Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001950-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001950-protein
Unique NameTCONS_00001950-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1254

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001950-protein ID=TCONS_00001950-protein|Name=TCONS_00001950-protein|organism=Clytia hemisphaerica|type=polypeptide|length=1254bp
MVRTVLCHPFVEQKNFTDQYDASCICCTNDDKVLIGSLYGSISIIDLKGG
THNVLHKFPSNGIPIKMLFSDDKQFLVSLESKLQDYRVGLSAREMNCQAR
VYSNIMLGNPQKNVAPLSSGYSINRHNNNHTRNKFSVIDFAGLRQPATDI
ALCNSRHNVAISSSKKIYLYAFKEVMSADLPEDDSVLTIDFIRMVEVETT
INIRSVAFSLNWIAFASKTEIRVIQVYLHQPSDEKVYQGEDVSELLDDST
TQTDGLEKTTVSVLTSKPSKSNNMPVQTTLWDFDQATSTSSINEFESKGG
HGMMQMQSIQEEKPYIDTKSSSKEVTGEHTILVGHPLCCSFLGQMPTKEG
HVNYATVTSTTHLYRRFEEDDISFSGNTERIHSLQWLPIFLEDIAEHKQL
EVEEKMPWPWNAFLKPHSFPVLLSMPLFFSTGTHGYLYDTWNSKGLILDY
SYTSDCLSAKHTNSLLYTVTSNGLEIFTSRLYPFVSGCTKEMFKECKFSK
NAEIANKAAGKSKQPYRARDRGPTEIFLETNYFMDYVSVNKDLSMIEDGG
LGPSNDIEPRKRTHSSAYDRYPYQWLLKTCPPKDLETCLVGMYPYQDVVC
VATSMSFVLMFIKVPKRTKEKGGATSSPWSVCSFEKHISTDVGQKITKLI
EESEFSNPMVYYHLLCESHLLLCCDLMSRPNDEILIKALKSSAVSLATFL
MRCEPSFDFTSVKGYFEMAGMQPTAVLEHMNNENIRLERKKHSFGTGMIE
YLNNTLFGKEQVQFDKNICDFIINVYGKNHPSMLAKVILKSNLPRLYSID
LCVKLMSKYKRKKESKEQRLQPLDSLCFAYLHMDLGNPGHAEELLKELEK
DDLLKICISNTEVLFNSQYQLTPMGQLMKKHFKESFQSIVISLFDTRTID
LNNILQIFQAKGKAEDNEKRIPLDRQACQILENLLNDSSRRKSFQEIAVI
LVDQYLLRMTKKMNTNDGWKIKHNHEIKGNGHYGTRFTWLNKLKPFSGES
PSPQDCIILKNNQKSRSNDTSGGTGRKQNDQQSMALSLPSTGLTTSNPSS
PSRSKILSPSSMDDTNHETSKILKSREFCPCCCCSEILIKFQSLLCSRYN
RKEFSLHVIEKLKDSDFVGKEALLLLAWPKAGMAQEAVDYIVANYPALIL
QYAKDMFDWKAQWQQLLQCLLEYIRANKFEPWNYDVYMETLKGVLMRLAR
AFSPKDFLNMLPSDMNVNFMLPYLAECNEFHRSSSLKSQILQTYKTQIEI
HENL
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_001007XLOC_001007Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001950TCONS_00001950Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR029438HPS3_C
IPR029437HPS3_N
IPR028167HPS3_central_dom
IPR011990TPR-like_helical_dom
IPR015943WD40/YVTN_repeat-like_dom
IPR017986WD40_repeat_dom
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005515 protein binding
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029438Hermansky-Pudlak syndrome 3 protein, C-terminal domainPFAMPF14763HPS3_Ccoord: 1072..1228
e-value: 9.7E-16
score: 58.0
IPR029437Hermansky-Pudlak syndrome 3 protein, N-terminal domainPFAMPF14761HPS3_Ncoord: 5..226
e-value: 1.6E-25
score: 89.9
IPR028167Hermansky-Pudlak syndrome 3, central regionPFAMPF14762HPS3_Midcoord: 356..481
e-value: 2.5E-16
score: 59.4
coord: 576..784
e-value: 1.9E-16
score: 59.7
IPR011990Tetratricopeptide-like helical domainGENE3D1.25.40.10coord: 1053..1254
e-value: 5.4E-6
score: 25.3
IPR015943WD40/YVTN repeat-like-containing domainGENE3D2.130.10.10coord: 8..480
e-value: 2.0E-7
score: 29.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1010..1067
IPR017986WD40-repeat-containing domainSUPERFAMILY50978WD40 repeat-likecoord: 21..227

Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00001950-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top