Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001932 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001932
Unique NameTCONS_00001932
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length974

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001932 ID=TCONS_00001932|Name=TCONS_00001932|organism=Clytia hemisphaerica|type=transcript|length=974bp
AATTGAACGCAAATATGGTTTGTATCTTAAGCTTGGAATTTAAAAAGATG
TATTCAGACTAGTCTGTTTATTATAAATGTTTATGGACTTTATTTCTTAG
CTTCCAAATGGGAATGGATAGGTAAAAACAACAATAACATAGATTCCCAT
GATGGCGgactttaatttcaaaattatagtAGTTGGTTCAAGTGGAGTTG
GTAAGACAGCAGTTGTACAACGATACGTCCGTAAATCATTCAAAGAAAAT
GACCAATCAACAATAGGGATCGACATTGGTATAAAATTACTGCAGATTGA
TGACTATAAAATTCAGTTAAAGATATGGGACAGTGCTGGATCAGAACGAT
TCAAGAGCTTGACAACAAGTTATTACAGAAATGCTGACGCTGCAATTTTA
ATGTACGGTATCAATAATCCTCAATCTTTACACGAGCTTCACACGTGGTC
AACTGAAGTAACACATCatgctgaaattttgaaaatattagttGGTAACA
AAAATGATTTGGACGTTGAAGAACGAAAAATATTCGAAGAGACGGCAGTC
AATTTTGCATTAATGGAAAATATTGATTTAGCCGTAGAGTGCTCTGCAAA
AATTGACGATAATGTCGATTATATATTCCATACTATTGCTAAAAAACTGC
TCCATAAAGAGTTGGCGCTCAACTCAACCAACAGTAAACGGAAtatcaaa
aaaggattgaataATGATTTAGTTAAGTACCAAGGAACTTCAGATTCAAT
GGATAATTTGTTTTTAACACCAAAGGAGATTGCTTCTTTGAATAAGCGAA
ACAACGAGAGTTGCCAACTGGACCAAATTAGACcaaggaaaaatcttttt
caaaggaTCTGCTCTATTTTATGATATTGTTTTTGTATAtcaagaaaatt
gagaaaaagtgAAATCATTAAGatttcttcaaatcaaaaaaatgataCAA
ATGATACAACAAGCTTAAAATCAG
Run BLAST on NCBI

protein sequence of TCONS_00001932-protein

>TCONS_00001932-protein ID=TCONS_00001932-protein|Name=TCONS_00001932-protein|organism=Clytia hemisphaerica|type=polypeptide|length=241bp
MMADFNFKIIVVGSSGVGKTAVVQRYVRKSFKENDQSTIGIDIGIKLLQI
DDYKIQLKIWDSAGSERFKSLTTSYYRNADAAILMYGINNPQSLHELHTW
STEVTHHAEILKILVGNKNDLDVEERKIFEETAVNFALMENIDLAVECSA
KIDDNVDYIFHTIAKKLLHKELALNSTNSKRNIKKGLNNDLVKYQGTSDS
MDNLFLTPKEIASLNKRNNESCQLDQIRPRKNLFQRICSIL
Run BLAST on NCBI

transcript from alignment at sc0000012:329992..331647-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001932 ID=TCONS_00001932|Name=TCONS_00001932|organism=Clytia hemisphaerica|type=transcript|length=1656bp|location=Sequence derived from alignment at sc0000012:329992..331647- (Clytia hemisphaerica)
AATTGAACGCAAATATGGTTTGTATCTTAAGCTTGGAATTTAAAAAGATG TATTCAGACTAGTCTGTTTATTATAAATGTTTATGGACTTTATTTCTTAG CTTCCAAATGGGAATGGATAGGTAAAAACAACAATAACATAGATTCCCAT GATGGCGGACTTTAATTTCAAAATTATAGTAGTTGGTTCAAGTGGAGTTG GTAAGACAGCAGTTGTACAACGATACGTCCGTAAATCATTCAAAGAAAAT GACCAATCAACAATAGGGATCGACATTGGTATAAAATTACTGCAGATTGA TGACTATAAAATTCAGGTATGTCACTTAAAAGCATCGTTTATTAGTATTT GACGCCACTGTTCCACAGGGATCTTTCAGTAATGTGTGTAGAAAGGGAAT AAAAAGACCAATATTCTAAACAAAGAAAGATATGGCACCCCCTTCTCACA GAAGTTGGCAAAAGTATCGTCCCCAATGGAACATTATACTGTAATTTTTT TCTGCTGAAAATACTCAGATAGGCAAATCCTCACTGCAAAATAATGTGCT ATTTTTCCCATTCCAACTCAATTTTCTGGCTAGAAAACAATGGAATTCAA GTCCCCAGCCATAAAAGCCATGTATGGGAATATTAATTCCCATCGAATTT TGGCCTGTTATTTTTATCGTCACTGGCTGATAATTTCCCACCGGGTCTGT GAGAAGCGGGTGTGATATGAACATTTTCATCACTTTTGATTTTTTAGCCT GGGCGATATTTGGACGTTTTATGATCTTGTGTGGTGGGGGCACAGGAGTT GTCGGTTGTCCCCCAATATAGCATTTTTTTAATAAATGGAAAATATTCAA GGTATCCAATATAAGGCTATATATAAGGCAAGGCCTTTAGAGGGTCTTTT ATAAAATGTGAAAAATACTGTACTGTTTTCCTAAGCACATGCCTGGTGAT GGGCACTTACCTCAGATGTCAATTTCTTCTTTTTTTTTCACGCATTAGTT AAAGATATGGGACAGTGCTGGATCAGAACGATTCAAGAGCTTGACAACAA GTTATTACAGAAATGCTGACGCTGCAATTTTAATGTACGGTATCAATAAT CCTCAATCTTTACACGAGCTTCACACGTGGTCAACTGAAGTAACACATCA TGCTGAAATTTTGAAAATATTAGTTGGTAACAAAAATGATTTGGACGTTG AAGAACGAAAAATATTCGAAGAGACGGCAGTCAATTTTGCATTAATGGAA AATATTGATTTAGCCGTAGAGTGCTCTGCAAAAATTGACGATAATGTCGA TTATATATTCCATACTATTGCTAAAAAACTGCTCCATAAAGAGTTGGCGC TCAACTCAACCAACAGTAAACGGAATATCAAAAAAGGATTGAATAATGAT TTAGTTAAGTACCAAGGAACTTCAGATTCAATGGATAATTTGTTTTTAAC ACCAAAGGAGATTGCTTCTTTGAATAAGCGAAACAACGAGAGTTGCCAAC TGGACCAAATTAGACCAAGGAAAAATCTTTTTCAAAGGATCTGCTCTATT TTATGATATTGTTTTTGTATATCAAGAAAATTGAGAAAAAGTGAAATCAT TAAGATTTCTTCAAATCAAAAAAATGATACAAATGATACAACAAGCTTAA AATCAG

Coding sequence (CDS) from alignment at sc0000012:329992..331647-

>TCONS_00001932 ID=TCONS_00001932|Name=TCONS_00001932|organism=Clytia hemisphaerica|type=CDS|length=1452bp|location=Sequence derived from alignment at sc0000012:329992..331647- (Clytia hemisphaerica)
TTAAAGATATGGGACAGTGCTGGATCAGAACGATTCAAGAGCTTGACAAC
AAGTTATTACAGAAATGCTGACGCTGCAATTTTAATGTACGGTATCAATA
ATCCTCAATCTTTACACGAGCTTCACACGTGGTCAACTGAAGTAACACAT
CATGCTGAAATTTTGAAAATATTAGTTGGTAACAAAAATGATTTGGACGT
TGAAGAACGAAAAATATTCGAAGAGACGGCAGTCAATTTTGCATTAATGG
AAAATATTGATTTAGCCGTAGAGTGCTCTGCAAAAATTGACGATAATGTC
GATTATATATTCCATACTATTGCTAAAAAACTGCTCCATAAAGAGTTGGC
GCTCAACTCAACCAACAGTAAACGGAATATCAAAAAAGGATTGAATAATG
ATTTAGTTAAGTACCAAGGAACTTCAGATTCAATGGATAATTTGTTTTTA
ACACCAAAGGAGATTGCTTCTTTGAATAAGCGAAACAACGAGAGTTGCCA
ACTGGACCAAATTAGACCAAGGAAAAATCTTTTTCAAAGGATCTGCTCTA
TTTTATGAATGATGGCGGACTTTAATTTCAAAATTATAGTAGTTGGTTCA
AGTGGAGTTGGTAAGACAGCAGTTGTACAACGATACGTCCGTAAATCATT
CAAAGAAAATGACCAATCAACAATAGGGATCGACATTGGTATAAAATTAC
TGCAGATTGATGACTATAAAATTCAGTTAAAGATATGGGACAGTGCTGGA
TCAGAACGATTCAAGAGCTTGACAACAAGTTATTACAGAAATGCTGACGC
TGCAATTTTAATGTACGGTATCAATAATCCTCAATCTTTACACGAGCTTC
ACACGTGGTCAACTGAAGTAACACATCATGCTGAAATTTTGAAAATATTA
GTTGGTAACAAAAATGATTTGGACGTTGAAGAACGAAAAATATTCGAAGA
GACGGCAGTCAATTTTGCATTAATGGAAAATATTGATTTAGCCGTAGAGT
GCTCTGCAAAAATTGACGATAATGTCGATTATATATTCCATACTATTGCT
AAAAAACTGCTCCATAAAGAGTTGGCGCTCAACTCAACCAACAGTAAACG
GAATATCAAAAAAGGATTGAATAATGATTTAGTTAAGTACCAAGGAACTT
CAGATTCAATGGATAATTTGTTTTTAACACCAAAGGAGATTGCTTCTTTG
AATAAGCGAAACAACGAGAGTTGCCAACTGGACCAAATTAGACCAAGGAA
AAATCTTTTTCAAAGGATCTGCTCTATTTTATGAATGATGGCGGACTTTA
ATTTCAAAATTATAGTAGTTGGTTCAAGTGGAGTTGGTAAGACAGCAGTT
GTACAACGATACGTCCGTAAATCATTCAAAGAAAATGACCAATCAACAAT
AGGGATCGACATTGGTATAAAATTACTGCAGATTGATGACTATAAAATTC
AG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000998XLOC_000998Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001932-proteinTCONS_00001932-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001932-exon-sc0000012-1575043694:331332..331647TCONS_00001932-exon-sc0000012-1575043694:331332..331647Clytia hemisphaericaexon
TCONS_00001932-exon-sc0000012-1575043694:329992..330649TCONS_00001932-exon-sc0000012-1575043694:329992..330649Clytia hemisphaericaexon
TCONS_00001932-exon-sc0000012-1510915933:331332..331647TCONS_00001932-exon-sc0000012-1510915933:331332..331647Clytia hemisphaericaexon
TCONS_00001932-exon-sc0000012-1510915933:329992..330649TCONS_00001932-exon-sc0000012-1510915933:329992..330649Clytia hemisphaericaexon
TCONS_00001932-exon-sc0000012-1491911889:331332..331647TCONS_00001932-exon-sc0000012-1491911889:331332..331647Clytia hemisphaericaexon
TCONS_00001932-exon-sc0000012-1491911889:329992..330649TCONS_00001932-exon-sc0000012-1491911889:329992..330649Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000012supercontigsc0000012:329992..331647 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 0 0 0 0 0.596238 1.00474 1.44597 1.21018 1.64448 0.833929 3.51614 2.69061 1.52737 1.97822 11.5584 4.46045 3.20443 2.73415 21.6124 20.0119 1.91426 2.22377 3.03731 4.66601 0.445136 1.42518 0.0514739 0
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001806Small_GTPase
IPR005225Small_GTP-bd_dom
IPR027417P-loop_NTPase
Vocabulary: Molecular Function
TermDefinition
GO:0005525GTP binding
GO:0003924GTPase activity
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0003924 GTPase activity
molecular_function GO:0005525 GTP binding
Blast
BLAST of TCONS_00001932 vs. Swiss-Prot (Human)
Match: RAB30 (Ras-related protein Rab-30 OS=Homo sapiens GN=RAB30 PE=1 SV=2)

HSP 1 Score: 136.346 bits (342), Expect = 6.531e-38
Identity = 69/169 (40.83%), Postives = 113/169 (66.86%), Query Frame = 2
Query:  158 DFNFKIIVVGSSGVGKTAVVQRYVRKSFKENDQSTIGIDIGIKLLQIDDYKIQLKIWDSAGSERFKSLTTSYYRNADAAILMYGINNPQSLHELHTWSTEVTHHA--EILKILVGNKNDLDVEERKIFEETAVNFALMENIDLAVECSAKIDDNVDYIFHTIAKKLLHK 658
            DF FKI+++G++GVGKT +V+R+ +  F     +TIG+D  IK ++I+  K++L+IWD+AG ERF+S+T SYYR+A+A IL Y I   +S   L  W  E+  +A  +++ +LVGNK DL  E R++ ++ A  F+  +++   +E SAK  DNV+ +F  +A +L+ +
Sbjct:    7 DFLFKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEINGEKVKLQIWDTAGQERFRSITQSYYRSANALILTYDITCEESFRCLPEWLREIEQYASNKVITVLVGNKIDL-AERREVSQQRAEEFSEAQDM-YYLETSAKESDNVEKLFLDLACRLISE 173          
The following BLAST results are available for this feature:
BLAST of TCONS_00001932 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
RAB306.531e-3840.83Ras-related protein Rab-30 OS=Homo sapiens GN=RAB3... [more]
back to top