTCTGTCAATAAAGAT
CTCTCCATGATCGAAGATGGTGGACTGGGCCCTAGTAATGATATTGAGCC
AAGAAAAAGAACCCATTCTTCGGCCTATGATAGATACCCATATCAATGGC
TTTTAAAGATATCGCTGAACACAAACAATTGGAAGTTGAGGAGAAAATGC
CATGGCCTTGGAATGCTTTCTTAAAACCACACTCCTTCCCAGTTCTCCTC
TCCATGCCTCTTTTTTTCTCAACTGGAACACATGGTTACCTCTACGACAC
GTGGAACTCAAAAGGACTCATCTTAGACTACAGTTACACGTCAGATTGTT
TGAGTGCCAAACATACAAATTCACTTCTATACACTGTCACCAGTAATGGA
TTGGAGATTTTCACTTCTCGCCTTTATCCCTTTGTTTCTGGATGTACAAA
AGAAATGTTTAAAGAATGCAAGTTTTCCAAAAATGCCGAAATAGCTAATA
AAGGTGAACATACAATCCTTGTTGGTCACCCACTATGTTGCTCGTTCCTT
GGACAGATGCCCACCAAAGAAGGTCACGTCAATTATGCCACAGTCACCAG
TACTACACATCTGTATCGAAGATTTGAGGAGGATGATATCTCTTTCTCGG
GAAACACTGAAAGAATACATAGTCTACAATGGCTGCCTATCTTTTTGGAA
GTGACTCAACAACCCAAACAGACGGTCTTGAGAAAACCACAGTCTCAGTT
CTCACATCAAAACCATCAAAGTCAAATAACATGCCAGTACAAACGACGTT
ATGGGATTTTGACCAAGCTACTTCCACTTCATCAATCAATGAATTCGAAT
CTAAAGGTGGTCATGGTATGATGCAAATGCAATCTATCCAGGAAGAGAAA
CCTTACATTGATACTAAATCATCTTCCAAAGAAGTGACAGATGGTACGTA
CTGTACTTTGCCATCCATTTGTGGAGCAAAAGAATTTCACTGACCAATAC
GATGCATCGTGTATTTGCTGCACCAATGATGATAAAGTTCTCATTGGTTC
ATTGTATGGTAGCATCAGCATAATTGATCTCAAAGGTGGTACACATAATG
TTTTACACAAATTTCCTTCAAATGGAATCCCAATCAAAATGTTGTTTTCT
GATGATAAGCAATTCTTGGTGTCACTTGAATCTAAGCTTCAAGATTATCG
TGTTGGATTATCAGCTAGGGAAATGAACTGTCAAGCTAGAGTATATTCAA
ATATTATGCTTGGTAACCCACAGAAGAATGTTGCCCCTTTAAGTAGCGGG
TATTCAATTAACCGACACAATAATAATCATACACGAAACAAGTTTTCTGT
TATTGATTTTGCTGGTTTACGTCAACCTGCAACTGATATTGCCCTATGTA
ACTCTCGTCATAATGTTGCCATATCAAGTTCAAAGAAAATCTATCTTTAC
GCTTTCAAAGAAGTTATGTCTGCTGATTTACCAGAGGATGATAGTGTCCT
CACAATTGATTTCATACGCATGGTAGAAGTTGAAACCACTATCAATATAA
GAAGTGTAGCTTTTTCATTAAATTGGATTGCCTTTGCCTCCAAAACTGAA
ATTCGTGTTATTCAAGTTTATCTTCACCAACCATCAGATGAAAAGGTTTA
TCAAGGAGAAGACGTTTCTGAACTTCTTGAGTGTTTTGATGAGGTTGGCA
AGAGCGTTTTCACCAAAAGACTTTCTCAACATGTTACCGTCAGATATGAA
TGTTAATTTCATGTTACCTTACCTGGCTGAATGCAATGAATTTCATCGAT
CTTCGTCGCTCAAAAGTCAAATCTTACAAACTTATAAAACTCAAATCGAG
ATTCATGAAAACCTTTAATGGCAACAACTTTTACAATGCTTGCTGGAGTA
CATCAGAGCGAATAAATTTGAACCGTGGAACTATGATGTTTACATGGAAA
CACTGAAAGGCAGTTGATTATATCGTGGCGAATTACCCGGCGTTGATCCT
ACAGTATGCCAAAGATATGTTCGATTGGAAAGCTCAGTCATTGCTGTGTT
CAAGATACAACCGAAAGGAGTTCAGTTTACATGTCATCGAGAAATTGAAA
GATTCAGATTTTGTTGGAAAAGAAGCATTGTTGTTGCTGGCCTGGCCCAA
AGCTGGAATGGCTCAAGAGGTGAATCACCTTCTCCGCAAGACTGTATCAT
CCTCAAAAACAATCAAAAGTCACGTTCAAATGACACTAGTGGTGGTACAG
GACGAAAACAAAACGATCAACAAAGCATGGCTTTATCCTTACCAAGTACT
GGATTGACCACCAGTAATCCTTCGTCACCATCCAGATCAAAGATTCTTTC
ACCATCATCGATGGATGACACAAATCATGAAACATCCAAAATCTTGAAAT
CAAGAGAATTTTGTCCGTGTTGCTGTTGCAGTGAAATATTGATCAAATTT
CAGATCAAAGGCAATGGGCATTATGGTACACGCTTCACTTGGCTCAATAA
GTTAAAACCATTTTCAGGTGATCTTAGTGGACCAGTACTTACTGCGCATG
ACAAAGAAAATGAATACTAATGATGGTTGGAAAATCAAACATAACCACGA
GATTCATCTCGTCGAAAGAGCTTCCAAGAAATTGCGGCAAAAGGAAAGGC
TGAAGACAATGAGAAAAGAATTCCACTTGATCGACAAGCTTGTCAAATAC
TTGAAAATCTTCTAAATGTTAATGAAGAAGCATTTCAAAGAGAGTTTCCA
GAGCATTGTAATTTCTCTGTTCGATACACGCACAATCGACTTGAATAATA
TCCTTCAAATATTCCAGGACGATTTGCTAAAGATTTGTATTTCAAATACT
GAAGTGTTATTCAACTCACAATATCAATTGACGCCCATGGGACAGACTAC
AACCACTGGACAGCTTATGTTTTGCTTACTTGCACATGGACTTGGGGAAC
CCAGGGCACGCGGAAGAGCTTTTGAAAGAACTGGAAAAGATTTATGTGTC
AAACTGATGAGCAAATACAAGCGGAAAAAAGAATCAAAAGAACAGAGAAT
ATTTGTGATTTCATCATCAATGTGTATGGCAAGAATCATCCATCAATGCT
AGCAAAAGTGATCTTAAAATCCAATCTACCTCGTCTCTATTCAATTGAAA
CACAGTTTTGGAACTGGAATGATTGAATATCTGAACAATACTCTATTCGG
CAAAGAACAAGTACAATTCGATAAGATGTGAACCAAGTTTTGATTTCACC
AGCGTCAAAGGGTACTTCGAAATGGCTGGAATGCAACCTACAGCCGTCCT
TGAACACATGAACAATGAAAACATAAGACTCGAGCGAAAGAGAGAAGGGC
GGCGCAACATCATCACCATGGAGTGTATGCAGCTTCGAAAAACACATCTC
AACGGATGTGGGTCAAAAGATTACCAAACTAATTGAAGAAAGTGAATTTT
CGAATCCCATGGTGTATTATCATTTACTGTGTGAATCACATCTTTTACTT
TGTTGTGATTTGATGAGCAGACCAAACGATGAAATTTTGATCAAAGCATT
GAAATCATCAGCCGTCTCACTTGCAACCTTCTTAATGAGACTTGTCCACC
GAAGGATCTGGAAACTTGTTTGGTTGGTATGTATCCATACCAAGATGTTG
TTTGTGTGGCAACTAGTATGTCCTTCGTCCTCATGTTCATCAAAGTCCCT
AAAAGAACAAACAGCTGGTAAATCAAAACAACCTTATCGTGCTCGAGATC
GTGGACCAACAGAGATCTTCCTGGAAACCAATTACTTCATGGATTACGTG
TCTGTCAATAAAGATCTCTCCATGATCGAAGATGGTGGACTGGGCCCTAG
TAATGATATTGAGCCAAGAAAAAGAACCCATTCTTCGGCCTATGATAGAT
ACCCATATCAATGGCTTTTAAAGATATCGCTGAACACAAACAATTGGAAG
TTGAGGAGAAAATGCCATGGCCTTGGAATGCTTTCTTAAAACCACACTCC
TTCCCAGTTCTCCTCTCCATGCCTCTTTTTTTCTCAACTGGAACACATGG
TTACCTCTACGACACGTGGAACTCAAAAGGACTCATCTTAGACTACAGTT
ACACGTCAGATTGTTTGAGTGCCAAACATACAAATTCACTTCTATACACT
GTCACCAGTAATGGATTGGAGATTTTCACTTCTCGCCTTTATCCCTTTGT
TTCTGGATGTACAAAAGAAATGTTTAAAGAATGCAAGTTTTCCAAAAATG
CCGAAATAGCTAATAAAGGTGAACATACAATCCTTGTTGGTCACCCACTA
TGTTGCTCGTTCCTTGGACAGATGCCCACCAAAGAAGGTCACGTCAATTA
TGCCACAGTCACCAGTACTACACATCTGTATCGAAGATTTGAGGAGGATG
ATATCTCTTTCTCGGGAAACACTGAAAGAATACATAGTCTACAATGGCTG
CCTATCTTTTTGGAAGTGACTCAACAACCCAAACAGACGGTCTTGAGAAA
ACCACAGTCTCAGTTCTCACATCAAAACCATCAAAGTCAAATAACATGCC
AGTACAAACGACGTTATGGGATTTTGACCAAGCTACTTCCACTTCATCAA
TCAATGAATTCGAATCTAAAGGTGGTCATGGTATGATGCAAATGCAATCT
ATCCAGGAAGAGAAACCTTACATTGATACTAAATCATCTTCCAAAGAAGT
GACAGATGGTACGTACTGTACTTTGCCATCCATTTGTGGAGCAAAAGAAT
TTCACTGACCAATACGATGCATCGTGTATTTGCTGCACCAATGATGATAA
AGTTCTCATTGGTTCATTGTATGGTAGCATCAGCATAATTGATCTCAAAG
GTGGTACACATAATGTTTTACACAAATTTCCTTCAAATGGAATCCCAATC
AAAATGTTGTTTTCTGATGATAAGCAATTCTTGGTGTCACTTGAATCTAA
GCTTCAAGATTATCGTGTTGGATTATCAGCTAGGGAAATGAACTGTCAAG
CTAGAGTATATTCAAATATTATGCTTGGTAACCCACAGAAGAATGTTGCC
CCTTTAAGTAGCGGGTATTCAATTAACCGACACAATAATAATCATACACG
AAACAAGTTTTCTGTTATTGATTTTGCTGGTTTACGTCAACCTGCAACTG
ATATTGCCCTATGTAACTCTCGTCATAATGTTGCCATATCAAGTTCAAAG
AAAATCTATCTTTACGCTTTCAAAGAAGTTATGTCTGCTGATTTACCAGA
GGATGATAGTGTCCTCACAATTGATTTCATACGCATGGTAGAAGTTGAAA
CCACTATCAATATAAGAAGTGTAGCTTTTTCATTAAATTGGATTGCCTTT
GCCTCCAAAACTGAAATTCGTGTTATTCAAGTTTATCTTCACCAACCATC
AGATGAAAAGGTTTATCAAGGAGAAGACGTTTCTGAACTTCTTGAGTGTT
TTGATGAGGTTGGCAAGAGCGTTTTCACCAAAAGACTTTCTCAACATGTT
ACCGTCAGATATGAATGTTAATTTCATGTTACCTTACCTGGCTGAATGCA
ATGAATTTCATCGATCTTCGTCGCTCAAAAGTCAAATCTTACAAACTTAT
AAAACTCAAATCGAGATTCATGAAAACCTTTAATGGCAACAACTTTTACA
ATGCTTGCTGGAGTACATCAGAGCGAATAAATTTGAACCGTGGAACTATG
ATGTTTACATGGAAACACTGAAAGGCAGTTGATTATATCGTGGCGAATTA
CCCGGCGTTGATCCTACAGTATGCCAAAGATATGTTCGATTGGAAAGCTC
AGTCATTGCTGTGTTCAAGATACAACCGAAAGGAGTTCAGTTTACATGTC
ATCGAGAAATTGAAAGATTCAGATTTTGTTGGAAAAGAAGCATTGTTGTT
GCTGGCCTGGCCCAAAGCTGGAATGGCTCAAGAGGTGAATCACCTTCTCC
GCAAGACTGTATCATCCTCAAAAACAATCAAAAGTCACGTTCAAATGACA
CTAGTGGTGGTACAGGACGAAAACAAAACGATCAACAAAGCATGGCTTTA
TCCTTACCAAGTACTGGATTGACCACCAGTAATCCTTCGTCACCATCCAG
ATCAAAGATTCTTTCACCATCATCGATGGATGACACAAATCATGAAACAT
CCAAAATCTTGAAATCAAGAGAATTTTGTCCGTGTTGCTGTTGCAGTGAA
ATATTGATCAAATTTCAGATCAAAGGCAATGGGCATTATGGTACACGCTT
CACTTGGCTCAATAAGTTAAAACCATTTTCAGGTGATCTTAGTGGACCAG
TACTTACTGCGCATGACAAAGAAAATGAATACTAATGATGGTTGGAAAAT
CAAACATAACCACGAGATTCATCTCGTCGAAAGAGCTTCCAAGAAATTGC
GGCAAAAGGAAAGGCTGAAGACAATGAGAAAAGAATTCCACTTGATCGAC
AAGCTTGTCAAATACTTGAAAATCTTCTAAATGTTAATGAAGAAGCATTT
CAAAGAGAGTTTCCAGAGCATTGTAATTTCTCTGTTCGATACACGCACAA
TCGACTTGAATAATATCCTTCAAATATTCCAGGACGATTTGCTAAAGATT
TGTATTTCAAATACTGAAGTGTTATTCAACTCACAATATCAATTGACGCC
CATGGGACAGACTACAACCACTGGACAGCTTATGTTTTGCTTACTTGCAC
ATGGACTTGGGGAACCCAGGGCACGCGGAAGAGCTTTTGAAAGAACTGGA
AAAGATTTATGTGTCAAACTGATGAGCAAATACAAGCGGAAAAAAGAATC
AAAAGAACAGAGAATATTTGTGATTTCATCATCAATGTGTATGGCAAGAA
TCATCCATCAATGCTAGCAAAAGTGATCTTAAAATCCAATCTACCTCGTC
TCTATTCAATTGAAACACAGTTTTGGAACTGGAATGATTGAATATCTGAA
CAATACTCTATTCGGCAAAGAACAAGTACAATTCGATAAGATGTGAACCA
AGTTTTGATTTCACCAGCGTCAAAGGGTACTTCGAAATGGCTGGAATGCA
ACCTACAGCCGTCCTTGAACACATGAACAATGAAAACATAAGACTCGAGC
GAAAGAGAGAAGGGCGGCGCAACATCATCACCATGGAGTGTATGCAGCTT
CGAAAAACACATCTCAACGGATGTGGGTCAAAAGATTACCAAACTAATTG
AAGAAAGTGAATTTTCGAATCCCATGGTGTATTATCATTTACTGTGTGAA
TCACATCTTTTACTTTGTTGTGATTTGATGAGCAGACCAAACGATGAAAT
TTTGATCAAAGCATTGAAATCATCAGCCGTCTCACTTGCAACCTTCTTAA
TGAGACTTGTCCACCGAAGGATCTGGAAACTTGTTTGGTTGGTATGTATC
CATACCAAGATGTTGTTTGTGTGGCAACTAGTATGTCCTTCGTCCTCATG
TTCATCAAAGTCCCTAAAAGAACAAACAGCTGGTAAATCAAAACAACCTT
ATCGTGCTCGAGATCGTGGACCAACAGAGATCTTCCTGGAAACCAATTAC
TTCATGGATTACGTGTCTGTCAATAAAGATCTCTCCATGATCGAAGATGG
TGGACTGGGCCCTAGTAATGATATTGAGCCAAGAAAAAGAACCCATTCTT
CGGCCTATGATAGATACCCATATCAATGGCTTTTAAAGATATCGCTGAAC
ACAAACAATTGGAAGTTGAGGAGAAAATGCCATGGCCTTGGAATGCTTTC
TTAAAACCACACTCCTTCCCAGTTCTCCTCTCCATGCCTCTTTTTTTCTC
AACTGGAACACATGGTTACCTCTACGACACGTGGAACTCAAAAGGACTCA
TCTTAGACTACAGTTACACGTCAGATTGTTTGAGTGCCAAACATACAAAT
TCACTTCTATACACTGTCACCAGTAATGGATTGGAGATTTTCACTTCTCG
CCTTTATCCCTTTGTTTCTGGATGTACAAAAGAAATGTTTAAAGAATGCA
AGTTTTCCAAAAATGCCGAAATAGCTAATAAAGGTGAACATACAATCCTT
GTTGGTCACCCACTATGTTGCTCGTTCCTTGGACAGATGCCCACCAAAGA
AGGTCACGTCAATTATGCCACAGTCACCAGTACTACACATCTGTATCGAA
GATTTGAGGAGGATGATATCTCTTTCTCGGGAAACACTGAAAGAATACAT
AGTCTACAATGGCTGCCTATCTTTTTGGAAGTGACTCAACAACCCAAACA
GACGGTCTTGAGAAAACCACAGTCTCAGTTCTCACATCAAAACCATCAAA
GTCAAATAACATGCCAGTACAAACGACGTTATGGGATTTTGACCAAGCTA
CTTCCACTTCATCAATCAATGAATTCGAATCTAAAGGTGGTCATGGTATG
ATGCAAATGCAATCTATCCAGGAAGAGAAACCTTACATTGATACTAAATC
ATCTTCCAAAGAAGTGACAGATGGTACGTACTGTACTTTGCCATCCATTT
GTGGAGCAAAAGAATTTCACTGACCAATACGATGCATCGTGTATTTGCTG
CACCAATGATGATAAAGTTCTCATTGGTTCATTGTATGGTAGCATCAGCA
TAATTGATCTCAAAGGTGGTACACATAATGTTTTACACAAATTTCCTTCA
AATGGAATCCCAATCAAAATGTTGTTTTCTGATGATAAGCAATTCTTGGT
GTCACTTGAATCTAAGCTTCAAGATTATCGTGTTGGATTATCAGCTAGGG
AAATGAACTGTCAAGCTAGAGTATATTCAAATATTATGCTTGGTAACCCA
CAGAAGAATGTTGCCCCTTTAAGTAGCGGGTATTCAATTAACCGACACAA
TAATAATCATACACGAAACAAGTTTTCTGTTATTGATTTTGCTGGTTTAC
GTCAACCTGCAACTGATATTGCCCTATGTAACTCTCGTCATAATGTTGCC
ATATCAAGTTCAAAGAAAATCTATCTTTACGCTTTCAAAGAAGTTATGTC
TGCTGATTTACCAGAGGATGATAGTGTCCTCACAATTGATTTCATACGCA
TGGTAGAAGTTGAAACCACTATCAATATAAGAAGTGTAGCTTTTTCATTA
AATTGGATTGCCTTTGCCTCCAAAACTGAAATTCGTGTTATTCAAGTTTA
TCTTCACCAACCATCAGATGAAAAGGTTTATCAAGGAGAAGACGTTTCTG
AACTTCTTGAGTGTTTTGATGAGGTTGGCAAGAGCGTTTTCACCAAAAGA
CTTTCTCAACATGTTACCGTCAGATATGAATGTTAATTTCATGTTACCTT
ACCTGGCTGAATGCAATGAATTTCATCGATCTTCGTCGCTCAAAAGTCAA
ATCTTACAAACTTATAAAACTCAAATCGAGATTCATGAAAACCTTTAATG
GCAACAACTTTTACAATGCTTGCTGGAGTACATCAGAGCGAATAAATTTG
AACCGTGGAACTATGATGTTTACATGGAAACACTGAAAGGCAGTTGATTA
TATCGTGGCGAATTACCCGGCGTTGATCCTACAGTATGCCAAAGATATGT
TCGATTGGAAAGCTCAGTCATTGCTGTGTTCAAGATACAACCGAAAGGAG
TTCAGTTTACATGTCATCGAGAAATTGAAAGATTCAGATTTTGTTGGAAA
AGAAGCATTGTTGTTGCTGGCCTGGCCCAAAGCTGGAATGGCTCAAGAGG
TGAATCACCTTCTCCGCAAGACTGTATCATCCTCAAAAACAATCAAAAGT
CACGTTCAAATGACACTAGTGGTGGTACAGGACGAAAACAAAACGATCAA
CAAAGCATGGCTTTATCCTTACCAAGTACTGGATTGACCACCAGTAATCC
TTCGTCACCATCCAGATCAAAGATTCTTTCACCATCATCGATGGATGACA
CAAATCATGAAACATCCAAAATCTTGAAATCAAGAGAATTTTGTCCGTGT
TGCTGTTGCAGTGAAATATTGATCAAATTTCAGATCAAAGGCAATGGGCA
TTATGGTACACGCTTCACTTGGCTCAATAAGTTAAAACCATTTTCAGGTG
ATCTTAGTGGACCAGTACTTACTGCGCATGACAAAGAAAATGAATACTAA
TGATGGTTGGAAAATCAAACATAACCACGAGATTCATCTCGTCGAAAGAG
CTTCCAAGAAATTGCGGCAAAAGGAAAGGCTGAAGACAATGAGAAAAGAA
TTCCACTTGATCGACAAGCTTGTCAAATACTTGAAAATCTTCTAAATGTT
AATGAAGAAGCATTTCAAAGAGAGTTTCCAGAGCATTGTAATTTCTCTGT
TCGATACACGCACAATCGACTTGAATAATATCCTTCAAATATTCCAGGAC
GATTTGCTAAAGATTTGTATTTCAAATACTGAAGTGTTATTCAACTCACA
ATATCAATTGACGCCCATGGGACAGACTACAACCACTGGACAGCTTATGT
TTTGCTTACTTGCACATGGACTTGGGGAACCCAGGGCACGCGGAAGAGCT
TTTGAAAGAACTGGAAAAGATTTATGTGTCAAACTGATGAGCAAATACAA
GCGGAAAAAAGAATCAAAAGAACAGAGAATATTTGTGATTTCATCATCAA
TGTGTATGGCAAGAATCATCCATCAATGCTAGCAAAAGTGATCTTAAAAT
CCAATCTACCTCGTCTCTATTCAATTGAAACACAGTTTTGGAACTGGAAT
GATTGAATATCTGAACAATACTCTATTCGGCAAAGAACAAGTACAATTCG
ATAAGATGTGAACCAAGTTTTGATTTCACCAGCGTCAAAGGGTACTTCGA
AATGGCTGGAATGCAACCTACAGCCGTCCTTGAACACATGAACAATGAAA
ACATAAGACTCGAGCGAAAGAGAGAAGGGCGGCGCAACATCATCACCATG
GAGTGTATGCAGCTTCGAAAAACACATCTCAACGGATGTGGGTCAAAAGA
TTACCAAACTAATTGAAGAAAGTGAATTTTCGAATCCCATGGTGTATTAT
CATTTACTGTGTGAATCACATCTTTTACTTTGTTGTGATTTGATGAGCAG
ACCAAACGATGAAATTTTGATCAAAGCATTGAAATCATCAGCCGTCTCAC
TTGCAACCTTCTTAATGAGACTTGTCCACCGAAGGATCTGGAAACTTGTT
TGGTTGGTATGTATCCATACCAAGATGTTGTTTGTGTGGCAACTAGTATG
TCCTTCGTCCTCATGTTCATCAAAGTCCCTAAAAGAACAAACAGCTGGTA
AATCAAAACAACCTTATCGTGCTCGAGATCGTGGACCAACAGAGATCTTC
CTGGAAACCAATTACTTCATGGATTACGTGTCTGTCAATAAAGATCTCTC
CATGATCGAAGATGGTGGACTGGGCCCTAGTAATGATATTGAGCCAAGAA
AAAGAACCCATTCTTCGGCCTATGATAGATACCCATATCAATGGCTTTTA
AAGATATCGCTGAACACAAACAATTGGAAGTTGAGGAGAAAATGCCATGG
CCTTGGAATGCTTTCTTAAAACCACACTCCTTCCCAGTTCTCCTCTCCAT
GCCTCTTTTTTTCTCAACTGGAACACATGGTTACCTCTACGACACGTGGA
ACTCAAAAGGACTCATCTTAGACTACAGTTACACGTCAGATTGTTTGAGT
GCCAAACATACAAATTCACTTCTATACACTGTCACCAGTAATGGATTGGA
GATTTTCACTTCTCGCCTTTATCCCTTTGTTTCTGGATGTACAAAAGAAA
TGTTTAAAGAATGCAAGTTTTCCAAAAATGCCGAAATAGCTAATAAAGGT
GAACATACAATCCTTGTTGGTCACCCACTATGTTGCTCGTTCCTTGGACA
GATGCCCACCAAAGAAGGTCACGTCAATTATGCCACAGTCACCAGTACTA
CACATCTGTATCGAAGATTTGAGGAGGATGATATCTCTTTCTCGGGAAAC
ACTGAAAGAATACATAGTCTACAATGGCTGCCTATCTTTTTGGAAGTGAC
TCAACAACCCAAACAGACGGTCTTGAGAAAACCACAGTCTCAGTTCTCAC
ATCAAAACCATCAAAGTCAAATAACATGCCAGTACAAACGACGTTATGGG
ATTTTGACCAAGCTACTTCCACTTCATCAATCAATGAATTCGAATCTAAA
GGTGGTCATGGTATGATGCAAATGCAATCTATCCAGGAAGAGAAACCTTA
CATTGATACTAAATCATCTTCCAAAGAAGTGACAGATGGTACGTACTGTA
CTTTGCCATCCATTTGTGGAGCAAAAGAATTTCACTGACCAATACGATGC
ATCGTGTATTTGCTGCACCAATGATGATAAAGTTCTCATTGGTTCATTGT
ATGGTAGCATCAGCATAATTGATCTCAAAGGTGGTACACATAATGTTTTA
CACAAATTTCCTTCAAATGGAATCCCAATCAAAATGTTGTTTTCTGATGA
TAAGCAATTCTTGGTGTCACTTGAATCTAAGCTTCAAGATTATCGTGTTG
GATTATCAGCTAGGGAAATGAACTGTCAAGCTAGAGTATATTCAAATATT
ATGCTTGGTAACCCACAGAAGAATGTTGCCCCTTTAAGTAGCGGGTATTC
AATTAACCGACACAATAATAATCATACACGAAACAAGTTTTCTGTTATTG
ATTTTGCTGGTTTACGTCAACCTGCAACTGATATTGCCCTATGTAACTCT
CGTCATAATGTTGCCATATCAAGTTCAAAGAAAATCTATCTTTACGCTTT
CAAAGAAGTTATGTCTGCTGATTTACCAGAGGATGATAGTGTCCTCACAA
TTGATTTCATACGCATGGTAGAAGTTGAAACCACTATCAATATAAGAAGT
GTAGCTTTTTCATTAAATTGGATTGCCTTTGCCTCCAAAACTGAAATTCG
TGTTATTCAAGTTTATCTTCACCAACCATCAGATGAAAAGGTTTATCAAG
GAGAAGACGTTTCTGAACTTCTTGAGTGTTTTGATGAGGTTGGCAAGAGC
GTTTTCACCAAAAGACTTTCTCAACATGTTACCGTCAGATATGAATGTTA
ATTTCATGTTACCTTACCTGGCTGAATGCAATGAATTTCATCGATCTTCG
TCGCTCAAAAGTCAAATCTTACAAACTTATAAAACTCAAATCGAGATTCA
TGAAAACCTTTAATGGCAACAACTTTTACAATGCTTGCTGGAGTACATCA
GAGCGAATAAATTTGAACCGTGGAACTATGATGTTTACATGGAAACACTG
AAAGGCAGTTGATTATATCGTGGCGAATTACCCGGCGTTGATCCTACAGT
ATGCCAAAGATATGTTCGATTGGAAAGCTCAGTCATTGCTGTGTTCAAGA
TACAACCGAAAGGAGTTCAGTTTACATGTCATCGAGAAATTGAAAGATTC
AGATTTTGTTGGAAAAGAAGCATTGTTGTTGCTGGCCTGGCCCAAAGCTG
GAATGGCTCAAGAGGTGAATCACCTTCTCCGCAAGACTGTATCATCCTCA
AAAACAATCAAAAGTCACGTTCAAATGACACTAGTGGTGGTACAGGACGA
AAACAAAACGATCAACAAAGCATGGCTTTATCCTTACCAAGTACTGGATT
GACCACCAGTAATCCTTCGTCACCATCCAGATCAAAGATTCTTTCACCAT
CATCGATGGATGACACAAATCATGAAACATCCAAAATCTTGAAATCAAGA
GAATTTTGTCCGTGTTGCTGTTGCAGTGAAATATTGATCAAATTTCAGAT
CAAAGGCAATGGGCATTATGGTACACGCTTCACTTGGCTCAATAAGTTAA
AACCATTTTCAGGTGATCTTAGTGGACCAGTACTTACTGCGCATGACAAA
GAAAATGAATACTAATGATGGTTGGAAAATCAAACATAACCACGAGATTC
ATCTCGTCGAAAGAGCTTCCAAGAAATTGCGGCAAAAGGAAAGGCTGAAG
ACAATGAGAAAAGAATTCCACTTGATCGACAAGCTTGTCAAATACTTGAA
AATCTTCTAAATGTTAATGAAGAAGCATTTCAAAGAGAGTTTCCAGAGCA
TTGTAATTTCTCTGTTCGATACACGCACAATCGACTTGAATAATATCCTT
CAAATATTCCAGGACGATTTGCTAAAGATTTGTATTTCAAATACTGAAGT
GTTATTCAACTCACAATATCAATTGACGCCCATGGGACAGACTACAACCA
CTGGACAGCTTATGTTTTGCTTACTTGCACATGGACTTGGGGAACCCAGG
GCACGCGGAAGAGCTTTTGAAAGAACTGGAAAAGATTTATGTGTCAAACT
GATGAGCAAATACAAGCGGAAAAAAGAATCAAAAGAACAGAGAATATTTG
TGATTTCATCATCAATGTGTATGGCAAGAATCATCCATCAATGCTAGCAA
AAGTGATCTTAAAATCCAATCTACCTCGTCTCTATTCAATTGAAACACAG
TTTTGGAACTGGAATGATTGAATATCTGAACAATACTCTATTCGGCAAAG
AACAAGTACAATTCGATAAGATGTGAACCAAGTTTTGATTTCACCAGCGT
CAAAGGGTACTTCGAAATGGCTGGAATGCAACCTACAGCCGTCCTTGAAC
ACATGAACAATGAAAACATAAGACTCGAGCGAAAGAGAGAAGGGCGGCGC
AACATCATCACCATGGAGTGTATGCAGCTTCGAAAAACACATCTCAACGG
ATGTGGGTCAAAAGATTACCAAACTAATTGAAGAAAGTGAATTTTCGAAT
CCCATGGTGTATTATCATTTACTGTGTGAATCACATCTTTTACTTTGTTG
TGATTTGATGAGCAGACCAAACGATGAAATTTTGATCAAAGCATTGAAAT
CATCAGCCGTCTCACTTGCAACCTTCTTAATGAGACTTGTCCACCGAAGG
ATCTGGAAACTTGTTTGGTTGGTATGTATCCATACCAAGATGTTGTTTGT
GTGGCAACTAGTATGTCCTTCGTCCTCATGTTCATCAAAGTCCCTAAAAG
AACAAACAGCTGGTAAATCAAAACAACCTTATCGTGCTCGAGATCGTGGA
CCAACAGAGATCTTCCTGGAAACCAATTACTTCATGGATTACGTGTCTGT
CAATAAAGATCTCTCCATGATCGAAGATGGTGGACTGGGCCCTAGTAATG
ATATTGAGCCAAGAAAAAGAACCCATTCTTCGGCCTATGATAGATACCCA
TATCAATGGCTTTTAAAGATATCGCTGAACACAAACAATTGGAAGTTGAG
GAGAAAATGCCATGGCCTTGGAATGCTTTCTTAAAACCACACTCCTTCCC
AGTTCTCCTCTCCATGCCTCTTTTTTTCTCAACTGGAACACATGGTTACC
TCTACGACACGTGGAACTCAAAAGGACTCATCTTAGACTACAGTTACACG
TCAGATTGTTTGAGTGCCAAACATACAAATTCACTTCTATACACTGTCAC
CAGTAATGGATTGGAGATTTTCACTTCTCGCCTTTATCCCTTTGTTTCTG
GATGTACAAAAGAAATGTTTAAAGAATGCAAGTTTTCCAAAAATGCCGAA
ATAGCTAATAAAGGTGAACATACAATCCTTGTTGGTCACCCACTATGTTG
CTCGTTCCTTGGACAGATGCCCACCAAAGAAGGTCACGTCAATTATGCCA
CAGTCACCAGTACTACACATCTGTATCGAAGATTTGAGGAGGATGATATC
TCTTTCTCGGGAAACACTGAAAGAATACATAGTCTACAATGGCTGCCTAT
CTTTTTGGAAGTGACTCAACAACCCAAACAGACGGTCTTGAGAAAACCAC
AGTCTCAGTTCTCACATCAAAACCATCAAAGTCAAATAACATGCCAGTAC
AAACGACGTTATGGGATTTTGACCAAGCTACTTCCACTTCATCAATCAAT
GAATTCGAATCTAAAGGTGGTCATGGTATGATGCAAATGCAATCTATCCA
GGAAGAGAAACCTTACATTGATACTAAATCATCTTCCAAAGAAGTGACAG
ATGGTACGTACTGTACTTTGCCATCCATTTGTGGAGCAAAAGAATTTCAC
TGACCAATACGATGCATCGTGTATTTGCTGCACCAATGATGATAAAGTTC
TCATTGGTTCATTGTATGGTAGCATCAGCATAATTGATCTCAAAGGTGGT
ACACATAATGTTTTACACAAATTTCCTTCAAATGGAATCCCAATCAAAAT
GTTGTTTTCTGATGATAAGCAATTCTTGGTGTCACTTGAATCTAAGCTTC
AAGATTATCGTGTTGGATTATCAGCTAGGGAAATGAACTGTCAAGCTAGA
GTATATTCAAATATTATGCTTGGTAACCCACAGAAGAATGTTGCCCCTTT
AAGTAGCGGGTATTCAATTAACCGACACAATAATAATCATACACGAAACA
AGTTTTCTGTTATTGATTTTGCTGGTTTACGTCAACCTGCAACTGATATT
GCCCTATGTAACTCTCGTCATAATGTTGCCATATCAAGTTCAAAGAAAAT
CTATCTTTACGCTTTCAAAGAAGTTATGTCTGCTGATTTACCAGAGGATG
ATAGTGTCCTCACAATTGATTTCATACGCATGGTAGAAGTTGAAACCACT
ATCAATATAAGAAGTGTAGCTTTTTCATTAAATTGGATTGCCTTTGCCTC
CAAAACTGAAATTCGTGTTATTCAAGTTTATCTTCACCAACCATCAGATG
AAAAGGTTTATCAAGGAGAAGACGTTTCTGAACTTCTTGAGTGTTTTGAT
GAGGTTGGCAAGAGCGTTTTCACCAAAAGACTTTCTCAACATGTTACCGT
CAGATATGAATGTTAATTTCATGTTACCTTACCTGGCTGAATGCAATGAA
TTTCATCGATCTTCGTCGCTCAAAAGTCAAATCTTACAAACTTATAAAAC
TCAAATCGAGATTCATGAAAACCTTTAATGGCAACAACTTTTACAATGCT
TGCTGGAGTACATCAGAGCGAATAAATTTGAACCGTGGAACTATGATGTT
TACATGGAAACACTGAAAGGCAGTTGATTATATCGTGGCGAATTACCCGG
CGTTGATCCTACAGTATGCCAAAGATATGTTCGATTGGAAAGCTCAGTCA
TTGCTGTGTTCAAGATACAACCGAAAGGAGTTCAGTTTACATGTCATCGA
GAAATTGAAAGATTCAGATTTTGTTGGAAAAGAAGCATTGTTGTTGCTGG
CCTGGCCCAAAGCTGGAATGGCTCAAGAGGTGAATCACCTTCTCCGCAAG
ACTGTATCATCCTCAAAAACAATCAAAAGTCACGTTCAAATGACACTAGT
GGTGGTACAGGACGAAAACAAAACGATCAACAAAGCATGGCTTTATCCTT
ACCAAGTACTGGATTGACCACCAGTAATCCTTCGTCACCATCCAGATCAA
AGATTCTTTCACCATCATCGATGGATGACACAAATCATGAAACATCCAAA
ATCTTGAAATCAAGAGAATTTTGTCCGTGTTGCTGTTGCAGTGAAATATT
GATCAAATTTCAGATCAAAGGCAATGGGCATTATGGTACACGCTTCACTT
GGCTCAATAAGTTAAAACCATTTTCAGGTGATCTTAGTGGACCAGTACTT
ACTGCGCATGACAAAGAAAATGAATACTAATGATGGTTGGAAAATCAAAC
ATAACCACGAGATTCATCTCGTCGAAAGAGCTTCCAAGAAATTGCGGCAA
AAGGAAAGGCTGAAGACAATGAGAAAAGAATTCCACTTGATCGACAAGCT
TGTCAAATACTTGAAAATCTTCTAAATGTTAATGAAGAAGCATTTCAAAG
AGAGTTTCCAGAGCATTGTAATTTCTCTGTTCGATACACGCACAATCGAC
TTGAATAATATCCTTCAAATATTCCAGGACGATTTGCTAAAGATTTGTAT
TTCAAATACTGAAGTGTTATTCAACTCACAATATCAATTGACGCCCATGG
GACAGACTACAACCACTGGACAGCTTATGTTTTGCTTACTTGCACATGGA
CTTGGGGAACCCAGGGCACGCGGAAGAGCTTTTGAAAGAACTGGAAAAGA
TTTATGTGTCAAACTGATGAGCAAATACAAGCGGAAAAAAGAATCAAAAG
AACAGAGAATATTTGTGATTTCATCATCAATGTGTATGGCAAGAATCATC
CATCAATGCTAGCAAAAGTGATCTTAAAATCCAATCTACCTCGTCTCTAT
TCAATTGAAACACAGTTTTGGAACTGGAATGATTGAATATCTGAACAATA
CTCTATTCGGCAAAGAACAAGTACAATTCGATAAGATGTGAACCAAGTTT
TGATTTCACCAGCGTCAAAGGGTACTTCGAAATGGCTGGAATGCAACCTA
CAGCCGTCCTTGAACACATGAACAATGAAAACATAAGACTCGAGCGAAAG
AGAGAAGGGCGGCGCAACATCATCACCATGGAGTGTATGCAGCTTCGAAA
AACACATCTCAACGGATGTGGGTCAAAAGATTACCAAACTAATTGAAGAA
AGTGAATTTTCGAATCCCATGGTGTATTATCATTTACTGTGTGAATCACA
TCTTTTACTTTGTTGTGATTTGATGAGCAGACCAAACGATGAAATTTTGA
TCAAAGCATTGAAATCATCAGCCGTCTCACTTGCAACCTTCTTAATGAGA
CTTGTCCACCGAAGGATCTGGAAACTTGTTTGGTTGGTATGTATCCATAC
CAAGATGTTGTTTGTGTGGCAACTAGTATGTCCTTCGTCCTCATGTTCAT
CAAAGTCCCTAAAAGAACAAACAGCTGGTAAATCAAAACAACCTTATCGT
GCTCGAGATCGTGGACCAACAGAGATCTTCCTGGAAACCAATTACTTCAT
GGATTACGTGTCTGTCAATAAAGATCTCTCCATGATCGAAGATGGTGGAC
TGGGCCCTAGTAATGATATTGAGCCAAGAAAAAGAACCCATTCTTCGGCC
TATGATAGATACCCATATCAATGGCTTTTAAAGATATCGCTGAACACAAA
CAATTGGAAGTTGAGGAGAAAATGCCATGGCCTTGGAATGCTTTCTTAAA
ACCACACTCCTTCCCAGTTCTCCTCTCCATGCCTCTTTTTTTCTCAACTG
GAACACATGGTTACCTCTACGACACGTGGAACTCAAAAGGACTCATCTTA
GACTACAGTTACACGTCAGATTGTTTGAGTGCCAAACATACAAATTCACT
TCTATACACTGTCACCAGTAATGGATTGGAGATTTTCACTTCTCGCCTTT
ATCCCTTTGTTTCTGGATGTACAAAAGAAATGTTTAAAGAATGCAAGTTT
TCCAAAAATGCCGAAATAGCTAATAAAGGTGAACATACAATCCTTGTTGG
TCACCCACTATGTTGCTCGTTCCTTGGACAGATGCCCACCAAAGAAGGTC
ACGTCAATTATGCCACAGTCACCAGTACTACACATCTGTATCGAAGATTT
GAGGAGGATGATATCTCTTTCTCGGGAAACACTGAAAGAATACATAGTCT
ACAATGGCTGCCTATCTTTTTGGAAGTGACTCAACAACCCAAACAGACGG
TCTTGAGAAAACCACAGTCTCAGTTCTCACATCAAAACCATCAAAGTCAA
ATAACATGCCAGTACAAACGACGTTATGGGATTTTGACCAAGCTACTTCC
ACTTCATCAATCAATGAATTCGAATCTAAAGGTGGTCATGGTATGATGCA
AATGCAATCTATCCAGGAAGAGAAACCTTACATTGATACTAAATCATCTT
CCAAAGAAGTGACAGATGGTACGTACTGTACTTTGCCATCCATTTGTGGA
GCAAAAGAATTTCACTGACCAATACGATGCATCGTGTATTTGCTGCACCA
ATGATGATAAAGTTCTCATTGGTTCATTGTATGGTAGCATCAGCATAATT
GATCTCAAAGGTGGTACACATAATGTTTTACACAAATTTCCTTCAAATGG
AATCCCAATCAAAATGTTGTTTTCTGATGATAAGCAATTCTTGGTGTCAC
TTGAATCTAAGCTTCAAGATTATCGTGTTGGATTATCAGCTAGGGAAATG
AACTGTCAAGCTAGAGTATATTCAAATATTATGCTTGGTAACCCACAGAA
GAATGTTGCCCCTTTAAGTAGCGGGTATTCAATTAACCGACACAATAATA
ATCATACACGAAACAAGTTTTCTGTTATTGATTTTGCTGGTTTACGTCAA
CCTGCAACTGATATTGCCCTATGTAACTCTCGTCATAATGTTGCCATATC
AAGTTCAAAGAAAATCTATCTTTACGCTTTCAAAGAAGTTATGTCTGCTG
ATTTACCAGAGGATGATAGTGTCCTCACAATTGATTTCATACGCATGGTA
GAAGTTGAAACCACTATCAATATAAGAAGTGTAGCTTTTTCATTAAATTG
GATTGCCTTTGCCTCCAAAACTGAAATTCGTGTTATTCAAGTTTATCTTC
ACCAACCATCAGATGAAAAGGTTTATCAAGGAGAAGACGTTTCTGAACTT
CTTGAGTGTTTTGATGAGGTTGGCAAGAGCGTTTTCACCAAAAGACTTTC
TCAACATGTTACCGTCAGATATGAATGTTAATTTCATGTTACCTTACCTG
GCTGAATGCAATGAATTTCATCGATCTTCGTCGCTCAAAAGTCAAATCTT
ACAAACTTATAAAACTCAAATCGAGATTCATGAAAACCTTTAATGGCAAC
AACTTTTACAATGCTTGCTGGAGTACATCAGAGCGAATAAATTTGAACCG
TGGAACTATGATGTTTACATGGAAACACTGAAAGGCAGTTGATTATATCG
TGGCGAATTACCCGGCGTTGATCCTACAGTATGCCAAAGATATGTTCGAT
TGGAAAGCTCAGTCATTGCTGTGTTCAAGATACAACCGAAAGGAGTTCAG
TTTACATGTCATCGAGAAATTGAAAGATTCAGATTTTGTTGGAAAAGAAG
CATTGTTGTTGCTGGCCTGGCCCAAAGCTGGAATGGCTCAAGAGGTGAAT
CACCTTCTCCGCAAGACTGTATCATCCTCAAAAACAATCAAAAGTCACGT
TCAAATGACACTAGTGGTGGTACAGGACGAAAACAAAACGATCAACAAAG
CATGGCTTTATCCTTACCAAGTACTGGATTGACCACCAGTAATCCTTCGT
CACCATCCAGATCAAAGATTCTTTCACCATCATCGATGGATGACACAAAT
CATGAAACATCCAAAATCTTGAAATCAAGAGAATTTTGTCCGTGTTGCTG
TTGCAGTGAAATATTGATCAAATTTCAGATCAAAGGCAATGGGCATTATG
GTACACGCTTCACTTGGCTCAATAAGTTAAAACCATTTTCAGGTGATCTT
AGTGGACCAGTACTTACTGCGCATGACAAAGAAAATGAATACTAATGATG
GTTGGAAAATCAAACATAACCACGAGATTCATCTCGTCGAAAGAGCTTCC
AAGAAATTGCGGCAAAAGGAAAGGCTGAAGACAATGAGAAAAGAATTCCA
CTTGATCGACAAGCTTGTCAAATACTTGAAAATCTTCTAAATGTTAATGA
AGAAGCATTTCAAAGAGAGTTTCCAGAGCATTGTAATTTCTCTGTTCGAT
ACACGCACAATCGACTTGAATAATATCCTTCAAATATTCCAGGACGATTT
GCTAAAGATTTGTATTTCAAATACTGAAGTGTTATTCAACTCACAATATC
AATTGACGCCCATGGGACAGACTACAACCACTGGACAGCTTATGTTTTGC
TTACTTGCACATGGACTTGGGGAACCCAGGGCACGCGGAAGAGCTTTTGA
AAGAACTGGAAAAGATTTATGTGTCAAACTGATGAGCAAATACAAGCGGA
AAAAAGAATCAAAAGAACAGAGAATATTTGTGATTTCATCATCAATGTGT
ATGGCAAGAATCATCCATCAATGCTAGCAAAAGTGATCTTAAAATCCAAT
CTACCTCGTCTCTATTCAATTGAAACACAGTTTTGGAACTGGAATGATTG
AATATCTGAACAATACTCTATTCGGCAAAGAACAAGTACAATTCGATAAG
ATGTGAACCAAGTTTTGATTTCACCAGCGTCAAAGGGTACTTCGAAATGG
CTGGAATGCAACCTACAGCCGTCCTTGAACACATGAACAATGAAAACATA
AGACTCGAGCGAAAGAGAGAAGGGCGGCGCAACATCATCACCATGGAGTG
TATGCAGCTTCGAAAAACACATCTCAACGGATGTGGGTCAAAAGATTACC
AAACTAATTGAAGAAAGTGAATTTTCGAATCCCATGGTGTATTATCATTT
ACTGTGTGAATCACATCTTTTACTTTGTTGTGATTTGATGAGCAGACCAA
ACGATGAAATTTTGATCAAAGCATTGAAATCATCAGCCGTCTCACTTGCA
ACCTTCTTAATGAGACTTGTCCACCGAAGGATCTGGAAACTTGTTTGGTT
GGTATGTATCCATACCAAGATGTTGTTTGTGTGGCAACTAGTATGTCCTT
CGTCCTCATGTTCATCAAAGTCCCTAAAAGAACAAACAGCTGGTAAATCA
AAACAACCTTATCGTGCTCGAGATCGTGGACCAACAGAGATCTTCCTGGA
AACCAATTACTTCATGGATTACGTGTCTGTCAATAAAGATCTCTCCATGA
TCGAAGATGGTGGACTGGGCCCTAGTAATGATATTGAGCCAAGAAAAAGA
ACCCATTCTTCGGCCTATGATAGATACCCATATCAATGGCTTTTAAAGAT
ATCGCTGAACACAAACAATTGGAAGTTGAGGAGAAAATGCCATGGCCTTG
GAATGCTTTCTTAAAACCACACTCCTTCCCAGTTCTCCTCTCCATGCCTC
TTTTTTTCTCAACTGGAACACATGGTTACCTCTACGACACGTGGAACTCA
AAAGGACTCATCTTAGACTACAGTTACACGTCAGATTGTTTGAGTGCCAA
ACATACAAATTCACTTCTATACACTGTCACCAGTAATGGATTGGAGATTT
TCACTTCTCGCCTTTATCCCTTTGTTTCTGGATGTACAAAAGAAATGTTT
AAAGAATGCAAGTTTTCCAAAAATGCCGAAATAGCTAATAAAGGTGAACA
TACAATCCTTGTTGGTCACCCACTATGTTGCTCGTTCCTTGGACAGATGC
CCACCAAAGAAGGTCACGTCAATTATGCCACAGTCACCAGTACTACACAT
CTGTATCGAAGATTTGAGGAGGATGATATCTCTTTCTCGGGAAACACTGA
AAGAATACATAGTCTACAATGGCTGCCTATCTTTTTGGAAGTGACTCAAC
AACCCAAACAGACGGTCTTGAGAAAACCACAGTCTCAGTTCTCACATCAA
AACCATCAAAGTCAAATAACATGCCAGTACAAACGACGTTATGGGATTTT
GACCAAGCTACTTCCACTTCATCAATCAATGAATTCGAATCTAAAGGTGG
TCATGGTATGATGCAAATGCAATCTATCCAGGAAGAGAAACCTTACATTG
ATACTAAATCATCTTCCAAAGAAGTGACAGATGGTACGTACTGTACTTTG
CCATCCATTTGTGGAGCAAAAGAATTTCACTGACCAATACGATGCATCGT
GTATTTGCTGCACCAATGATGATAAAGTTCTCATTGGTTCATTGTATGGT
AGCATCAGCATAATTGATCTCAAAGGTGGTACACATAATGTTTTACACAA
ATTTCCTTCAAATGGAATCCCAATCAAAATGTTGTTTTCTGATGATAAGC
AATTCTTGGTGTCACTTGAATCTAAGCTTCAAGATTATCGTGTTGGATTA
TCAGCTAGGGAAATGAACTGTCAAGCTAGAGTATATTCAAATATTATGCT
TGGTAACCCACAGAAGAATGTTGCCCCTTTAAGTAGCGGGTATTCAATTA
ACCGACACAATAATAATCATACACGAAACAAGTTTTCTGTTATTGATTTT
GCTGGTTTACGTCAACCTGCAACTGATATTGCCCTATGTAACTCTCGTCA
TAATGTTGCCATATCAAGTTCAAAGAAAATCTATCTTTACGCTTTCAAAG
AAGTTATGTCTGCTGATTTACCAGAGGATGATAGTGTCCTCACAATTGAT
TTCATACGCATGGTAGAAGTTGAAACCACTATCAATATAAGAAGTGTAGC
TTTTTCATTAAATTGGATTGCCTTTGCCTCCAAAACTGAAATTCGTGTTA
TTCAAGTTTATCTTCACCAACCATCAGATGAAAAGGTTTATCAAGGAGAA
GACGTTTCTGAACTTCTTGAGTGTTTTGATGAGGTTGGCAAGAGCGTTTT
CACCAAAAGACTTTCTCAACATGTTACCGTCAGATATGAATGTTAATTTC
ATGTTACCTTACCTGGCTGAATGCAATGAATTTCATCGATCTTCGTCGCT
CAAAAGTCAAATCTTACAAACTTATAAAACTCAAATCGAGATTCATGAAA
ACCTTTAATGGCAACAACTTTTACAATGCTTGCTGGAGTACATCAGAGCG
AATAAATTTGAACCGTGGAACTATGATGTTTACATGGAAACACTGAAAGG
CAGTTGATTATATCGTGGCGAATTACCCGGCGTTGATCCTACAGTATGCC
AAAGATATGTTCGATTGGAAAGCTCAGTCATTGCTGTGTTCAAGATACAA
CCGAAAGGAGTTCAGTTTACATGTCATCGAGAAATTGAAAGATTCAGATT
TTGTTGGAAAAGAAGCATTGTTGTTGCTGGCCTGGCCCAAAGCTGGAATG
GCTCAAGAGGTGAATCACCTTCTCCGCAAGACTGTATCATCCTCAAAAAC
AATCAAAAGTCACGTTCAAATGACACTAGTGGTGGTACAGGACGAAAACA
AAACGATCAACAAAGCATGGCTTTATCCTTACCAAGTACTGGATTGACCA
CCAGTAATCCTTCGTCACCATCCAGATCAAAGATTCTTTCACCATCATCG
ATGGATGACACAAATCATGAAACATCCAAAATCTTGAAATCAAGAGAATT
TTGTCCGTGTTGCTGTTGCAGTGAAATATTGATCAAATTTCAGATCAAAG
GCAATGGGCATTATGGTACACGCTTCACTTGGCTCAATAAGTTAAAACCA
TTTTCAGGTGATCTTAGTGGACCAGTACTTACTGCGCATGACAAAGAAAA
TGAATACTAATGATGGTTGGAAAATCAAACATAACCACGAGATTCATCTC
GTCGAAAGAGCTTCCAAGAAATTGCGGCAAAAGGAAAGGCTGAAGACAAT
GAGAAAAGAATTCCACTTGATCGACAAGCTTGTCAAATACTTGAAAATCT
TCTAAATGTTAATGAAGAAGCATTTCAAAGAGAGTTTCCAGAGCATTGTA
ATTTCTCTGTTCGATACACGCACAATCGACTTGAATAATATCCTTCAAAT
ATTCCAGGACGATTTGCTAAAGATTTGTATTTCAAATACTGAAGTGTTAT
TCAACTCACAATATCAATTGACGCCCATGGGACAGACTACAACCACTGGA
CAGCTTATGTTTTGCTTACTTGCACATGGACTTGGGGAACCCAGGGCACG
CGGAAGAGCTTTTGAAAGAACTGGAAAAGATTTATGTGTCAAACTGATGA
GCAAATACAAGCGGAAAAAAGAATCAAAAGAACAGAGAATATTTGTGATT
TCATCATCAATGTGTATGGCAAGAATCATCCATCAATGCTAGCAAAAGTG
ATCTTAAAATCCAATCTACCTCGTCTCTATTCAATTGAAACACAGTTTTG
GAACTGGAATGATTGAATATCTGAACAATACTCTATTCGGCAAAGAACAA
GTACAATTCGATAAGATGTGAACCAAGTTTTGATTTCACCAGCGTCAAAG
GGTACTTCGAAATGGCTGGAATGCAACCTACAGCCGTCCTTGAACACATG
AACAATGAAAACATAAGACTCGAGCGAAAGAGAGAAGGGCGGCGCAACAT
CATCACCATGGAGTGTATGCAGCTTCGAAAAACACATCTCAACGGATGTG
GGTCAAAAGATTACCAAACTAATTGAAGAAAGTGAATTTTCGAATCCCAT
GGTGTATTATCATTTACTGTGTGAATCACATCTTTTACTTTGTTGTGATT
TGATGAGCAGACCAAACGATGAAATTTTGATCAAAGCATTGAAATCATCA
GCCGTCTCACTTGCAACCTTCTTAATGAGACTTGTCCACCGAAGGATCTG
GAAACTTGTTTGGTTGGTATGTATCCATACCAAGATGTTGTTTGTGTGGC
AACTAGTATGTCCTTCGTCCTCATGTTCATCAAAGTCCCTAAAAGAACAA
ACAGCTGGTAAATCAAAACAACCTTATCGTGCTCGAGATCGTGGACCAAC
AGAGATCTTCCTGGAAACCAATTACTTCATGGATTACGTGTCTGTCAATA
AAGATCTCTCCATGATCGAAGATGGTGGACTGGGCCCTAGTAATGATATT
GAGCCAAGAAAAAGAACCCATTCTTCGGCCTATGATAGATACCCATATCA
ATGGCTTTTAAAGATATCGCTGAACACAAACAATTGGAAGTTGAGGAGAA
AATGCCATGGCCTTGGAATGCTTTCTTAAAACCACACTCCTTCCCAGTTC
TCCTCTCCATGCCTCTTTTTTTCTCAACTGGAACACATGGTTACCTCTAC
GACACGTGGAACTCAAAAGGACTCATCTTAGACTACAGTTACACGTCAGA
TTGTTTGAGTGCCAAACATACAAATTCACTTCTATACACTGTCACCAGTA
ATGGATTGGAGATTTTCACTTCTCGCCTTTATCCCTTTGTTTCTGGATGT
ACAAAAGAAATGTTTAAAGAATGCAAGTTTTCCAAAAATGCCGAAATAGC
TAATAAAGGTGAACATACAATCCTTGTTGGTCACCCACTATGTTGCTCGT
TCCTTGGACAGATGCCCACCAAAGAAGGTCACGTCAATTATGCCACAGTC
ACCAGTACTACACATCTGTATCGAAGATTTGAGGAGGATGATATCTCTTT
CTCGGGAAACACTGAAAGAATACATAGTCTACAATGGCTGCCTATCTTTT
TGGAAGTGACTCAACAACCCAAACAGACGGTCTTGAGAAAACCACAGTCT
CAGTTCTCACATCAAAACCATCAAAGTCAAATAACATGCCAGTACAAACG
ACGTTATGGGATTTTGACCAAGCTACTTCCACTTCATCAATCAATGAATT
CGAATCTAAAGGTGGTCATGGTATGATGCAAATGCAATCTATCCAGGAAG
AGAAACCTTACATTGATACTAAATCATCTTCCAAAGAAGTGACAGATGGT
ACGTACTGTACTTTGCCATCCATTTGTGGAGCAAAAGAATTTCACTGACC
AATACGATGCATCGTGTATTTGCTGCACCAATGATGATAAAGTTCTCATT
GGTTCATTGTATGGTAGCATCAGCATAATTGATCTCAAAGGTGGTACACA
TAATGTTTTACACAAATTTCCTTCAAATGGAATCCCAATCAAAATGTTGT
TTTCTGATGATAAGCAATTCTTGGTGTCACTTGAATCTAAGCTTCAAGAT
TATCGTGTTGGATTATCAGCTAGGGAAATGAACTGTCAAGCTAGAGTATA
TTCAAATATTATGCTTGGTAACCCACAGAAGAATGTTGCCCCTTTAAGTA
GCGGGTATTCAATTAACCGACACAATAATAATCATACACGAAACAAGTTT
TCTGTTATTGATTTTGCTGGTTTACGTCAACCTGCAACTGATATTGCCCT
ATGTAACTCTCGTCATAATGTTGCCATATCAAGTTCAAAGAAAATCTATC
TTTACGCTTTCAAAGAAGTTATGTCTGCTGATTTACCAGAGGATGATAGT
GTCCTCACAATTGATTTCATACGCATGGTAGAAGTTGAAACCACTATCAA
TATAAGAAGTGTAGCTTTTTCATTAAATTGGATTGCCTTTGCCTCCAAAA
CTGAAATTCGTGTTATTCAAGTTTATCTTCACCAACCATCAGATGAAAAG
GTTTATCAAGGAGAAGACGTTTCTGAACTTCTTGAGTGTTTTGATGAGGT
TGGCAAGAGCGTTTTCACCAAAAGACTTTCTCAACATGTTACCGTCAGAT
ATGAATGTTAATTTCATGTTACCTTACCTGGCTGAATGCAATGAATTTCA
TCGATCTTCGTCGCTCAAAAGTCAAATCTTACAAACTTATAAAACTCAAA
TCGAGATTCATGAAAACCTTTAATGGCAACAACTTTTACAATGCTTGCTG
GAGTACATCAGAGCGAATAAATTTGAACCGTGGAACTATGATGTTTACAT
GGAAACACTGAAAGGCAGTTGATTATATCGTGGCGAATTACCCGGCGTTG
ATCCTACAGTATGCCAAAGATATGTTCGATTGGAAAGCTCAGTCATTGCT
GTGTTCAAGATACAACCGAAAGGAGTTCAGTTTACATGTCATCGAGAAAT
TGAAAGATTCAGATTTTGTTGGAAAAGAAGCATTGTTGTTGCTGGCCTGG
CCCAAAGCTGGAATGGCTCAAGAGGTGAATCACCTTCTCCGCAAGACTGT
ATCATCCTCAAAAACAATCAAAAGTCACGTTCAAATGACACTAGTGGTGG
TACAGGACGAAAACAAAACGATCAACAAAGCATGGCTTTATCCTTACCAA
GTACTGGATTGACCACCAGTAATCCTTCGTCACCATCCAGATCAAAGATT
CTTTCACCATCATCGATGGATGACACAAATCATGAAACATCCAAAATCTT
GAAATCAAGAGAATTTTGTCCGTGTTGCTGTTGCAGTGAAATATTGATCA
AATTTCAGATCAAAGGCAATGGGCATTATGGTACACGCTTCACTTGGCTC
AATAAGTTAAAACCATTTTCAGGTGATCTTAGTGGACCAGTACTTACTGC
GCATGACAAAGAAAATGAATACTAATGATGGTTGGAAAATCAAACATAAC
CACGAGATTCATCTCGTCGAAAGAGCTTCCAAGAAATTGCGGCAAAAGGA
AAGGCTGAAGACAATGAGAAAAGAATTCCACTTGATCGACAAGCTTGTCA
AATACTTGAAAATCTTCTAAATGTTAATGAAGAAGCATTTCAAAGAGAGT
TTCCAGAGCATTGTAATTTCTCTGTTCGATACACGCACAATCGACTTGAA
TAATATCCTTCAAATATTCCAGGACGATTTGCTAAAGATTTGTATTTCAA
ATACTGAAGTGTTATTCAACTCACAATATCAATTGACGCCCATGGGACAG
ACTACAACCACTGGACAGCTTATGTTTTGCTTACTTGCACATGGACTTGG
GGAACCCAGGGCACGCGGAAGAGCTTTTGAAAGAACTGGAAAAGATTTAT
GTGTCAAACTGATGAGCAAATACAAGCGGAAAAAAGAATCAAAAGAACAG
AGAATATTTGTGATTTCATCATCAATGTGTATGGCAAGAATCATCCATCA
ATGCTAGCAAAAGTGATCTTAAAATCCAATCTACCTCGTCTCTATTCAAT
TGAAACACAGTTTTGGAACTGGAATGATTGAATATCTGAACAATACTCTA
TTCGGCAAAGAACAAGTACAATTCGATAAGATGTGAACCAAGTTTTGATT
TCACCAGCGTCAAAGGGTACTTCGAAATGGCTGGAATGCAACCTACAGCC
GTCCTTGAACACATGAACAATGAAAACATAAGACTCGAGCGAAAGAGAGA
AGGGCGGCGCAACATCATCACCATGGAGTGTATGCAGCTTCGAAAAACAC
ATCTCAACGGATGTGGGTCAAAAGATTACCAAACTAATTGAAGAAAGTGA
ATTTTCGAATCCCATGGTGTATTATCATTTACTGTGTGAATCACATCTTT
TACTTTGTTGTGATTTGATGAGCAGACCAAACGATGAAATTTTGATCAAA
GCATTGAAATCATCAGCCGTCTCACTTGCAACCTTCTTAATGAGACTTGT
CCACCGAAGGATCTGGAAACTTGTTTGGTTGGTATGTATCCATACCAAGA
TGTTGTTTGTGTGGCAACTAGTATGTCCTTCGTCCTCATGTTCATCAAAG
TCCCTAAAAGAACAAACAGCTGGTAAATCAAAACAACCTTATCGTGCTCG
AGATCGTGGACCAACAGAGATCTTCCTGGAAACCAATTACTTCATGGATT
ACGTGTCTGTCAATAAAGATCTCTCCATGATCGAAGATGGTGGACTGGGC
CCTAGTAATGATATTGAGCCAAGAAAAAGAACCCATTCTTCGGCCTATGA
TAGATACCCATATCAATGGCTTTTAAAGATATCGCTGAACACAAACAATT
GGAAGTTGAGGAGAAAATGCCATGGCCTTGGAATGCTTTCTTAAAACCAC
ACTCCTTCCCAGTTCTCCTCTCCATGCCTCTTTTTTTCTCAACTGGAACA
CATGGTTACCTCTACGACACGTGGAACTCAAAAGGACTCATCTTAGACTA
CAGTTACACGTCAGATTGTTTGAGTGCCAAACATACAAATTCACTTCTAT
ACACTGTCACCAGTAATGGATTGGAGATTTTCACTTCTCGCCTTTATCCC
TTTGTTTCTGGATGTACAAAAGAAATGTTTAAAGAATGCAAGTTTTCCAA
AAATGCCGAAATAGCTAATAAAGGTGAACATACAATCCTTGTTGGTCACC
CACTATGTTGCTCGTTCCTTGGACAGATGCCCACCAAAGAAGGTCACGTC
AATTATGCCACAGTCACCAGTACTACACATCTGTATCGAAGATTTGAGGA
GGATGATATCTCTTTCTCGGGAAACACTGAAAGAATACATAGTCTACAAT
GGCTGCCTATCTTTTTGGAAGTGACTCAACAACCCAAACAGACGGTCTTG
AGAAAACCACAGTCTCAGTTCTCACATCAAAACCATCAAAGTCAAATAAC
ATGCCAGTACAAACGACGTTATGGGATTTTGACCAAGCTACTTCCACTTC
ATCAATCAATGAATTCGAATCTAAAGGTGGTCATGGTATGATGCAAATGC
AATCTATCCAGGAAGAGAAACCTTACATTGATACTAAATCATCTTCCAAA
GAAGTGACAGATGGTACGTACTGTACTTTGCCATCCATTTGTGGAGCAAA
AGAATTTCACTGACCAATACGATGCATCGTGTATTTGCTGCACCAATGAT
GATAAAGTTCTCATTGGTTCATTGTATGGTAGCATCAGCATAATTGATCT
CAAAGGTGGTACACATAATGTTTTACACAAATTTCCTTCAAATGGAATCC
CAATCAAAATGTTGTTTTCTGATGATAAGCAATTCTTGGTGTCACTTGAA
TCTAAGCTTCAAGATTATCGTGTTGGATTATCAGCTAGGGAAATGAACTG
TCAAGCTAGAGTATATTCAAATATTATGCTTGGTAACCCACAGAAGAATG
TTGCCCCTTTAAGTAGCGGGTATTCAATTAACCGACACAATAATAATCAT
ACACGAAACAAGTTTTCTGTTATTGATTTTGCTGGTTTACGTCAACCTGC
AACTGATATTGCCCTATGTAACTCTCGTCATAATGTTGCCATATCAAGTT
CAAAGAAAATCTATCTTTACGCTTTCAAAGAAGTTATGTCTGCTGATTTA
CCAGAGGATGATAGTGTCCTCACAATTGATTTCATACGCATGGTAGAAGT
TGAAACCACTATCAATATAAGAAGTGTAGCTTTTTCATTAAATTGGATTG
CCTTTGCCTCCAAAACTGAAATTCGTGTTATTCAAGTTTATCTTCACCAA
CCATCAGATGAAAAGGTTTATCAAGGAGAAGACGTTTCTGAACTTCTTGA
GTGTTTTGATGAGGTTGGCAAGAGCGTTTTCACCAAAAGACTTTCTCAAC
ATGTTACCGTCAGATATGAATGTTAATTTCATGTTACCTTACCTGGCTGA
ATGCAATGAATTTCATCGATCTTCGTCGCTCAAAAGTCAAATCTTACAAA
CTTATAAAACTCAAATCGAGATTCATGAAAACCTTTAATGGCAACAACTT
TTACAATGCTTGCTGGAGTACATCAGAGCGAATAAATTTGAACCGTGGAA
CTATGATGTTTACATGGAAACACTGAAAGGCAGTTGATTATATCGTGGCG
AATTACCCGGCGTTGATCCTACAGTATGCCAAAGATATGTTCGATTGGAA
AGCTCAGTCATTGCTGTGTTCAAGATACAACCGAAAGGAGTTCAGTTTAC
ATGTCATCGAGAAATTGAAAGATTCAGATTTTGTTGGAAAAGAAGCATTG
TTGTTGCTGGCCTGGCCCAAAGCTGGAATGGCTCAAGAGGTGAATCACCT
TCTCCGCAAGACTGTATCATCCTCAAAAACAATCAAAAGTCACGTTCAAA
TGACACTAGTGGTGGTACAGGACGAAAACAAAACGATCAACAAAGCATGG
CTTTATCCTTACCAAGTACTGGATTGACCACCAGTAATCCTTCGTCACCA
TCCAGATCAAAGATTCTTTCACCATCATCGATGGATGACACAAATCATGA
AACATCCAAAATCTTGAAATCAAGAGAATTTTGTCCGTGTTGCTGTTGCA
GTGAAATATTGATCAAATTTCAGATCAAAGGCAATGGGCATTATGGTACA
CGCTTCACTTGGCTCAATAAGTTAAAACCATTTTCAGGTGATCTTAGTGG
ACCAGTACTTACTGCGCATGACAAAGAAAATGAATACTAATGATGGTTGG
AAAATCAAACATAACCACGAGATTCATCTCGTCGAAAGAGCTTCCAAGAA
ATTGCGGCAAAAGGAAAGGCTGAAGACAATGAGAAAAGAATTCCACTTGA
TCGACAAGCTTGTCAAATACTTGAAAATCTTCTAAATGTTAATGAAGAAG
CATTTCAAAGAGAGTTTCCAGAGCATTGTAATTTCTCTGTTCGATACACG
CACAATCGACTTGAATAATATCCTTCAAATATTCCAGGACGATTTGCTAA
AGATTTGTATTTCAAATACTGAAGTGTTATTCAACTCACAATATCAATTG
ACGCCCATGGGACAGACTACAACCACTGGACAGCTTATGTTTTGCTTACT
TGCACATGGACTTGGGGAACCCAGGGCACGCGGAAGAGCTTTTGAAAGAA
CTGGAAAAGATTTATGTGTCAAACTGATGAGCAAATACAAGCGGAAAAAA
GAATCAAAAGAACAGAGAATATTTGTGATTTCATCATCAATGTGTATGGC
AAGAATCATCCATCAATGCTAGCAAAAGTGATCTTAAAATCCAATCTACC
TCGTCTCTATTCAATTGAAACACAGTTTTGGAACTGGAATGATTGAATAT
CTGAACAATACTCTATTCGGCAAAGAACAAGTACAATTCGATAAGATGTG
AACCAAGTTTTGATTTCACCAGCGTCAAAGGGTACTTCGAAATGGCTGGA
ATGCAACCTACAGCCGTCCTTGAACACATGAACAATGAAAACATAAGACT
CGAGCGAAAGAGAGAAGGGCGGCGCAACATCATCACCATGGAGTGTATGC
AGCTTCGAAAAACACATCTCAACGGATGTGGGTCAAAAGATTACCAAACT
AATTGAAGAAAGTGAATTTTCGAATCCCATGGTGTATTATCATTTACTGT
GTGAATCACATCTTTTACTTTGTTGTGATTTGATGAGCAGACCAAACGAT
GAAATTTTGATCAAAGCATTGAAATCATCAGCCGTCTCACTTGCAACCTT
CTTAATGAGACTTGTCCACCGAAGGATCTGGAAACTTGTTTGGTTGGTAT
GTATCCATACCAAGATGTTGTTTGTGTGGCAACTAGTATGTCCTTCGTCC
TCATGTTCATCAAAGTCCCTAAAAGAACAAACAGCTGGTAAATCAAAACA
ACCTTATCGTGCTCGAGATCGTGGACCAACAGAGATCTTCCTGGAAACCA
ATTACTTCATGGATTACGTGTCTGTCAATAAAGATCTCTCCATGATCGAA
GATGGTGGACTGGGCCCTAGTAATGATATTGAGCCAAGAAAAAGAACCCA
TTCTTCGGCCTATGATAGATACCCATATCAATGGCTTTTAAAGATATCGC
TGAACACAAACAATTGGAAGTTGAGGAGAAAATGCCATGGCCTTGGAATG
CTTTCTTAAAACCACACTCCTTCCCAGTTCTCCTCTCCATGCCTCTTTTT
TTCTCAACTGGAACACATGGTTACCTCTACGACACGTGGAACTCAAAAGG
ACTCATCTTAGACTACAGTTACACGTCAGATTGTTTGAGTGCCAAACATA
CAAATTCACTTCTATACACTGTCACCAGTAATGGATTGGAGATTTTCACT
TCTCGCCTTTATCCCTTTGTTTCTGGATGTACAAAAGAAATGTTTAAAGA
ATGCAAGTTTTCCAAAAATGCCGAAATAGCTAATAAAGGTGAACATACAA
TCCTTGTTGGTCACCCACTATGTTGCTCGTTCCTTGGACAGATGCCCACC
AAAGAAGGTCACGTCAATTATGCCACAGTCACCAGTACTACACATCTGTA
TCGAAGATTTGAGGAGGATGATATCTCTTTCTCGGGAAACACTGAAAGAA
TACATAGTCTACAATGGCTGCCTATCTTTTTGGAAGTGACTCAACAACCC
AAACAGACGGTCTTGAGAAAACCACAGTCTCAGTTCTCACATCAAAACCA
TCAAAGTCAAATAACATGCCAGTACAAACGACGTTATGGGATTTTGACCA
AGCTACTTCCACTTCATCAATCAATGAATTCGAATCTAAAGGTGGTCATG
GTATGATGCAAATGCAATCTATCCAGGAAGAGAAACCTTACATTGATACT
AAATCATCTTCCAAAGAAGTGACAGATGGTACGTACTGTACTTTGCCATC
CATTTGTGGAGCAAAAGAATTTCACTGACCAATACGATGCATCGTGTATT
TGCTGCACCAATGATGATAAAGTTCTCATTGGTTCATTGTATGGTAGCAT
CAGCATAATTGATCTCAAAGGTGGTACACATAATGTTTTACACAAATTTC
CTTCAAATGGAATCCCAATCAAAATGTTGTTTTCTGATGATAAGCAATTC
TTGGTGTCACTTGAATCTAAGCTTCAAGATTATCGTGTTGGATTATCAGC
TAGGGAAATGAACTGTCAAGCTAGAGTATATTCAAATATTATGCTTGGTA
ACCCACAGAAGAATGTTGCCCCTTTAAGTAGCGGGTATTCAATTAACCGA
CACAATAATAATCATACACGAAACAAGTTTTCTGTTATTGATTTTGCTGG
TTTACGTCAACCTGCAACTGATATTGCCCTATGTAACTCTCGTCATAATG
TTGCCATATCAAGTTCAAAGAAAATCTATCTTTACGCTTTCAAAGAAGTT
ATGTCTGCTGATTTACCAGAGGATGATAGTGTCCTCACAATTGATTTCAT
ACGCATGGTAGAAGTTGAAACCACTATCAATATAAGAAGTGTAGCTTTTT
CATTAAATTGGATTGCCTTTGCCTCCAAAACTGAAATTCGTGTTATTCAA
GTTTATCTTCACCAACCATCAGATGAAAAGGTTTATCAAGGAGAAGACGT
TTCTGAACTTCTTGAGTGTTTTGATGAGGTTGGCAAGAGCGTTTTCACCA
AAAGACTTTCTCAACATGTTACCGTCAGATATGAATGTTAATTTCATGTT
ACCTTACCTGGCTGAATGCAATGAATTTCATCGATCTTCGTCGCTCAAAA
GTCAAATCTTACAAACTTATAAAACTCAAATCGAGATTCATGAAAACCTT
TAATGGCAACAACTTTTACAATGCTTGCTGGAGTACATCAGAGCGAATAA
ATTTGAACCGTGGAACTATGATGTTTACATGGAAACACTGAAAGGCAGTT
GATTATATCGTGGCGAATTACCCGGCGTTGATCCTACAGTATGCCAAAGA
TATGTTCGATTGGAAAGCTCAGTCATTGCTGTGTTCAAGATACAACCGAA
AGGAGTTCAGTTTACATGTCATCGAGAAATTGAAAGATTCAGATTTTGTT
GGAAAAGAAGCATTGTTGTTGCTGGCCTGGCCCAAAGCTGGAATGGCTCA
AGAGGTGAATCACCTTCTCCGCAAGACTGTATCATCCTCAAAAACAATCA
AAAGTCACGTTCAAATGACACTAGTGGTGGTACAGGACGAAAACAAAACG
ATCAACAAAGCATGGCTTTATCCTTACCAAGTACTGGATTGACCACCAGT
AATCCTTCGTCACCATCCAGATCAAAGATTCTTTCACCATCATCGATGGA
TGACACAAATCATGAAACATCCAAAATCTTGAAATCAAGAGAATTTTGTC
CGTGTTGCTGTTGCAGTGAAATATTGATCAAATTTCAGATCAAAGGCAAT
GGGCATTATGGTACACGCTTCACTTGGCTCAATAAGTTAAAACCATTTTC
AGGTGATCTTAGTGGACCAGTACTTACTGCGCATGACAAAGAAAATGAAT
ACTAATGATGGTTGGAAAATCAAACATAACCACGAGATTCATCTCGTCGA
AAGAGCTTCCAAGAAATTGCGGCAAAAGGAAAGGCTGAAGACAATGAGAA
AAGAATTCCACTTGATCGACAAGCTTGTCAAATACTTGAAAATCTTCTAA
ATGTTAATGAAGAAGCATTTCAAAGAGAGTTTCCAGAGCATTGTAATTTC
TCTGTTCGATACACGCACAATCGACTTGAATAATATCCTTCAAATATTCC
AGGACGATTTGCTAAAGATTTGTATTTCAAATACTGAAGTGTTATTCAAC
TCACAATATCAATTGACGCCCATGGGACAGACTACAACCACTGGACAGCT
TATGTTTTGCTTACTTGCACATGGACTTGGGGAACCCAGGGCACGCGGAA
GAGCTTTTGAAAGAACTGGAAAAGATTTATGTGTCAAACTGATGAGCAAA
TACAAGCGGAAAAAAGAATCAAAAGAACAGAGAATATTTGTGATTTCATC
ATCAATGTGTATGGCAAGAATCATCCATCAATGCTAGCAAAAGTGATCTT
AAAATCCAATCTACCTCGTCTCTATTCAATTGAAACACAGTTTTGGAACT
GGAATGATTGAATATCTGAACAATACTCTATTCGGCAAAGAACAAGTACA
ATTCGATAAGATGTGAACCAAGTTTTGATTTCACCAGCGTCAAAGGGTAC
TTCGAAATGGCTGGAATGCAACCTACAGCCGTCCTTGAACACATGAACAA
TGAAAACATAAGACTCGAGCGAAAGAGAGAAGGGCGGCGCAACATCATCA
CCATGGAGTGTATGCAGCTTCGAAAAACACATCTCAACGGATGTGGGTCA
AAAGATTACCAAACTAATTGAAGAAAGTGAATTTTCGAATCCCATGGTGT
ATTATCATTTACTGTGTGAATCACATCTTTTACTTTGTTGTGATTTGATG
AGCAGACCAAACGATGAAATTTTGATCAAAGCATTGAAATCATCAGCCGT
CTCACTTGCAACCTTCTTAATGAGACTTGTCCACCGAAGGATCTGGAAAC
TTGTTTGGTTGGTATGTATCCATACCAAGATGTTGTTTGTGTGGCAACTA
GTATGTCCTTCGTCCTCATGTTCATCAAAGTCCCTAAAAGAACAAACAGC
TGGTAAATCAAAACAACCTTATCGTGCTCGAGATCGTGGACCAACAGAGA
TCTTCCTGGAAACCAATTACTTCATGGATTACGTGTCTGTCAATAAAGAT
CTCTCCATGATCGAAGATGGTGGACTGGGCCCTAGTAATGATATTGAGCC
AAGAAAAAGAACCCATTCTTCGGCCTATGATAGATACCCATATCAATGGC
TTTTAAAGATATCGCTGAACACAAACAATTGGAAGTTGAGGAGAAAATGC
CATGGCCTTGGAATGCTTTCTTAAAACCACACTCCTTCCCAGTTCTCCTC
TCCATGCCTCTTTTTTTCTCAACTGGAACACATGGTTACCTCTACGACAC
GTGGAACTCAAAAGGACTCATCTTAGACTACAGTTACACGTCAGATTGTT
TGAGTGCCAAACATACAAATTCACTTCTATACACTGTCACCAGTAATGGA
TTGGAGATTTTCACTTCTCGCCTTTATCCCTTTGTTTCTGGATGTACAAA
AGAAATGTTTAAAGAATGCAAGTTTTCCAAAAATGCCGAAATAGCTAATA
AAGGTGAACATACAATCCTTGTTGGTCACCCACTATGTTGCTCGTTCCTT
GGACAGATGCCCACCAAAGAAGGTCACGTCAATTATGCCACAGTCACCAG
TACTACACATCTGTATCGAAGATTTGAGGAGGATGATATCTCTTTCTCGG
GAAACACTGAAAGAATACATAGTCTACAATGGCTGCCTATCTTTTTGGAA
GTGACTCAACAACCCAAACAGACGGTCTTGAGAAAACCACAGTCTCAGTT
CTCACATCAAAACCATCAAAGTCAAATAACATGCCAGTACAAACGACGTT
ATGGGATTTTGACCAAGCTACTTCCACTTCATCAATCAATGAATTCGAAT
CTAAAGGTGGTCATGGTATGATGCAAATGCAATCTATCCAGGAAGAGAAA
CCTTACATTGATACTAAATCATCTTCCAAAGAAGTGACAGATGGTACGTA
CTGTACTTTGCCATCCATTTGTGGAGCAAAAGAATTTCACTGACCAATAC
GATGCATCGTGTATTTGCTGCACCAATGATGATAAAGTTCTCATTGGTTC
ATTGTATGGTAGCATCAGCATAATTGATCTCAAAGGTGGTACACATAATG
TTTTACACAAATTTCCTTCAAATGGAATCCCAATCAAAATGTTGTTTTCT
GATGATAAGCAATTCTTGGTGTCACTTGAATCTAAGCTTCAAGATTATCG
TGTTGGATTATCAGCTAGGGAAATGAACTGTCAAGCTAGAGTATATTCAA
ATATTATGCTTGGTAACCCACAGAAGAATGTTGCCCCTTTAAGTAGCGGG
TATTCAATTAACCGACACAATAATAATCATACACGAAACAAGTTTTCTGT
TATTGATTTTGCTGGTTTACGTCAACCTGCAACTGATATTGCCCTATGTA
ACTCTCGTCATAATGTTGCCATATCAAGTTCAAAGAAAATCTATCTTTAC
GCTTTCAAAGAAGTTATGTCTGCTGATTTACCAGAGGATGATAGTGTCCT
CACAATTGATTTCATACGCATGGTAGAAGTTGAAACCACTATCAATATAA
GAAGTGTAGCTTTTTCATTAAATTGGATTGCCTTTGCCTCCAAAACTGAA
ATTCGTGTTATTCAAGTTTATCTTCACCAACCATCAGATGAAAAGGTTTA
TCAAGGAGAAGACGTTTCTGAACTTCTTGAGTGTTTTGATGAGGTTGGCA
AGAGCGTTTTCACCAAAAGACTTTCTCAACATGTTACCGTCAGATATGAA
TGTTAATTTCATGTTACCTTACCTGGCTGAATGCAATGAATTTCATCGAT
CTTCGTCGCTCAAAAGTCAAATCTTACAAACTTATAAAACTCAAATCGAG
ATTCATGAAAACCTTTAATGGCAACAACTTTTACAATGCTTGCTGGAGTA
CATCAGAGCGAATAAATTTGAACCGTGGAACTATGATGTTTACATGGAAA
CACTGAAAGGCAGTTGATTATATCGTGGCGAATTACCCGGCGTTGATCCT
ACAGTATGCCAAAGATATGTTCGATTGGAAAGCTCAGTCATTGCTGTGTT
CAAGATACAACCGAAAGGAGTTCAGTTTACATGTCATCGAGAAATTGAAA
GATTCAGATTTTGTTGGAAAAGAAGCATTGTTGTTGCTGGCCTGGCCCAA
AGCTGGAATGGCTCAAGAGGTGAATCACCTTCTCCGCAAGACTGTATCAT
CCTCAAAAACAATCAAAAGTCACGTTCAAATGACACTAGTGGTGGTACAG
GACGAAAACAAAACGATCAACAAAGCATGGCTTTATCCTTACCAAGTACT
GGATTGACCACCAGTAATCCTTCGTCACCATCCAGATCAAAGATTCTTTC
ACCATCATCGATGGATGACACAAATCATGAAACATCCAAAATCTTGAAAT
CAAGAGAATTTTGTCCGTGTTGCTGTTGCAGTGAAATATTGATCAAATTT
CAGATCAAAGGCAATGGGCATTATGGTACACGCTTCACTTGGCTCAATAA
GTTAAAACCATTTTCAGGTGATCTTAGTGGACCAGTACTTACTGCGCATG
ACAAAGAAAATGAATACTAATGATGGTTGGAAAATCAAACATAACCACGA
GATTCATCTCGTCGAAAGAGCTTCCAAGAAATTGCGGCAAAAGGAAAGGC
TGAAGACAATGAGAAAAGAATTCCACTTGATCGACAAGCTTGTCAAATAC
TTGAAAATCTTCTAAATGTTAATGAAGAAGCATTTCAAAGAGAGTTTCCA
GAGCATTGTAATTTCTCTGTTCGATACACGCACAATCGACTTGAATAATA
TCCTTCAAATATTCCAGGACGATTTGCTAAAGATTTGTATTTCAAATACT
GAAGTGTTATTCAACTCACAATATCAATTGACGCCCATGGGACAGACTAC
AACCACTGGACAGCTTATGTTTTGCTTACTTGCACATGGACTTGGGGAAC
CCAGGGCACGCGGAAGAGCTTTTGAAAGAACTGGAAAAGATTTATGTGTC
AAACTGATGAGCAAATACAAGCGGAAAAAAGAATCAAAAGAACAGAGAAT
ATTTGTGATTTCATCATCAATGTGTATGGCAAGAATCATCCATCAATGCT
AGCAAAAGTGATCTTAAAATCCAATCTACCTCGTCTCTATTCAATTGAAA
CACAGTTTTGGAACTGGAATGATTGAATATCTGAACAATACTCTATTCGG
CAAAGAACAAGTACAATTCGATAAGATGTGAACCAAGTTTTGATTTCACC
AGCGTCAAAGGGTACTTCGAAATGGCTGGAATGCAACCTACAGCCGTCCT
TGAACACATGAACAATGAAAACATAAGACTCGAGCGAAAGAGAGAAGGGC
GGCGCAACATCATCACCATGGAGTGTATGCAGCTTCGAAAAACACATCTC
AACGGATGTGGGTCAAAAGATTACCAAACTAATTGAAGAAAGTGAATTTT
CGAATCCCATGGTGTATTATCATTTACTGTGTGAATCACATCTTTTACTT
TGTTGTGATTTGATGAGCAGACCAAACGATGAAATTTTGATCAAAGCATT
GAAATCATCAGCCGTCTCACTTGCAACCTTCTTAATGAGACTTGTCCACC
GAAGGATCTGGAAACTTGTTTGGTTGGTATGTATCCATACCAAGATGTTG
TTTGTGTGGCAACTAGTATGTCCTTCGTCCTCATGTTCATCAAAGTCCCT
AAAAGAACAAACAGCTGGTAAATCAAAACAACCTTATCGTGCTCGAGATC
GTGGACCAACAGAGATCTTCCTGGAAACCAATTACTTCATGGATTACGTG
TCTGTCAATAAAGATCTCTCCATGATCGAAGATGGTGGACTGGGCCCTAG
TAATGATATTGAGCCAAGAAAAAGAACCCATTCTTCGGCCTATGATAGAT
ACCCATATCAATGGCTTTTAAAGATATCGCTGAACACAAACAATTGGAAG
TTGAGGAGAAAATGCCATGGCCTTGGAATGCTTTCTTAAAACCACACTCC
TTCCCAGTTCTCCTCTCCATGCCTCTTTTTTTCTCAACTGGAACACATGG
TTACCTCTACGACACGTGGAACTCAAAAGGACTCATCTTAGACTACAGTT
ACACGTCAGATTGTTTGAGTGCCAAACATACAAATTCACTTCTATACACT
GTCACCAGTAATGGATTGGAGATTTTCACTTCTCGCCTTTATCCCTTTGT
TTCTGGATGTACAAAAGAAATGTTTAAAGAATGCAAGTTTTCCAAAAATG
CCGAAATAGCTAATAAAGGTGAACATACAATCCTTGTTGGTCACCCACTA
TGTTGCTCGTTCCTTGGACAGATGCCCACCAAAGAAGGTCACGTCAATTA
TGCCACAGTCACCAGTACTACACATCTGTATCGAAGATTTGAGGAGGATG
ATATCTCTTTCTCGGGAAACACTGAAAGAATACATAGTCTACAATGGCTG
CCTATCTTTTTGGAAGTGACTCAACAACCCAAACAGACGGTCTTGAGAAA
ACCACAGTCTCAGTTCTCACATCAAAACCATCAAAGTCAAATAACATGCC
AGTACAAACGACGTTATGGGATTTTGACCAAGCTACTTCCACTTCATCAA
TCAATGAATTCGAATCTAAAGGTGGTCATGGTATGATGCAAATGCAATCT
ATCCAGGAAGAGAAACCTTACATTGATACTAAATCATCTTCCAAAGAAGT
GACAGATGGTACGTACTGTACTTTGCCATCCATTTGTGGAGCAAAAGAAT
TTCACTGACCAATACGATGCATCGTGTATTTGCTGCACCAATGATGATAA
AGTTCTCATTGGTTCATTGTATGGTAGCATCAGCATAATTGATCTCAAAG
GTGGTACACATAATGTTTTACACAAATTTCCTTCAAATGGAATCCCAATC
AAAATGTTGTTTTCTGATGATAAGCAATTCTTGGTGTCACTTGAATCTAA
GCTTCAAGATTATCGTGTTGGATTATCAGCTAGGGAAATGAACTGTCAAG
CTAGAGTATATTCAAATATTATGCTTGGTAACCCACAGAAGAATGTTGCC
CCTTTAAGTAGCGGGTATTCAATTAACCGACACAATAATAATCATACACG
AAACAAGTTTTCTGTTATTGATTTTGCTGGTTTACGTCAACCTGCAACTG
ATATTGCCCTATGTAACTCTCGTCATAATGTTGCCATATCAAGTTCAAAG
AAAATCTATCTTTACGCTTTCAAAGAAGTTATGTCTGCTGATTTACCAGA
GGATGATAGTGTCCTCACAATTGATTTCATACGCATGGTAGAAGTTGAAA
CCACTATCAATATAAGAAGTGTAGCTTTTTCATTAAATTGGATTGCCTTT
GCCTCCAAAACTGAAATTCGTGTTATTCAAGTTTATCTTCACCAACCATC
AGATGAAAAGGTTTATCAAGGAGAAGACGTTTCTGAACTTCTTGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_001007XLOC_001007Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001950-proteinTCONS_00001950-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001950-exon-sc0000012-1575043694:706587..706669TCONS_00001950-exon-sc0000012-1575043694:706587..706669Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1575043694:692163..692910TCONS_00001950-exon-sc0000012-1575043694:692163..692910Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1575043694:691605..691843TCONS_00001950-exon-sc0000012-1575043694:691605..691843Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1575043694:690529..690726TCONS_00001950-exon-sc0000012-1575043694:690529..690726Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1575043694:687348..687692TCONS_00001950-exon-sc0000012-1575043694:687348..687692Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1575043694:686852..687063TCONS_00001950-exon-sc0000012-1575043694:686852..687063Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1575043694:686175..686296TCONS_00001950-exon-sc0000012-1575043694:686175..686296Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1575043694:685053..685301TCONS_00001950-exon-sc0000012-1575043694:685053..685301Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1575043694:684525..684639TCONS_00001950-exon-sc0000012-1575043694:684525..684639Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1575043694:683883..683960TCONS_00001950-exon-sc0000012-1575043694:683883..683960Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1575043694:683506..683605TCONS_00001950-exon-sc0000012-1575043694:683506..683605Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1575043694:683073..683130TCONS_00001950-exon-sc0000012-1575043694:683073..683130Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1575043694:682241..682334TCONS_00001950-exon-sc0000012-1575043694:682241..682334Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1575043694:681885..681962TCONS_00001950-exon-sc0000012-1575043694:681885..681962Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1575043694:681521..681619TCONS_00001950-exon-sc0000012-1575043694:681521..681619Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1575043694:681274..681355TCONS_00001950-exon-sc0000012-1575043694:681274..681355Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1575043694:680936..680970TCONS_00001950-exon-sc0000012-1575043694:680936..680970Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1575043694:680278..680361TCONS_00001950-exon-sc0000012-1575043694:680278..680361Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1575043694:679757..679820TCONS_00001950-exon-sc0000012-1575043694:679757..679820Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1575043694:679272..679555TCONS_00001950-exon-sc0000012-1575043694:679272..679555Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1575043694:678792..678923TCONS_00001950-exon-sc0000012-1575043694:678792..678923Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1575043694:669872..669949TCONS_00001950-exon-sc0000012-1575043694:669872..669949Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1575043694:669179..669269TCONS_00001950-exon-sc0000012-1575043694:669179..669269Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1575043694:666048..667479TCONS_00001950-exon-sc0000012-1575043694:666048..667479Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1510915933:706587..706669TCONS_00001950-exon-sc0000012-1510915933:706587..706669Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1510915933:692163..692910TCONS_00001950-exon-sc0000012-1510915933:692163..692910Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1510915933:691605..691843TCONS_00001950-exon-sc0000012-1510915933:691605..691843Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1510915933:690529..690726TCONS_00001950-exon-sc0000012-1510915933:690529..690726Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1510915933:687348..687692TCONS_00001950-exon-sc0000012-1510915933:687348..687692Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1510915933:686852..687063TCONS_00001950-exon-sc0000012-1510915933:686852..687063Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1510915933:686175..686296TCONS_00001950-exon-sc0000012-1510915933:686175..686296Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1510915933:685053..685301TCONS_00001950-exon-sc0000012-1510915933:685053..685301Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1510915933:684525..684639TCONS_00001950-exon-sc0000012-1510915933:684525..684639Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1510915933:683883..683960TCONS_00001950-exon-sc0000012-1510915933:683883..683960Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1510915933:683506..683605TCONS_00001950-exon-sc0000012-1510915933:683506..683605Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1510915933:683073..683130TCONS_00001950-exon-sc0000012-1510915933:683073..683130Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1510915933:682241..682334TCONS_00001950-exon-sc0000012-1510915933:682241..682334Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1510915933:681885..681962TCONS_00001950-exon-sc0000012-1510915933:681885..681962Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1510915933:681521..681619TCONS_00001950-exon-sc0000012-1510915933:681521..681619Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1510915933:681274..681355TCONS_00001950-exon-sc0000012-1510915933:681274..681355Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1510915933:680936..680970TCONS_00001950-exon-sc0000012-1510915933:680936..680970Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1510915933:680278..680361TCONS_00001950-exon-sc0000012-1510915933:680278..680361Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1510915933:679757..679820TCONS_00001950-exon-sc0000012-1510915933:679757..679820Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1510915933:679272..679555TCONS_00001950-exon-sc0000012-1510915933:679272..679555Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1510915933:678792..678923TCONS_00001950-exon-sc0000012-1510915933:678792..678923Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1510915933:669872..669949TCONS_00001950-exon-sc0000012-1510915933:669872..669949Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1510915933:669179..669269TCONS_00001950-exon-sc0000012-1510915933:669179..669269Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1510915933:666048..667479TCONS_00001950-exon-sc0000012-1510915933:666048..667479Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1491911889:706587..706669TCONS_00001950-exon-sc0000012-1491911889:706587..706669Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1491911889:692163..692910TCONS_00001950-exon-sc0000012-1491911889:692163..692910Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1491911889:691605..691843TCONS_00001950-exon-sc0000012-1491911889:691605..691843Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1491911889:690529..690726TCONS_00001950-exon-sc0000012-1491911889:690529..690726Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1491911889:687348..687692TCONS_00001950-exon-sc0000012-1491911889:687348..687692Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1491911889:686852..687063TCONS_00001950-exon-sc0000012-1491911889:686852..687063Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1491911889:686175..686296TCONS_00001950-exon-sc0000012-1491911889:686175..686296Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1491911889:685053..685301TCONS_00001950-exon-sc0000012-1491911889:685053..685301Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1491911889:684525..684639TCONS_00001950-exon-sc0000012-1491911889:684525..684639Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1491911889:683883..683960TCONS_00001950-exon-sc0000012-1491911889:683883..683960Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1491911889:683506..683605TCONS_00001950-exon-sc0000012-1491911889:683506..683605Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1491911889:683073..683130TCONS_00001950-exon-sc0000012-1491911889:683073..683130Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1491911889:682241..682334TCONS_00001950-exon-sc0000012-1491911889:682241..682334Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1491911889:681885..681962TCONS_00001950-exon-sc0000012-1491911889:681885..681962Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1491911889:681521..681619TCONS_00001950-exon-sc0000012-1491911889:681521..681619Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1491911889:681274..681355TCONS_00001950-exon-sc0000012-1491911889:681274..681355Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1491911889:680936..680970TCONS_00001950-exon-sc0000012-1491911889:680936..680970Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1491911889:680278..680361TCONS_00001950-exon-sc0000012-1491911889:680278..680361Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1491911889:679757..679820TCONS_00001950-exon-sc0000012-1491911889:679757..679820Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1491911889:679272..679555TCONS_00001950-exon-sc0000012-1491911889:679272..679555Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1491911889:678792..678923TCONS_00001950-exon-sc0000012-1491911889:678792..678923Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1491911889:669872..669949TCONS_00001950-exon-sc0000012-1491911889:669872..669949Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1491911889:669179..669269TCONS_00001950-exon-sc0000012-1491911889:669179..669269Clytia hemisphaericaexon
TCONS_00001950-exon-sc0000012-1491911889:666048..667479TCONS_00001950-exon-sc0000012-1491911889:666048..667479Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000012supercontigsc0000012:666048..706669 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.000174911 2.1548e-09 1.0259e-09 2.03756e-07 1.6998e-09 8.13415e-11 2.40446e-10 0 0 0 3.50769e-08 1.64843e-05 6.12176e-09 7.64177e-11 0 0 0 0 0.000104582 1.01626e-10 1.25085e-07 1.57559e-09 1.42628e-07 1.14051e-06 0 0.363922 1.74951e-10 3.92875e-09 3.36509e-08 0.000152507
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR029438HPS3_C
IPR029437HPS3_N
IPR028167HPS3_central_dom
IPR011990TPR-like_helical_dom
IPR015943WD40/YVTN_repeat-like_dom
IPR017986WD40_repeat_dom
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005515 protein binding
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00001950 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top