Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001922 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001922
Unique NameTCONS_00001922
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1074

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001922 ID=TCONS_00001922|Name=TCONS_00001922|organism=Clytia hemisphaerica|type=transcript|length=1074bp
tttttaccTTCAGATTCCAAGATGTCCGATCTGGACTGCGTGTGCAGAAA
ACTAAACTAGAgaaataattttctaaaaaaatgttgCGTTTGGCTCAGAA
ATCATCTGTCCTTGGACAAGCAGCCAAAATGTTGGCACAACAAGAACGAT
ATATGTCCAAAGCTGTCGTCTTCAACATGGGTGGTGCTATGTTGCCGGCA
ATGTCACCAGTTTTGCAAAAGTTTGCACGTGACCACAAAATGTCCGAAGC
TGAATTGACCAACAAATTATTCAAAGAAggagataaagGACTAATGGAAA
AAGTCGAACCCGCTTTATTATCGAGACACGGCAGTGAAGATGCCAACCTT
GCATACGTTGTTTCCGCTATTCAAAGTATCCGTGGTGAAGGCTTAAAGAC
CGGTTTGGTTGCATCCGCACCTGGATTGAACACTGACCTATTCCCAGTCA
GCAATGCTTTATTTGACGCTGTATCAGCCAACTTGAAAGGTGATTTGATG
GACAAATTGAAAGTTGACTCCAGTGAAGTCATTTACTTAGATAACGTCGA
TGCTAACTTGAAAGCTGCTCAAGGAATGGGAATGACGACCGTCAAGGTTG
AAGATGTCGAAGCTGCCCTGCACGAATTAGAAGCACATCTTCAAGTTCCA
TTAAGAGAATTCGTTCCAGGTTTCTCATGGATTTACTACGATGGCGCCAA
CAGTCCACACAAATCAACCAAAGAGAACCTTCTCTACTATTTCTTAGTCA
TCTACATTTTCATGGTCGCTGGTCACATGACCTGTAAACACGTTCTCAAA
ATCGACGGTACTTTCCAacattaaagaaattattaataattttataattt
ttttttccttttaaaatttaGACCAAAACTTTACCACCTGTACGTCATag
aacttttgaataaaaagtttttgtgaaagaaattcccccaaaaaaataca
aatgtaTGTACATATTTGATAAACATTTATTTgtcgaattttttttaatt
tggttcGCCTTTTCAAGAGAAGACACGCTTTGGTACATTTTGGTCAACTG
AAAAAATCCGAtccaaaaaatgaa
Run BLAST on NCBI

protein sequence of TCONS_00001922-protein

>TCONS_00001922-protein ID=TCONS_00001922-protein|Name=TCONS_00001922-protein|organism=Clytia hemisphaerica|type=polypeptide|length=247bp
MLRLAQKSSVLGQAAKMLAQQERYMSKAVVFNMGGAMLPAMSPVLQKFAR
DHKMSEAELTNKLFKEGDKGLMEKVEPALLSRHGSEDANLAYVVSAIQSI
RGEGLKTGLVASAPGLNTDLFPVSNALFDAVSANLKGDLMDKLKVDSSEV
IYLDNVDANLKAAQGMGMTTVKVEDVEAALHELEAHLQVPLREFVPGFSW
IYYDGANSPHKSTKENLLYYFLVIYIFMVAGHMTCKHVLKIDGTFQH
Run BLAST on NCBI

transcript from alignment at sc0000012:200770..210887-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001922 ID=TCONS_00001922|Name=TCONS_00001922|organism=Clytia hemisphaerica|type=transcript|length=10118bp|location=Sequence derived from alignment at sc0000012:200770..210887- (Clytia hemisphaerica)
TTTTTACCTTCAGATTCCAAGATGTCCGATCTGGACTGCGTGTGCAGAAA AGTACGTCGTCTTACTTTTCTAAATTCACCTGCTTCATCGTCATTTTATG AAGACAACTTACTTTAGTTCTCAGGTTTTTAAACTTTTTTATTTGTGTTT CGATTCTGTTTAATTTATNTACTTTTCTAAATTCACCTGCTTCATCGTCA TTTTATGAAGACAACTTACTTTAGTTCTCAGGTTTTTAAACTTTTTTATT TGTGTTTCAATTCTGTTTAATTTATTTACCCTGGGAAACTTCCATTGTAG TTTTAAAAATTAAAAACAGGGGTCACGTCCAACATTATCTGGTTGGCAGA CGATATCATACTCCAGGATGCAAGTGAAATTTTTCAAATCTGCGGACCTA GACGGGGGTTCGTTTATTATCAGTTAGGGTTAGGGTTGGAGCTCGAGAGT CACAATATAAAGCCGAAGGCCTTCTTAGGGGCATTCGTACCCTGTGACTT AATTAACTTAGGATCCCGTAGCTAGGGATCCTTGTATCCTTGTAGGGGCA CCGGTAGGGTTGGGAGCTTTCTTAATTAGGGTCTGTAAATTACACGCTGT AAGTATTTGTGAATGACAGCGTTCTGTCGTGTCTCGTTGGTGGAAGCGGT TAAGCATTGGGTTAATAAACCAAGGTTGTTTGTATTTGGTGGTTCGAGCC GGGGTCGGAGACCTGTTTCACCGGTACGGGCAAATTTCAGAAAAATACTT AGAACAGTTGGAAACACTTGAGAAAGACAGAAAATCTGGATAGAAGATAG GAAAGTAGAAAATAGGGGGAAAATGAGAGACAGTGTAGACCTAACTCTTC ATACAAAAATTACGGGAAAACGCATATTTTGGACTTTGTACCCTATGCTG CACTCAAGCACTTGGGCCAAAATCCCACAAAGGCGGGACAAAAATCAGTT TTTTGAAGTTTGCAAAAAAACGCCACATAGAAGATCTTTCAAATTCAGTA TGTGAATTATAGAGCAGTAAAAAATACAACTTTTCTATTTTTCCTTTTTT TTGCAAAAGTTCTAGGAATGAAAATAAAGGGATAATCATAATTGAATACT ATCCATTGATGATCCGCGGCACTATCGTAAAGCTAGAATCGCTTCGCGTA CTCTTAGCTTGAGAAAATGATTGACAGATTGAAGTTTTTCATCCCCGCGG TGCGCGCCACGCGGGAGCTCAGGCGCTCTGCGAGAGTTCTCGGCTCAATC CTCGGACCTCGCTAAAATGGTAGACTGAGCTGTGATAGATCATTTCGATG GAAGTTGTTGGAATGTTTACAAGGCTCTTGATAGAATATTGTTTGTTTTA TTGTCAATGATGACAGTGCCGTTATACATTTTGTTATATCTAACAAATTG ATGTTTGTAAGTGCACTTTATAGTTTTGATTCCCATTGAAGAATAATATT CTGGTTTTCATGTTATTAGATGCTGTTTTAGAGCTTTAGAGCTACACTGA GAGACGATGCATCCTGGAGTATGATATCGTTTGCCAACCACATTATCTAA GGGTCTTATCTGTTTCATCTTCCTTTTAAGAGCTCTGAACCTAGAGTTCA ACTTCTAGATGAATATCATTCTGCCACAGTCATGTGCTAAAGCACATTGT GAAGCACATTTTTATTCGATCGGCATCGAGAGTGATAAAATGACAGTGTG ATCAAATAGTTGTTTATGGGAGAACGCGACGGTGTGTCTACTGAATATTA CTCCAGCCATTACAGAAAGGATCGATAATCTTGTACCTAGGTGACAGCTA TGTTGTAAGGCCCTAAATGACGTCACAAAACACATTAAATATGAGATTTC TCAAACTTCAATCAGTTAGAATTCAAGCTTATTACCCGCCCCCACCATCC AAAAAGCTTTTGATGTGTTCAACAACACTCTACTTGGTGGGTGCGACGCC GGGTGTCTGCGTTTATGAAAAATGTGTGTAACGCAAGATGGTAGCTGAGC TGTTATTCTCAAATTTTGCCAGGGGGTTGATTCCAGTATGAAAGAGGGAT TTTGTGCAGTTTTAAGACAAAAAATCTTATTGTCTTTTGAAAAAGTAGTT GATGATACATCGTGGTTTTAATTTTGTGTTTAAAATTTCATTTTCATCTA TGATTGAGTGGGAAAATTAGCACTACCTTCCGATAAAACCCCCGTCCAAA AAAGGATTTGACATTCGAATTGAGGAATCCCTACAGTGACTTTTTAACAA AAATAATTCTGACGTCAATTATTCAAAAATCATGTGATGTAAATTTTCGA ATTTTGGAAGGCATGGCACTTTCTACGAAAAAGTTAGTAAAATTTGATTT TTTAAATAGTCAATGCGCAGGTAAGAAACGGTNCATGGCACTTTCTACGA AAAAGTTAGTAAAATTTGATTTTTTAAATAGTCAATGCGCAGGTAAAAAA CGGAGGTCTCCCGCGAGAAGTGGATATAAAATGTTGTCCCGTAAGTTTGG ATATGCCCATGATTGTTTTGAAATCAAAGTATTCATTATTTGGTCTTTTA AAGCGCGTCATTTCGTCCTTAAATTTGTAAATACAGCATTATTTTCTTTT CCTTTCTTATGCACTGATGATACATTTGACACTCTCAATTTGACGTTTTA CTGCTTAATAAATTCCTGTTTTCGCTTAAATTGAAATCGGCTTCAAACTT CCAGAAGAAACTCTCATAATTGACAGTTTACTGTTTACAAGCTAATTTTA TGGTGAAGACTTCAAGTCATATTCTCACATTCAATTTGAACCATAGAAAG GTATTTACGAGAAATCTTCCAGCTAATCGATATACTCCCGTGGTTGATGA AAACTAATTCGAATTCCCCGTAAAAATAAAGTTAGAGAGCATCAGCAATA CCATCTTTATCATCCTAAGGGCTTTTGATGCGCAATCTAAACCGGCGTTT GTGACAACGGGAACCATCTAGATCATACTAATTAAGTTTTTTCCGGCTCA AAACTTTGTAGACTGGGGACTTTAAGATTTCCTATTAGGATAAAATTTTG TGCACCTTGGTTCTTTTGGTCCTTTTAATCCCTTTTTGCCTCTTTTAACA TTTCTGAAGGTTTTTTGGATTAGTTTTCAGCCCTCGAATTTCAGGTCAGC ATTATGCAGTGCAGACCTAAAAGCCAACCAAAGAATGTGTATGATTGGCA GTTCATTGCCGACCATAATCATCAATTCTTTTGGCAGCAGACCATAAGTG ATAATTGAAAAAAAAACATTGCTGTAGTCTTTAAACAACTTTGCCAACCT ATAATGAAGCTCAGATCGGCATTGCCGATCTAAAAACAAGTCTAGGTTGG CAGAATTTTCACGATTTGCTTCTACTTGAAATTCAAGGGCTGAGTTTTAG CCTCAAAACAATTGACACAAGTTAACTAATGATGAGGCAGTGCAGAGAGG TGGTTCTCTTGTAAATTAGACTTTAACTCTAATGTAGGTACTGAAAGAAA ATGCAAGGTTTGAACACAAATATCCAGGCATTCAAAGACAGCCCATTATT TTCAACATTTTTACCCAAGTCTACCAAAGATCAGAGTCAAAATTATGGTC AAGATAAGAAGACAGAACATTATAATGCATCATCTTGTTTGCCACTCGAT GCTTCATTTGAATTTGATCAATTTTTCAATACCCACGTGTTCACTTCTGG ACTGACGGACAATGGTAAAACTTTGGCCATCTTTGAACAAGATGATAAAG GAAATTTAAACATGCATAAATATTGCTATCATAAAGGCCAGATTGNTTAA CATTTCTGAAGGTTTTTTGGATTAGTTTTCAGCCCTCGAATTTCAGGTCA GCATTATGCAGTGCAGACCTAAAAGCCAACCAAAGAATGTGTATGATTGG CAGTTCATTGCCGACCATAATCATCAATTCTTTTGGCAGCAGACCATAAG TGATAATTGAAAAAAAAACATTGCTGTAGTCTTTAAACAACTTTGCCAAC CTATAATGAAGCTCAGATCGGCATTGCCGATCTAAAAACAAGTCTAGGTT GGCAGAATTTTCACGATTTGCTTCTACTTGAAATTCAAGGGCTGAGTTTT AGCCTCAAAACAATTGACACAAGTTAACTAATGATGAGGCAGTGCAGAGA GGTGGTTCTCTTGTAAATTAGACTTTAACTCTAATGTAGGTACTGAAAGA AAATGCAAGGTTTGAACACAAATATCCAGGCATTCAAAGACAGCCCATTA TTTTCAACATTTTTACCCAAGTCTACCAAAGATCAGAGTCAAAATTATGG TCAAGATAAGAAGACAGAACATTATAATGCATCATCTTGTTTGCCACTCG ATGCTTCATTTGAATTTGATCAATTTTTCAATACCCACGTGTTCACTTCT GGACTGATGGACAATGGTAAAACTTTGGCCATCTTTGAACAAGATGATAA AGGAAATTTAAACATGCATAAATATTGCTATCATAAAGGCCAGATTCAAA GTCTTCATTCCAGACACTTTAACACATGGTTGATTCGAGATTATGATTAT CTTGTCAGTTATGATGGCTTATTTGTTGTAATGTTTAATTCTGAAGAACT TGCACATGAAAGAGACCATCGAAGGAGACGAAAACGTGGCTATGGCCTGG GAGAGAAAGTTTACATTTCTTTGCTAGTTTATGACCATGATTTTGAAAAT GGTCGAAGTGCAATGGGGAAATTTTTCCCGAATTCCTTTGTACTTACCAT GTCTGACAAGGATGATTCATTGTTTTGGAAATATAAACATGGATATGCTA TTGGGGTTGATGGCACCATAATTGTCTCCTCATGGGGCGTGACTAGAGAC ACTTTAGATGAACAAGATACGGGTGGGACTGCTTTATATTTGAATTATTT CAAAGTTCAACAAACAAGCTCTAAAATTGCTGTCAAACATTGTGGTTTTA CAGATTTGAGTGGTGCGTTGACTGGCAAACCGTTACCAACAGCTTTCAAC GATCCTGAACANGAAAGAGACCATCGAAGGAGACGAAAACGTGGCTATGG CCTGGGAGAGAAAGTTTACATTTCTTTGCTAGTTTATGACCATGATTTTG AAAATGGTCGAAGTGCAATGGGGAAATTTTTCCCTAATTCCTTTGTACTT ACCATGTCTGACAAGGATGATTCATTGTTTTGGAAATATAAACATGGATA TGCTATTGGCGTTGATGGCACCATAATTGTCTCCTCGTGGGGCGTGACTA GAGACACTTTAGATGAACAAGATACGGGTGGGACTGCTTTATATTTGAAT TATTTCAAAGTTCAACAAACAAGCTCTAAAATTGCTGTCAAACATTGTGG TTGTACAGATTTGAGTGGTGCGTTGACTGGCAAACCGTTACCAACAGCTT TCAACGATCCTGCTATTGTATGCAACCAAAACATTACTAAAGTCTTCTTT TTGAGTCATAATATGGTTTACAACGTGATGACGCACTCAATGAGTACATT ATCCGAACAAGCTTTCCAACATAATGTATGGGTTATTCATAGACGGTACG GTGAAATACTGATAACCATAGACAGGCCAACTTTCTCGCTACTCAATGTC AAAATATTCAAAGAGAACGACAAAGGCGAGTATGATCTAGTAAACAAATT CAAAACAAGTCGAATTATAAGACCAAATGATAATTTTATGGAAGAGCCTA CAATGCATTGTCATGGTATAAACAATGGAGAGACTCGACTATTTGTAGAA CCAACTCAATCATCACGCACGATCTTTGCTGTCAATCCGTTCACTTTAAA CATTGATTTCATTTTGGGCATTCCTGCAAAGCTTGAGGAACCATTTGTGC GTAAAGTCCTTCAGAGTGGTGATGAAATTACAGTCCTTGTTACCAGTAAT TCTGCTGAGTATCTGGTCTCTTATAACATTAACAAATGCACTGAACTGAA AAGTCTCAAGGAGCTTTCAGCTTTGGTGGTACTTAGAAACTTTTCAATGG ATGACATATTGCAGTATAATATTCCAAAATTATTGAAAACCTATTTAGAG AATAATATTTTTTACCTCTGATTATGAAATGTTTTATTAACGTTTGTTTG TCTGTTTCATTCTACTGTTCTGTGTGTTTTAATGTTTATTTTTCATGTTG TTTTTTATTTTTCCATTATCTGTGCGTTGTATCTGTTCTTCTTTTTCAAC TAGTGTGTACCGAATTAGACTTATCCTTTATTTTTTATTTAGATTGAACA GATAATGATGAATTGCTTCCCTTATTAAAAGTTTTCCAAATAATTTTTAT GGATAAATACATAAGATTTTAAAATCTACTTTTGTATCGTTTCAGCTAAA CTAGAGAAATAATTTTCTAAAAAAATGTTGCGTTTGGCTCAGAAATCATC TGTCCTTGGACAAGCAGCCAAAATGTTGGCACAACAAGAACGATATATGT CCAAAGCTGTCGTCTTCAACATGGGTGGTGCTATGTTGCCGGCAATGTCA CCAGTTTTGCAAAAGTTTGCACGTGACCACAAAATGTCCGAAGCTGAATT GACCAACAAATTATTCAAAGAAGGAGATAAAGGTACCAATTCTATTAGTT TGAGATAAACACTAAACTGCTTTCAATATCAATTCATTGATATTAAAATA ACTTGAAACGACTTTCAACTTTTTATTTTGGGTAAAGAAAGTCTCGTTTT TTTCTCATATTGGGAACATTTTGTTCAGCGAAGAGTCGCCACAATAATAA ACTCCCTTGATTTGACTCAATTTCGCCGATGCTAGTTACCTTTCTTTTTT GTCCTTCATAGAATGTAACCCCCCTGGCTCTTAGGGGGGGGGGCTAGAAC CTAAAGTTCTGGCTGGGGGCTCTTTTTCCCTAAGATCAGGGGGGCTACTT ACTCAGGGGGGGGGGCTAGAACCTAAAGTTCTGGCTGGGGGCTCTTTTTC CCTAAGATCAGGGGGGCTACTTACTCAGGGGGGGGGCTATTTATTTAGGT CTGTTGACTGGGGGCTATTTATTTAGGTCTGTTGACTGGGGGCTAACCTA ACAACTTTTTCCAAGAACTAATGTAATTTCATTGCATTTCATTTCATCGG TACAAAAGGTCTCATTATTTGTAAAACGTTGATATTCATTGACTTCTTAA AATTTGTTTGAAGTTTAACTTATTAAAATTTGTTTTAATTCTTACAACTA CAAGTGAAAATGCATCTTGATAGTCTGACTTATGATCATTGAAAAAGTTT TTTATACGTCCTAATCTAGTAAGGATAGCAAGGACTTGACATTCGCTTTT GATTGATTTTTTGATTATTCCTTTCTTCTCTTTCTTCTGTTTTTCTTTCT TTTTCAAAACGATGAGATGCTGCCTTGAATTTAACTAAAGTGCTCTAGCC AATGAGCTACATCCTATTAAGATGGCTGGAATCGAACCTGCTACCTCCTT AGCTAGTTCAAGACTTTTATCTCATTAACTTATTTTCTTGTTGTTCTTTA TAAGTTCTGATAGGTTAGTTCTTTAACTTTTATTTTTCTAGTTTATTTTG CTAGCTTTTTAATAAGCTTTTTGATAGTTCTAGTTTTTAAATTCTGGAGA GTTCAGATTTTTAAGCATAAATTAATTTTTTTTTTGTATTTTGGTAGGGG GGCTGTCTATTTCGAATTTTGGTGGGGGCTAAATCTCAGGGGGGGCTGAA CCTTCAGGGGGGCTTCAACCCCTCTGCACTCGATGTCCTTGTTCCGATAC ACTGTTATGTTATTCGAGTTATGTTTATTTCGCAAAGGTTGATCATTTCT CACATGACCTAAAATGTGGAAACGTTCCCGACGTTCCATTTCTCGATTTT AGTATACCATATAAGTGGTAATTGGTAGTCCGCTTTTGATGAACTTCACT TTTTAATTTCATTCATAGGACTAATGGAAAAAGTCGAACCCGCTTTATTA TCGAGACACGGCAGTGAAGATGCCAACCTTGCATACGTTGTTTCCGCTAT TCAAAGTATCCGTGGTGAAGGCTTAAAGACCGGTTTGGTTGCATCCGCAC CTGGATTGAACACTGACCTATTCCCAGTCAGCAATGCTTTATTTGACGCT GTAAGTTAATATTCTTTCTTTTGCGAACTCAGATTTGGGTTAAAAATGTA ACAGACAGAAACATCCACATTTTATAGAGTTCTGAGAGGGTCCGCTAAAT TCGGTTAGGCGACGATAGCTTTTTAGATTTCAGTAATTGCCTTGGATTTT ATTTGGACTCTTTCCGAACTATGAGCTCTTTCTAGGGAAGGGCAGTGTAA TGATAGTTTGGTTACAATCAATGAATGAATTCTATTTTTGATAGTTAATT TGAATGAAATTAGAAAACATGCTTTACCAGGTTTTTTGAATTTATTTACA CCTCTGATTAAAACATAAAACATTACTTTATTTTCCCACTTTTCCACCGT CAAGGTATCAGCCAACTTGAAAGGTGATTTGATGGACAAATTGAAAGTTG ACTCCAGTGAAGTCATTTACTTAGATAACGTCGATGCTAACTTGAAAGCT GCTCAAGGAATGGGAATGACGACCGTCAAGGTAAACAGATTAACATACGC GCCTTTTTATTAGGCTGGACTGTTCTTATTTTTTTGAAATTTTCAGGCGC AAATGTGTTTACGATGTTCTTAATACGCTTAGTTTCTTTACTTAAAACTT GAAATGGGTTTAAAATCTGTTAAATTCAGTACTTTTAAGTTATTTCTGAA ATCTGAGGCTTAGGGTTGTTCTTGATTTACACTTGATTTGGCCAATTTTT AGCCTCGTGTTCTTATAAAAGAACATCTAAAGTTTCTTTTAAGGTGGTTT GATGACAAGTATGCCTGTTAGAACTGCACTACTTTAGGCGTATAAACTTT CGCGAGCAGAAACTTTCGCGATTTTCGCGAATTTTGGCCCTTTTCGCGAA AGTAAATGTCTTTAAAAATTGTAGGAAGGGCCATTCGCAAAAATTTATGC TCGCGAAAAATTCTTAACAAAATAGAAAATCTGTAAAACTTCAAACTTTG AATAAAATGTAACTTTTATGGCACTTTTTAGCCTGCTAAAAGACTAATAA GTCAAAGAACAAATGTTTCAAGCCAATCCAAGAAGTATTTGTCCCTCTAA GCCATTTTTTCATCTGAAAATTCTAAATTTTACGTCTTGATTTGCGAAAG TTTCGTTTCAAGAAATTTCGCGATTTTTCGTCCTCGCGAAAGTTTGTACG CCTAAAGTAGTTTTTTAATCTCCTGGCACATGGTCGAGAATTTGAAAGAA ATGTCCTTTTTGAATTTAATGAGCAGCTCTCCACCGTATGAAGAGAAATG AATATTCATTCTACTATTCAGTCTAACATAATTTTGTTATAAGTTCTCGT CATAAGTGAGTTCTTGCCAAAATTAACTTTTTTATAATTTTCCAAATTAA CCCCTCATCTTTTTCCAAAACACTCATTTTTTTAGGCAAGACGAAACTTA TTTATCCTATCATTCGCCAACATAAATTAGAAATTGCCAAAAATACCAAA ATTAGTTCACTTAAGTTACTTGTTTCGCATTTTGCTACAAGCTAGAGAGG GGGTCGCCTTTTTAAACCATGTATATTCTTCGATTTGCAGGTTGAAGATG TCGAAGCTGCCCTGCACGAATTAGAAGCACATCTTCAAGTTCCATTAAGA GAATTCGTTCCAGGTTTCTCATGGATTTACTACGATGGCGCCAACAGTCC ACACAAATCAACCAAAGAGAACCTTCTCTACTATTTCTTAGTCATCTACA TTTTCATGGTCGCTGGTCACATGACCTGTAAACACGTTCTCAAAATCGAC GGTACTTTCCAACATTAAAGAAATTATTAATAATTTTATAATTTTTTTTT CCTTTTAAAATTTAGACCAAAACTTTACCACCTGTACGTCATAGAACTTT TGAATAAAAAGTTTTTGTGAAAGAAATTCCCCCAAAAAAATACAAATGTA TGTACATATTTGATAAACATTTATTTGTCGAATTTTTTTTAATTTGGTTC GCCTTTTCAAGAGAAGACACGCTTTGGTACATTTTGGTCAACTGAAAAAA TCCGATCCAAAAAATGAA

Coding sequence (CDS) from alignment at sc0000012:200770..210887-

>TCONS_00001922 ID=TCONS_00001922|Name=TCONS_00001922|organism=Clytia hemisphaerica|type=CDS|length=2976bp|location=Sequence derived from alignment at sc0000012:200770..210887- (Clytia hemisphaerica)
GTTGAAGATGTCGAAGCTGCCCTGCACGAATTAGAAGCACATCTTCAAGT
TCCATTAAGAGAATTCGTTCCAGGTTTCTCATGGATTTACTACGATGGCG
CCAACAGTCCACACAAATCAACCAAAGAGAACCTTCTCTACTATTTCTTA
GTCATCTACATTTTCATGGTCGCTGGTCACATGACCTGTAAACACGTTCT
CAAAATCGACGGTACTTTCCAACATTAAGTATCAGCCAACTTGAAAGGTG
ATTTGATGGACAAATTGAAAGTTGACTCCAGTGAAGTCATTTACTTAGAT
AACGTCGATGCTAACTTGAAAGCTGCTCAAGGAATGGGAATGACGACCGT
CAAGGACTAATGGAAAAAGTCGAACCCGCTTTATTATCGAGACACGGCAG
TGAAGATGCCAACCTTGCATACGTTGTTTCCGCTATTCAAAGTATCCGTG
GTGAAGGCTTAAAGACCGGTTTGGTTGCATCCGCACCTGGATTGAACACT
GACCTATTCCCAGTCAGCAATGCTTTATTTGACGCTATGTTGCGTTTGGC
TCAGAAATCATCTGTCCTTGGACAAGCAGCCAAAATGTTGGCACAACAAG
AACGATATATGTCCAAAGCTGTCGTCTTCAACATGGGTGGTGCTATGTTG
CCGGCAATGTCACCAGTTTTGCAAAAGTTTGCACGTGACCACAAAATGTC
CGAAGCTGAATTGACCAACAAATTATTCAAAGAAGGAGATAAAGGTTGAA
GATGTCGAAGCTGCCCTGCACGAATTAGAAGCACATCTTCAAGTTCCATT
AAGAGAATTCGTTCCAGGTTTCTCATGGATTTACTACGATGGCGCCAACA
GTCCACACAAATCAACCAAAGAGAACCTTCTCTACTATTTCTTAGTCATC
TACATTTTCATGGTCGCTGGTCACATGACCTGTAAACACGTTCTCAAAAT
CGACGGTACTTTCCAACATTAAGTATCAGCCAACTTGAAAGGTGATTTGA
TGGACAAATTGAAAGTTGACTCCAGTGAAGTCATTTACTTAGATAACGTC
GATGCTAACTTGAAAGCTGCTCAAGGAATGGGAATGACGACCGTCAAGGA
CTAATGGAAAAAGTCGAACCCGCTTTATTATCGAGACACGGCAGTGAAGA
TGCCAACCTTGCATACGTTGTTTCCGCTATTCAAAGTATCCGTGGTGAAG
GCTTAAAGACCGGTTTGGTTGCATCCGCACCTGGATTGAACACTGACCTA
TTCCCAGTCAGCAATGCTTTATTTGACGCTATGTTGCGTTTGGCTCAGAA
ATCATCTGTCCTTGGACAAGCAGCCAAAATGTTGGCACAACAAGAACGAT
ATATGTCCAAAGCTGTCGTCTTCAACATGGGTGGTGCTATGTTGCCGGCA
ATGTCACCAGTTTTGCAAAAGTTTGCACGTGACCACAAAATGTCCGAAGC
TGAATTGACCAACAAATTATTCAAAGAAGGAGATAAAGGTTGAAGATGTC
GAAGCTGCCCTGCACGAATTAGAAGCACATCTTCAAGTTCCATTAAGAGA
ATTCGTTCCAGGTTTCTCATGGATTTACTACGATGGCGCCAACAGTCCAC
ACAAATCAACCAAAGAGAACCTTCTCTACTATTTCTTAGTCATCTACATT
TTCATGGTCGCTGGTCACATGACCTGTAAACACGTTCTCAAAATCGACGG
TACTTTCCAACATTAAGTATCAGCCAACTTGAAAGGTGATTTGATGGACA
AATTGAAAGTTGACTCCAGTGAAGTCATTTACTTAGATAACGTCGATGCT
AACTTGAAAGCTGCTCAAGGAATGGGAATGACGACCGTCAAGGACTAATG
GAAAAAGTCGAACCCGCTTTATTATCGAGACACGGCAGTGAAGATGCCAA
CCTTGCATACGTTGTTTCCGCTATTCAAAGTATCCGTGGTGAAGGCTTAA
AGACCGGTTTGGTTGCATCCGCACCTGGATTGAACACTGACCTATTCCCA
GTCAGCAATGCTTTATTTGACGCTATGTTGCGTTTGGCTCAGAAATCATC
TGTCCTTGGACAAGCAGCCAAAATGTTGGCACAACAAGAACGATATATGT
CCAAAGCTGTCGTCTTCAACATGGGTGGTGCTATGTTGCCGGCAATGTCA
CCAGTTTTGCAAAAGTTTGCACGTGACCACAAAATGTCCGAAGCTGAATT
GACCAACAAATTATTCAAAGAAGGAGATAAAGGTTGAAGATGTCGAAGCT
GCCCTGCACGAATTAGAAGCACATCTTCAAGTTCCATTAAGAGAATTCGT
TCCAGGTTTCTCATGGATTTACTACGATGGCGCCAACAGTCCACACAAAT
CAACCAAAGAGAACCTTCTCTACTATTTCTTAGTCATCTACATTTTCATG
GTCGCTGGTCACATGACCTGTAAACACGTTCTCAAAATCGACGGTACTTT
CCAACATTAAGTATCAGCCAACTTGAAAGGTGATTTGATGGACAAATTGA
AAGTTGACTCCAGTGAAGTCATTTACTTAGATAACGTCGATGCTAACTTG
AAAGCTGCTCAAGGAATGGGAATGACGACCGTCAAGGACTAATGGAAAAA
GTCGAACCCGCTTTATTATCGAGACACGGCAGTGAAGATGCCAACCTTGC
ATACGTTGTTTCCGCTATTCAAAGTATCCGTGGTGAAGGCTTAAAGACCG
GTTTGGTTGCATCCGCACCTGGATTGAACACTGACCTATTCCCAGTCAGC
AATGCTTTATTTGACGCTATGTTGCGTTTGGCTCAGAAATCATCTGTCCT
TGGACAAGCAGCCAAAATGTTGGCACAACAAGAACGATATATGTCCAAAG
CTGTCGTCTTCAACATGGGTGGTGCTATGTTGCCGGCAATGTCACCAGTT
TTGCAAAAGTTTGCACGTGACCACAAAATGTCCGAAGCTGAATTGACCAA
CAAATTATTCAAAGAAGGAGATAAAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000992XLOC_000992Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001922-exon-sc0000012-1575043694:210837..210887TCONS_00001922-exon-sc0000012-1575043694:210837..210887Clytia hemisphaericaexon
TCONS_00001922-exon-sc0000012-1575043694:204306..204542TCONS_00001922-exon-sc0000012-1575043694:204306..204542Clytia hemisphaericaexon
TCONS_00001922-exon-sc0000012-1575043694:202788..202969TCONS_00001922-exon-sc0000012-1575043694:202788..202969Clytia hemisphaericaexon
TCONS_00001922-exon-sc0000012-1575043694:202308..202433TCONS_00001922-exon-sc0000012-1575043694:202308..202433Clytia hemisphaericaexon
TCONS_00001922-exon-sc0000012-1575043694:200770..201247TCONS_00001922-exon-sc0000012-1575043694:200770..201247Clytia hemisphaericaexon
TCONS_00001922-exon-sc0000012-1510915933:210837..210887TCONS_00001922-exon-sc0000012-1510915933:210837..210887Clytia hemisphaericaexon
TCONS_00001922-exon-sc0000012-1510915933:204306..204542TCONS_00001922-exon-sc0000012-1510915933:204306..204542Clytia hemisphaericaexon
TCONS_00001922-exon-sc0000012-1510915933:202788..202969TCONS_00001922-exon-sc0000012-1510915933:202788..202969Clytia hemisphaericaexon
TCONS_00001922-exon-sc0000012-1510915933:202308..202433TCONS_00001922-exon-sc0000012-1510915933:202308..202433Clytia hemisphaericaexon
TCONS_00001922-exon-sc0000012-1510915933:200770..201247TCONS_00001922-exon-sc0000012-1510915933:200770..201247Clytia hemisphaericaexon
TCONS_00001922-exon-sc0000012-1491911889:210837..210887TCONS_00001922-exon-sc0000012-1491911889:210837..210887Clytia hemisphaericaexon
TCONS_00001922-exon-sc0000012-1491911889:204306..204542TCONS_00001922-exon-sc0000012-1491911889:204306..204542Clytia hemisphaericaexon
TCONS_00001922-exon-sc0000012-1491911889:202788..202969TCONS_00001922-exon-sc0000012-1491911889:202788..202969Clytia hemisphaericaexon
TCONS_00001922-exon-sc0000012-1491911889:202308..202433TCONS_00001922-exon-sc0000012-1491911889:202308..202433Clytia hemisphaericaexon
TCONS_00001922-exon-sc0000012-1491911889:200770..201247TCONS_00001922-exon-sc0000012-1491911889:200770..201247Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001922-proteinTCONS_00001922-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000012supercontigsc0000012:200770..210887 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
340.851 326.411 396.32 280.534 121.654 53.6642 206.239 134.186 483.052 455.445 453.122 508.562 423.897 383.234 430.604 510.789 655.486 721.261 257.71 257.149 491.902 525.312 294.39 305.308 62.6377 88.0737 326.62 328.206 265.416 246.567
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR023214HAD-like_dom
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00001922 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top