Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001940 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001940
Unique NameTCONS_00001940
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1313

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001940 ID=TCONS_00001940|Name=TCONS_00001940|organism=Clytia hemisphaerica|type=transcript|length=1313bp
ctTACATTACGTTATGAAAATCATGAATTCATTGTTATGCTTGCTATGTT
ATCTAATATAGCATTtaacatttcaataaaaaccttAGTTTTCTATTAAG
CTAAACAAGTTGTGAATTAAATTTTACTGGGAGCTTACCCCTTCGCTACA
CAAGCAAGGAAAATGAGGATGAGCGCTCTGGTTTTCCATCACTGGATCTA
AATTTTGCAGCTGGGTTGGAACAAATTTCTGAACTGAATAAAATCTCAAC
AACAATAACTTTCGTATTGGGTGGAGTTGAGGAGACTTGCAAATGTTTAC
CGTTACATCCACAAACGGCTTTTTGCCAAGCAAATTTTGTCATGAAAGGA
ACAATCATATCGGATCGTCACGAGAAGTTGATGGAAACAGAAATTACAAA
GTCGATGAAAATGCCACCTTTACAGATTGTCTATTATGATGTTTTGGTTA
GCAGAGTTCACAAAGGATTCGAGAAAATATCTGAAGTTGTTGGTATTAAA
GATTCATTCTTAATGAAAATTCCAGTCTATTTATCACAAAGCGGTGCTGT
TTGTAAGTTCAAtcttaaaaaaggtaaaaaatatttgattatgGGTCGCA
TCGTTGCTAAACAACTACAAATTACACATTGCAGTTTTGTGAAAGAACTT
CACACCTTATCTAAGACAGTCAAACATGGTATTAAAGGGCACTATGACTG
CAAATGTCCAGTGACAATGTGTGTCGGTGGTTACTGTGATCAAGACCATG
GATGCAAATGGAATGTCGCTTGGGATCAACCAGTGGATGAATGTATCATA
AAACATAAATCTTGTCATCAAATACCAGACAAAAAGAATCCATCAGAAAT
TCATTGTCATTGGACTAAAAACTCTTTGAGATACAATAAATGCAATTCGA
AAAAAAGACTTATAGCCGAGTTGAAAATGAGGAAAGCTGAAAGATTactt
ttaaagaactttcaattataattttttttctaccaAGGTATGAATGCATA
TACACAATttgtaaagatatttttatttgcttgtaaaattatttcattct
gacaaattattttatttccttttaattttttcccaaaattttcttttgta
tatATGATTCTCCTTATTTTTCGGTATTGTAAATAATATATAGTAACTGT
ATGATGAGAATCTAGACAcatgacatttttcaaaacattacgTATTTGAA
AGAGATTCCTTTGCACTttcccaaaccacacccatgtTATACAAACCTGG
TAGTTTCCCTTTCTGTGGCAAATATATTTGAAAGATTTACATGGTTATAA
TAAATGAATACAC
Run BLAST on NCBI

protein sequence of TCONS_00001940-protein

>TCONS_00001940-protein ID=TCONS_00001940-protein|Name=TCONS_00001940-protein|organism=Clytia hemisphaerica|type=polypeptide|length=209bp
MKGTIISDRHEKLMETEITKSMKMPPLQIVYYDVLVSRVHKGFEKISEVV
GIKDSFLMKIPVYLSQSGAVCKFNLKKGKKYLIMGRIVAKQLQITHCSFV
KELHTLSKTVKHGIKGHYDCKCPVTMCVGGYCDQDHGCKWNVAWDQPVDE
CIIKHKSCHQIPDKKNPSEIHCHWTKNSLRYNKCNSKKRLIAELKMRKAE
RLLLKNFQL
Run BLAST on NCBI

transcript from alignment at sc0000012:535577..541447-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001940 ID=TCONS_00001940|Name=TCONS_00001940|organism=Clytia hemisphaerica|type=transcript|length=5871bp|location=Sequence derived from alignment at sc0000012:535577..541447- (Clytia hemisphaerica)
CTTACATTACGTTATGAAAATCATGAATTCATTGTTATGCTTGCTATGTT ATCTAATATAGCATTTAACATTTCAATAAAAACCTTAGTTTTCTATTAAG CTAAACAAGTTGTGAATTAAATTTTACTGGGAGCTTACCCCTTCGCTACA CAAGCAAGGAAAATGAGGATGAGCGCTCTGGTTTTCCATCACTGGATCTA AATTTTGCAGCTGGGTTGGAACAAATTTCTGAACTGAATAAAATCTCAAC AACAATGTACGTACCTATTATACTGCTTTTGTTGGAGGGTTTATGCACAA GTTAAATCACCTTGGGGAGGGGGCGGTGCAGTGATAGAAATTCTGAAAAT GATGTTATTCCTAGGAGAAAGATGGTAGAGTGAGATGCGGAAAAAACAAA GCTTAGAGAAGTTACGACCCGTGGAATACTACCGGGTGCGCCACAAAAAA GTTTTTCTCTTTAAAGTGAATTTTCTCGAAGTCTAAAAATTTAGAAATAA CCAATCCTTTTCCATTGGAATGAAGAAAGATAAACTTAAATTTTGATAGG TCATTTATAAAATTTGGTTCATTAGATCAAAAGTTATGCTCAATTGAATA AAAAAGTTACTTTCAAAAAGTGCTCGAAAACGTTAAAAATTTACCTATCA AAATTTTTATTTTTAAAATTTGGCAATTGCAATAGCCTTTACATGATTAA GAGCATTTTTGAGTAACTTAACACATAAATTTTGAAATTGAAGGGTTGAA TAGATTTTAAATCTTCATCAAAATCAATTTAATTTATTTTTACCGAAATT TTCCTCAGATTTTTTTATTCTAGACTGGATAAAGTCCATGTAAGGCTGGA TCTACCTCGAAACCCATATTTCATGTATTTTTATGAATTTTATTAGATTT TTTGGCCTTTTTCGACGAATTTTCTTCTTTTCATTGAGATTCAACCTTTC TTTATATAACAAAAGGTCATTTAGACAACTAATTATCATTTTTAATGACT GCAACGAGAGTACTGATGTATCATGTAATTATATACTGCTGTTTAAGGGC TCTGACCATAGTGAATTTTTCATAATTGCCGTGTTTAAAATGTGTTTTCT GACTGATGTAACCAACAAAACTATGGCATGTTATACATTTTCTGTTAGAC AAACTATTCCTGAATCTGAAAATTCAAAAATTACATTGAAAAAATGTGAT GAAGAAGAAAATGAAGAACTTTTGAAGACTTTTGCGAGGAAGAGTACTTC AACTTTGACGAGCTTAGTTTCGGCGAAGAAAAAACATTTTGAAAAATTTT TCGCAGTAGATGGTTTATCTTTTACCGAACAATAAAAATTTTTGCGGAAA ATTTTTGTAAATGCTTCTTTGTCTCAAAATCTTCAAAATAGTGGATTTTC ATCAATTTTACATCTGGATTTTGCTTAAAAAAACAGTCATAACTTTTGAC ACATCTTTTTAGAAAAATTTCCCGCAAAATCTAAAATAGTTCAATTCTTT GCGGACAGTTTGAAAAAACTTCTAAACAAAAAGGTTAATTACCCATTAAA ACTTAGCACTTTTTATAAAAGAAGGTGATGCAACATATTATTAACGTCTT TTTAAAGTTCATAACGTCATTTTTGNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAGGCA ATTCTTTGTTAAAAGTGTTAAAGAATCTAAAACATAACTTTCATGTTCAG ATACTAAAATCAATTTTCCGACTATGGTCAGAGCCCTTAATTTGATAAGT CGATTTTTAAAATTTTTGAGCCCTTTCCGAAAGTAACTTTTTTATTCAAT TGAGCATAACCTTTGATCTAGTGAATCGAATTTAATAAATGACCCATCAA AATTTAAGTTTATCTTTCTTCTTTCCAATGAAAAAGGATTGGTTATTTTT AAAATTTTAGACTTTGAGAAAATCAGTTTCAAACTTTTTTGTGGCGCACC CGGTACAATCCGTGCTGAAATATATTGGCAATTTTGGGTATTTTAACGTT TTTCAGAATTTAAAGCTCGGGCAAGAATTGCAATTTCAGTACTTCCACTT TGTTTCAGGGGATTTTTCGATTTGGGAGGGATGAAGTGGCTTCCAGGCTA TGTTCTCAACCATATTGGAACATTTTTGAGATTTCAGATCCTGAGATCCT ATGGTCACAAGCCGTAAGACTAATGTTAAAACTCGGAGTTAAAACTCTAC TTTCTAACCGCGCTTAATAATCACTTGAGGTTTTAAAGTTTGAGGAAATT CCCCTTTTGTGCAAAATATTTCGGCGCCGATTGTAGGGTTGGAAAATGAC GGGTATGTTCCGAACCGGACCTAATAAAGACCTCATAAATTTTTTGAACA TTCATAGTTTCTTACCCATTCAAAAAACCTAAAAATGGGAAAAGACTGTT TTGGCTATTTGTTGTTCATGTAACAGAGAGACTAAAAAAATCAACCCTTA AAGTCCGTACATAACAAGCACCTATTTTTACCTAAGGACCCCCCCGGAGT TACGTACACCAAAGACTTTGCTCGATCACGAATGGATATTGATGAACTGA CAGCAATCAAAGTTTATTTTACACTTACATAAATTCAGGTGCACTGTGAA TTTGAAAACGAGGTAATCCTCTTAATGGGAAATTATTTTACAAGGACTGT CTGATAAAATAATTATGTGCCACCTGGGTAATTCTCTTTACAGCTTTTAG GTTAAGAAACTTTTAAACTCGATTCAAAAATAATTTGTGATAGTGAAAAA GGTAGCCTTTGTAATCCCGAATCATTTTCACCTAGTTAAATCATTTTAAA AACCAAGTTAAAGAAAAAACTGAGTTATGATGTATAATTTTTGAAAAATT ATGTTGTTTTCATAAATCCTGGCAGGATTAATTTATTCTTAATTTTAATT TTGTAACTCACTTTTATTTTTTTATGAAAATATGAAAATTTCGATCGACA TAATGACTCATTTTGTTTGTAATTCGGCTTTTTTGAATCGGGTAAAAACA GCTGAGGATTTCCGATTTTCTTCAACTTGAATTTTTAAATCAACTGAAGG CACATTTATTTAGCTTTTTACGGTGAAAAGTCCATTCTGAAGGGAGTCTT TGTCATAGAAATACGAAGCTTCAAGTACAACAAGGTCGAGATAAAAAAGT TTGAGATTTTGATTGACAGCTTTCTTTTTTTGTCACTTTAATGAAATTTG CCAATTTCATGGTCAACTTGTAACGAGCTTTTAAGTCTAATTTCCCATTA ATGAAATGCTGGATGAATGTAATTTTTTTCAGCAGTGGAAAGAATACAAT ATTTCTTTTACACTTCTTACGCTTTTAGATGATGAAAGTCTTGAGTTACC TTTTTCTGGAAGAACTTAATTGATGTCCAATGTCAAACCCTTGTGTACTT AACAAAAAAGAACAAAAAAGCTGTTTGAAGTAAATTATTAATCACAAAAA GCTTAGTAGGTCTGTTTTAAGCTAACCTAAAAACTAAGCTGAATGGTTCA GTACTTCTTTCAAAAAATTGCCTTATTTTTCAGCATACACGTTTTTTTAT AAGATCATCTAAAATTTTTGAAGCCTTCGGACGAGGGGCAAATCACTAAA ATAAATCTCGTACACAATTTTATAAATCAAAAATAAATCAATAAATCAAA AATAAATCATGAATAAATCATAAATAAATAAAAAATAAATAAAACATTTT TCGAAAAAAAATTGACTTTTCAACTTTTTTTAATTTTTTGACAATGATTT TGATTATCAGTTCGTTATAATTTGAAAAAAAAAATCCATAAAATTACTCC TATTAATAAATTAGAGATGAATCAAAAATAATTCAAAAAAAAATCATAAA TAAATCATAAATCAAAAATAAATCAAAAATAAATCATAAATAAAAGATAA ATCAGAAATAAATCATAAATCAAAAATAAATCAAAAAAAAAATCATAAAT AAAAAAAAAATCATAAATCTCGTACACCATTTTTCGAGTGATTTGCCCCT CGCCTTCGGATATTCTTAACTTTTTGAGTTTTAAGCCTAAAAATGTTCTT AACCTGTTCTTAATACTTTGGCTGGTAAAGCCTTATGTTCTTATATAGTT TGTTCTTATAAAAAACGTGTACTTTATTGTGATACACCCTATACAACAAA CATATTTCTAGGAAGTTTGCTTTTTAAAGGAGGGTGATAGAAGGATGGAG GGGGAGAGTAGAATGTCAACATTTTTATTGAAGTCACGTTACGTCAATTA CTCAAGTATATAACAATGATTCTGATGATTTGACAGGCATGTAAATTAGT ATAAATAGACCGTCATTTAGATTGAAACAAGTCAGTTTAGTTTACCCATT CAAACAGTTTGTCGGCGGTAAAGAAAGATTAAAAGGATATTGTTGCGTTG GAATTGTCCGCAAAGCTATAGTTTGACTTATACAGGAAAAATGATTCTCA CTTCAGTTCTGTTACTTTTATCGTTCAGAACTTTCGTATTGGGTGGAGTT GAGGAGACTTGCAAATGTTTACCGTTACATCCACAAACGGCTTTTTGCCA AGCAAATTTTGGTAAGCTTTCTTGATTTTCATGTTTTGTTTTTGTAATCT GAAACTCGAAGGTGTGAAACCTGACACTTAAGTCTCTTAAGGTACGCACA TACCCAGCCTTCCTTTCCCAGTCTTCCTTAACCTTTTGACCAACAAAACT TTATAACCGATAAACAAAGGTCTTATGATTTTTCTTTCCTATTCCAGTCA TGAAAGGAACAATCATATCGGATCGTCACGAGAAGTTGATGGAAACAGAA ATTACAAAGTCGATGAAAATGCCACCTTTACAGATTGTCTATTATGATGT TTTGGTTAGCAGAGTTCACAAAGGATTCGAGAAAATATCTGAAGTTGTTG GTATTAAAGATTCATTCTTAATGAAAATTCCAGTCTATTTATCACAAAGC GGTGCTGTTTGTAAGTTCAATCTTAAAAAAGGTAAAAAATATTTGATTAT GGGTCGCATCGTTGCTAAACAACTACAAATTACACATTGCAGTTTTGTGA AAGAACTTCACACCTTATCTAAGACAGTCAAACATGGTATTAAAGGGCAC TATGACTGCAAATGTCCAGTGACAATGTGTGTCGGTGGTTACTGTGATCA AGACCATGGATGCAAATGGAATGTCGCTTGGGATCAACCAGTGGATGAAT GTATCATAAAACATAAATCTTGTCATCAAATACCAGACAAAAAGAATCCA TCAGAAATTCATTGTCATTGGACTAAAAACTCTTTGAGATACAATAAATG CAATTCGAAAAAAAGACTTATAGCCGAGTTGAAAATGAGGAAAGCTGAAA GATTACTTTTAAAGAACTTTCAATTATAATTTTTTTTCTACCAAGGTATG AATGCATATACACAATTTGTAAAGATATTTTTATTTGCTTGTAAAATTAT TTCATTCTGACAAATTATTTTATTTCCTTTTAATTTTTTCCCAAAATTTT CTTTTGTATATATGATTCTCCTTATTTTTCGGTATTGTAAATAATATATA GTAACTGTATGATGAGAATCTAGACACATGACATTTTTCAAAACATTACG TATTTGAAAGAGATTCCTTTGCACTTTCCCAAACCACACCCATGTTATAC AAACCTGGTAGTTTCCCTTTCTGTGGCAAATATATTTGAAAGATTTACAT GGTTATAATAAATGAATACAC

Coding sequence (CDS) from alignment at sc0000012:535577..541447-

>TCONS_00001940 ID=TCONS_00001940|Name=TCONS_00001940|organism=Clytia hemisphaerica|type=CDS|length=630bp|location=Sequence derived from alignment at sc0000012:535577..541447- (Clytia hemisphaerica)
ATGAAAGGAACAATCATATCGGATCGTCACGAGAAGTTGATGGAAACAGA
AATTACAAAGTCGATGAAAATGCCACCTTTACAGATTGTCTATTATGATG
TTTTGGTTAGCAGAGTTCACAAAGGATTCGAGAAAATATCTGAAGTTGTT
GGTATTAAAGATTCATTCTTAATGAAAATTCCAGTCTATTTATCACAAAG
CGGTGCTGTTTGTAAGTTCAATCTTAAAAAAGGTAAAAAATATTTGATTA
TGGGTCGCATCGTTGCTAAACAACTACAAATTACACATTGCAGTTTTGTG
AAAGAACTTCACACCTTATCTAAGACAGTCAAACATGGTATTAAAGGGCA
CTATGACTGCAAATGTCCAGTGACAATGTGTGTCGGTGGTTACTGTGATC
AAGACCATGGATGCAAATGGAATGTCGCTTGGGATCAACCAGTGGATGAA
TGTATCATAAAACATAAATCTTGTCATCAAATACCAGACAAAAAGAATCC
ATCAGAAATTCATTGTCATTGGACTAAAAACTCTTTGAGATACAATAAAT
GCAATTCGAAAAAAAGACTTATAGCCGAGTTGAAAATGAGGAAAGCTGAA
AGATTACTTTTAAAGAACTTTCAATTATAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_001003XLOC_001003Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001940-exon-sc0000012-1575043694:541192..541447TCONS_00001940-exon-sc0000012-1575043694:541192..541447Clytia hemisphaericaexon
TCONS_00001940-exon-sc0000012-1575043694:536737..536819TCONS_00001940-exon-sc0000012-1575043694:536737..536819Clytia hemisphaericaexon
TCONS_00001940-exon-sc0000012-1575043694:535577..536550TCONS_00001940-exon-sc0000012-1575043694:535577..536550Clytia hemisphaericaexon
TCONS_00001940-exon-sc0000012-1510915933:541192..541447TCONS_00001940-exon-sc0000012-1510915933:541192..541447Clytia hemisphaericaexon
TCONS_00001940-exon-sc0000012-1510915933:536737..536819TCONS_00001940-exon-sc0000012-1510915933:536737..536819Clytia hemisphaericaexon
TCONS_00001940-exon-sc0000012-1510915933:535577..536550TCONS_00001940-exon-sc0000012-1510915933:535577..536550Clytia hemisphaericaexon
TCONS_00001940-exon-sc0000012-1491911889:541192..541447TCONS_00001940-exon-sc0000012-1491911889:541192..541447Clytia hemisphaericaexon
TCONS_00001940-exon-sc0000012-1491911889:536737..536819TCONS_00001940-exon-sc0000012-1491911889:536737..536819Clytia hemisphaericaexon
TCONS_00001940-exon-sc0000012-1491911889:535577..536550TCONS_00001940-exon-sc0000012-1491911889:535577..536550Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001940-proteinTCONS_00001940-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000012supercontigsc0000012:535577..541447 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0.156687 0.290309 0.269832 0 0 0 0 0 0 0 0 0 0 0 0 0 1.36798 0 0 1.67415 1.42115 21.7152 14.9085 10.1783 2.70122 207.059 134.831 64.7696 37.693
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001820TIMP
IPR001134Netrin_domain
IPR008993TIMP-like_OB-fold
Vocabulary: Molecular Function
TermDefinition
GO:0008191metalloendopeptidase inhibitor activity
GO:0005515protein binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0008191 metalloendopeptidase inhibitor activity
molecular_function GO:0005515 protein binding
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00001940 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top