Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001917 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001917
Unique NameTCONS_00001917
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1540

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001917 ID=TCONS_00001917|Name=TCONS_00001917|organism=Clytia hemisphaerica|type=transcript|length=1540bp
ttagaAATCAAGTACATCATGATGTTGCAATTATTCATCGCAATTTATTT
GGCATCGGGATGTTTTGCAGACATTCTAGactGTGGTAATGGTTCCAAAC
TAAGCCGTATTGGATGTTTTACAAAGAATGATAATGCCCCTACCAAGTTC
ATAATGAGAAAGCCAGTCTATGGTGATGGATCAATAAAGagTTTGGCTTG
TGACTGTGCAGCAAAAGCAAAAGAAGGAGCACTAGTTCTAACCGACTACG
AGGAATGTTTTGAAACTAAGGCTGCGGATCACGGGAGTCGTTATCCTGGT
CAAACTTCATACGAGAAATGTATCAACACAGTCTTTCATCATTgtgaaaa
aggtcaaaattgtATTGGTACCACTGATTCTGTTTATATTTATGCAAAAG
TAGttGATGGAAAATGGAGTACATGGTCCGCTGTCGGAGCATGTAATCGA
AAATGTGGTCCAGGGCGCCGACGATTCACAAGAAAATGTAATAACCCAAA
GCCTGCTTTTGGTGGAAAATCATGCGAAGGACCGAAAATCAAATTCGAGT
CCTGCAACAATGGAGCGTGTCCGGTTAATGGAAAATGGAGTACATGGTCA
TCTTTCGGAGCATGTAATCGAAGATGTGGTCCAGGGCGCCGACGAGCAAC
AAGAAATTGCAATAACCCAAAGCCTGCTTTTGGCGGAAAATCATGCATAG
GACCGAAAATCAAATTCGAGTCCTGCAACAATGGAGCGTGTATTCCAGat
tTAAGAAACCAAGGACAAAATTGTTGGAAAAAACCTACCTATTTCTGTGG
TAAAAAAGGTCTTTGCAGTCGAAAAGGATGGGGTCGATGGCAAGACGCTG
CATTCCCCTGCGTTAATAGGCACTGTTGTACTGAGCCAGCTCTTGTTAAG
AACCTAGGCTCAAATTGCTGGTCGAAGTGTGGTAGAAAGGGTGGTTACTG
TCCTGGATTTTGTGGCGTGAACGGGCGTTGTTGTCGAAGAGGATGGAATG
ATGCTGGGTGCGCAGGAATGGCCACACCGTGCAATGGGAAGCATTGTTGT
ACAACTAAAAGACGAGATGTCCAAAATAGCGGTAAAAATTGCTGGTGGAA
ATGTAACAAGAAAGATGGGGAATGTTCGACAGGTTTTTGCGGTAAAGACG
GAGTTTGTTGTCGACGTGGTTGGGATACTTACAGATGTATCCGGACTACT
GGTGCATGCAGATACAAACATTGCTGTGTCGGTACAGCGGCTATGGGAAT
CCAAAAACCTTGAGCCGTCTTTTGATCGAGTCTCTGGAATTGGATTACAA
ATGGTTACTTAAAGAAAATGATTACGTTGTGAAAACGTATCATTTCTAAA
TTATAATAAAcatcatttttagattttgtagCAGTATTTAAACAGTATAT
GAAAGTAGATTTTTGTAGTTCTTATGGAAGTTGTACGTGCATTATCGTTT
AAGAACTAATAATATAAAGATTGAAataatatttatttcttttttaacac
TATAACTTTCGTATATAGAATAAATAGATACtgagaaaat
Run BLAST on NCBI

transcript from alignment at sc0000012:165313..177079-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001917 ID=TCONS_00001917|Name=TCONS_00001917|organism=Clytia hemisphaerica|type=transcript|length=11767bp|location=Sequence derived from alignment at sc0000012:165313..177079- (Clytia hemisphaerica)
TTAGAAATCAAGTACATCATGATGTTGCAATTATTCATCGCAATTTATTT GGCATCGGGATGTTTTGCAGACATTCTAGGTAGGCTGTTTATTATAAAAA CCCCTTCATAGGGATCAGTTTAAATGTTTTCAAATCACAGGGCGAGGAGA GAAATCAAGGAACCAAATGATATGGAAGATTGTTAACCCTTTATAAGGGG GGTTTGTACTTTTCCGGTGTGGCGGGATTGGCCCTTTTTTAGTACGGTAT TACGGGATTTGACGAAAAAAGAGACGGGAAAACGGTATTTCAAAATCAGA CGGTGACGGTATTTAGGTACATTTTCGCCCTGTACAAGCCGGTGTGACGG TGTTATTATTTTTTCAATTTTCGGGATTCCGGGATTCAGCAAANGTGTGA CGGTGTTATTATTTTTCCAATTTTCGGGATTCCGGGATTCAGCAAAAATT TTGACGGGAAAACGGTATTTCGAACCCCTACAAACCCCCCCCCTCCTTTA TATGCCATGGTCATTTTTTTCTAAGTTTTTTAAAGAAAATCACTAGTTAA AACTTTAAAGGCTTATATCTCGAGATCTAGAAGGAGTTAGAAGCTTGTTC ATAGCTCGTTTGATAGCTTGGAGTCTCCTCTTTCTTTAAGGCACCTTTGA GGCCGCCCGATTTAGGAAGGGCGGGGTGGGCTGCGCGGACCTGTCTAAAT GATAGAAAGATGCCCAATGGTAAAACTTTAAATTAATTCGCTGGAGGACA GAATCAAGTAAAACAGGGCTAAATTTGGTGGTTCTTGGATCACTCGTTGA NACAGAATCAAGTAAAACAGGGCCAAATTTGGTGGTTCTTGGATCACTCG TTGACCAAAAATGGTCAAAAAACGGTCAAAATCTTAAAAGAGTGGATTTT TGTCAAATCTTTGCATTTTTTTGACTTTTTGGCTTAAAATCTCGCTGGAA AGGCTCCTGTTGATTTTTTTTANATGATCAAAAAACGGTCAAAATCTTAA AAGAGTGGATTTTTGTCAAATCTTTGCATTTTTTTGACTTTTTGGCTTAA AATATCGCTGGAAAGGCTCCCTGTTGATTTTTTTTTTTGCTTCACCATGA AGCCCAATCCAATTCATACGAGTTAGACTAACAATGATGATTTCTAACTC AAACTGTGCATTACAGCCCATGTCTGATATATACGACATTGGCATTTAAA GGGTTGATTTGAAGGGAATCTCAAATTTGATTTCAGAACTTTATATGGTT GAAATAATTTTTCATGTTAGGAAATTTTTGAGTAATTTATGTGAATAAGG TCATTAGTAGGGGATCTTAACTTGACCTGTGGAGCTGCTGGTACTTAGAA ATGGTGTCAGGAAAATTGCCCCCGAGAAAATTGNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNAGGGGGCAGTTTTCCTAGGGGGCAATTTTCCGGGGGGCAATTTT CCGGGGGCAGTTTTCCGGGGGGCAATTTTCTCGGGGGCAATTTTCCTAGA ACCCTTAGAAATATGTTAAAATTAGCTCTAAATTCAACCTATATCTCCTT AAAAAATGTTTTTCAATAGTTAGTTTGAAAAATAATTGACTGGAAATTTA CCAAATAGTAACTTTTTTTTAATTATTTTCTCTCCTTTAAAGTTGAAATG ATCTCAAATATTTTTCAGACTGTGGTAATGGTTCCAAACTAAGCCGTATT GGATGTTTTACAAAGAATGATAATGCCCCTACCAAGTTCATAATGAGAAA GCCAGTCTATGGTGATGGATCAATAAAGAGGTATTTTCTTTTTCTTCAAA TAGTCATAGCTTAAAAGATCAGGTTGAAATGAAACCTTCCGGCGAGTTAA GGGATTCTTTACAGCCAATTTTCACTATTCTGCCTTTTAGCTCCGATAAT CGCCAGGCTTAGCTTTGTCCTTAAATCTTATTTTTTTTGCATTTATGTAT GAGCCTTTTAAAGTCTTGTTATTATTATAAATTACAGTTTGGCTTGTGAC TGTGCAGCAAAAGCAAAAGAAGGAGCACTAGTTCTAACCGACTACGAGGA ATGTTTTGAAACTAAGGCTGCGGATCACGGGAGTCGTTATCCTGGTCAAA CTTCATACGAGAAATGTATCAACACAGTCTTTCATCATTGTGAAAAAGGT CAAAATTGTATTGGTACCACTGATTCTGTTTATATTTATGCAAAAGTAGG TATGTATAAATTGCATTTAGCCTGAGATCAGGTTGTGATTTGTCTTCTGT TCATCACGCTAAAGCTCAAACTAAACGAATGGGTGAAAAAACGATCTGAA AAATATTCAATCTCGATTTACTTTTAAACCTATAAGATTTTGCTATTTCA AGGCGAAAACAAGCTCTCTGATTAAACTCCCAAAAAGGGCCCCCCCCCCC AAAAAAAAGTTCTTGTTGAATTTAATTCGCCATAACATTATAACAAATCA AAGGTTTTAGTTTACTGAAAAGACACAATTAGTAATAAGAGATTTGAACC ATACAACGCTCTGTTTTGTTTTCACTCAGTTATACCAGGTGAATCATTTT GACATTATGCCATGGCAAGGGATACTCAGTAGTATAAAGAACATTCCCTA CAATTTTAGATTTATTGAAATTAAAAATGATTTGAAAGAATTTGCAATAA AGTCAAAATTGGCCCAACCGTTCCCTTAAAAGTTCAGTGTTTGGCGACTA TATTGTCTTTATCAAATTAAACTATTCTTAACAATCTTTTAAAATCAATT TTAGTTGATGGAAAATGGAGTACATGGTCCGCTGTCGGAGCATGTAATCG AAAATGTGGTCCAGGGCGCCGACGATTCACAAGAAAATGTAATAACCCAA AGCCTGCTTTTGGTGGAAAATCATGCGAAGGACCGAAAATCAAATTCGAG TCCTGCAACAATGGAGCGTGTCCGGTTAATGGAAAATGGAGTACATGGTC ATCTTTCGGAGCATGTAATCGAAGATGTGGTCCAGGGCGCCGACGAGCAA CAAGAAATTGCAATAACCCAAAGCCTGCTTTTGGCGGAAAATCATGCATA GGACCGAAAATCAAATTCGAGTCCTGCAACAATGGAGCGTGTATTCCAGG TATTCTTTTTAAATCACGGTGTAAATCACTTTTGATTGAGTGTATTTTAT TGTAGGAGATGTATATATATGACCCTGTCTCGCAGCTCCAATGAAACTTT TTCCCGTAGCGGGGATGAGAAGTTCTATCGAAATCCAAATGAATTCAATG AGGATAGTAATTCTATTGCTCTAAGGTGAAAAGATCCAGTGGTGATGGTT TTGGAGTGCAATTTTTTCCGTTCAATAATAAATAGGGATGAAAACAAAGT CCATTTCTCAGTGGGGTTGAAATTTTTGGGGTATTTTTCCCACGGGGGAC GAAATTTCGGTCAAATCTTCCAATGAGTTGGGGGTCCCACCAGGTCTGTG ACACAGGAGTGTATATTGCCTAAATTGTTTTTAAAATACTTTGTATCAAA CCTAAACATTGGCCAAAATTATCTAATTGCCCCGCAGGGGCTTTTGTTGA TTCTCGCAGTGGGCTTGTTTGCCAGAAAAATATTCATGTTCATGTTCATG ATGTTGTTTCTTTCGATTCTGAGCGGGCCGCCGCGGTTAAAGAATGCTCG CGCGCACCTATCATTTTATCTATTTTGTTGCGACTTGTATTAATTCTCAC GTTTTAGTTCTTACAACGTAAACAATGGATGGCGCATAACATGAGCATTT TTCTTTTTCTTATAAGCATCTACTTTATAAGCATCAAATCAATAACTCTT GATAGACGGTGATATACCCTTCGTGAATTAGTTCTTACAAAGTAAACAAG GGACGGCGCATAATATGAACATATTTATTTTTCTTATGATTTTTCTTATA AGCACCTACTTTAAAAGAATCAAATCAATAACTCTTGATAAAGAGCCATA CATTTTTCGGTAATTAGCTCTTACAAAGTAAACAAGGGACAGTGCACAAT ATGAGCCTGTTTATTGTTCTTATAAGCATCTAGTTTATAAGATTCAGATC AATAACTCTTGATCAACAGCTTTATACCTTTTGGCATAGTTCTTATAAAG TAAACCAGGGACAGTGCACAATGAGAGCATTTTTATTTGTCTTATAAGCA CCTACTTCATAAGAATCAAATCAATAACTTTTGATAAACAGCCATATATC TTTCGGTACAGCGAATAGAAATTTGTAGCTGTGCGCTTATTGGATGGCGC TCCAATAAAACGATCTGTTGGAATGCGGCCTTCAAACGTTCATTCTCGAT TATGAATGCGTTCGCGGGGCATTCATAGCGACAGCTACTTGCCCGGGGGG TACTACCCTTGTCGACCGACGGGGGTGCTCCGCTGAGGTTCGAAAAATGG ACCCTACGTGGGACTCGAAATTTGCGAAAAAAGTGACCCTGNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNGCTCCAATAAAACGATCTGGTGGAATGCGGCCTTCAAACGTTC ATTCTCGATTATGAATGCGTTCGCGGGGCATTCATAGCGACAGCTACTTG CTAGTAAATATCAATGAAATAAGTAGTAGTTATCCTATATTGTACGAGTA AAAGTGTGATAACTGGTTTATCGTCAACTTGAAAAATATTAACAAACTTT TCTCTCTCCATTTTATTTGTCTTCTCTCTCTTCTTTGTTTTGTTTTTTCA CAAATCAACATCAAAACATTAACATCTTCGAAAATGATTCGAATGCTCAT TAAAATATTAAAATATAAATAATTTTTGTGAGTATTGAGAGGAAAAAAGA AAACATTCCTGAGAATAACTTTCGGGATAAGATACAAAAATAAATCCAAA TATGATCTCTCGCTTACCAGACCCCTTTTTGAACGCGGTCTTGTATGTGT ACGGTACAATAAGCAGATATTCAATAGGTAAAAATTGGTTATTGAGATCC CGGGGGGGGTACTACCCTTGTCGACCGACGGGGGTGCTCCGCTGAGGTTC GAAAAATGGACCCTACGTGGGACTCGAAATTTGCGAAAAAGGTGACCCTG NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NATATGCAATCCCTTATTCTCAAATAAAAATATTGCTTCATACTGTTTTT ACCTTCCAAAAACAACAAAAATCTGGCGGACTGTTTTACAGTCCGCCAAA GCAAAAACATATTACCATATACTACTGGGCCACTTAATCGCGCCATCCAG TCTATCAAAAAGCTTTAAGTGGACCCCGGGCTAGAGGTCGATGTAATGTT CAACGAGGCGAAGCCGAGTTGAATATATATCACCGAGGGTTAATAAATCC AATAGCCAACGAAAACCTATCGAATATATGTTTTATTATATACCTAGAGG CAAAAACAAAACTGAAATTATGTAAATAGTCAAACGATTCACATAAAACA CTCCCATAATAGAACGGTCGAATGTTTTTCTTTTTTAATGATTTTCTTAA TTAAAAGAATCTAACTTTGAAAGCAAAATTTGAAGAAAAAAAAATTCTAC CGTGGTATAATAGCCATGGTGTATCAGGAATTATTCAATGGCTGTTTTTG CCTACTTGTATATAATAATATAGAATACAGCATTTATATATGCGTTTTTA TATCTCAAGCAGACGACGACATTGAGAGAAGTTACCAAAATCTGATTAAA ACTGAAGTCTGTCTCAATATAGTTTGCAGAGGAGACAAAAAAGGCTGTAA CTTTTGATAGAATTCGAATTAGAAAACAGTTTTGTGCTCGTTTGAAAGAT AATCCAGAGTGGAATATTTGCAAAAAAGAAAAATCTTTAAAAAAATGGAA AAAAGAAGATGAAAAAAGAAGAAGAATAAAATCAACTTCTTATAGATTAA TGCTGTGATCTTCATTTTTATATCAGAGGTTCTTTAATCTTAGAACGTCA TAAATGGGAAAGAAATCAAAGAATATTTGTTTAGTAAAAAAATACAACTT AAAACTTTGCTTTGGTCGACTTTTTTGTTGTTTTTAGGTGGTTTTCGAAA AGTTAAGATCAATCCATCTTTGATCTAGTCTAGCTTGAAAAGCTTGTAAT AAGTTAAACAAGATAGGGCACTCTAATTTGTTTAACGCTCTCAAACTTCA AACTTTTAGAAGTCTTGTCGAGCCCATTCTTCTTTATGGCTCAGAGACTT GGACTATGACAAAAACTATGCTGAAGAGCCTGATGGCTGTTATACAAACC TTTTGCAAAGAATACAGAATCTTGATTGGCGCAACCACCCAACCCTTCAC GAGATCTATCATGGACTCTTTCTCAGGTCAATGTTTCCGTGCACCAAATG AAATCGTATCTGAAATCCTACTTCGGTGTCCTGCTGGCCCTAGGCGCTCG AAAAAGCACACACTTCTTGATATTTCAGGGCCGGCGAAACTGGGGGGCCG GGGGGCCATGCCCCCCCCCACTTTTTTGCTAAGAAAGGCCCAACCATGGT GGCGCCTCCTTAGACACTTACTATTTGGCCCCTCCACTTTCAAAATTGAT TCGCCGGCCCTGTATTTTGAAACGAAAAACAGGAATAGAGATTGAGGAAC TGAGTACTGCAATGGCTGATCGCAAACTGTGGATTGAGGGTTATTCTTTG TTTCCGACCTAGGTGATGATAATGAGGATGCGTTTTTAGCCAATCAGATT TCTCATATTTCTCATGTTGACGATAAAGGAAGGAAATTCCAAACGTTGTA TATTTATCTTTGTCTTTTGATGTTTTTTTAAACTTATTACCCCTGTCTTT GTGCCTTACCAAGAACCCAGATTGTTTTCAAAATAAAAATAATATACCAC CTTTCTTTCTTTTTAGATTTAAGAAACCAAGGACAAAATTGTTGGAAAAA ACCTACCTATTTCTGTGGTAAAAAAGGTCTTTGCAGTCGAAAAGGATGGG GTCGATGGCAAGACGCTGCATTCCCCTGCGTTAATAGGCACTGTTGTACT GAGCCAGCTCTTGTTAAGAACCTAGGTAAGATTAATTTTTCATTGACCTT AAAACTATTAGGAGTTTTAAGAATTTTGCAGCAATTTAGATAATCCCTTC ATTTAAACTCAGGGAATATAATAGCTAGCCAGTGGATACAAGACATCAAA TTTGGTTGGAACAAAGTAATTTTATAAAACGTTGAAGTTACCTGCAACAA AAACAATATGCTATCCAAAAGAGGGTCCCATTAACTTGCATGAGAAATGA GGCGCTAAAATTCTGCATCTTTATACTACAGTTCTGTAGTTTCATAACAC AATTATATTTAAGGCTCAAATTGCTGGTGGAAGTGTGGTAANTCTTTGTT TCCGACCTAGGTGATGATAATGAGGATGCGTTTTTAGCCAATCAGATTTC TCATATTTCTCATGTTGACGATAAAGGAAGGAAATTCCAAACGTTGTATA TTTATCTTTGTCTTTTGATGTTTTTTTAAACTTATTACCCCTGTCTTTGT GCCTTACCAAGAACCCAGATTGTTTTCAAAATAAAAATAATATACCACCT TTCTTTCTTTTTAGATTTAAGAAACCAAGGACAAAATTGTTGGAAAAAAC CTACCTATTTCTGTGGTAAAAAAGGTCTTTGCAGTCGAAAAGGATGGGGT CGATGGCAAGACGCTGCATTCCCCTGCGTTAATAGGCACTGTTGTACTGA GCCAGCTCTTGTTAAGAACCTAGGTAAGATTAATTTTTCATTGACCTTAA AACTATTAGGAGTTTTAAGAATTTTGCAGAAATTTAGATATTCCCTTCAT TTAAACTCAGGGAATATAATAGCTAGCCAGTGGATACAAGACGTCGAATT TGGTGTTGGAACAAAGTAATTTTATAAAACGTTGAAGTTACCTGCAACAA AAACAATATGCTATCCAAAAGAGGGTCCCGTTAACTTGCATGAGAAATGA GGCGCCAAAATTCTGCATCTTTATACTACAGTTCTGTATTTTCATAACAA AATTATATTTAAGGCTCAAATTGCTGGTCGAAGTGTGGTAGAAAGGGTGG TTACTGTCCTGGATTTTGTGGCGTGAACGGGCGTTGTTGTCGAAGAGGAT GGAATGATGCTGGGTGCGCAGGAATGGCCACACCGTGCAATGGGAAGCAT TGTTGTACAACTAAAAGACGAGATGTCCAAAATAGCGGTTGGTTCATATT TACACCAATCTTTGTACAGGGTGTCCCGAAAAAAAGTTACGTGTTCGAAT ATGATTCTGAGTAGTAGGTTGTTGCGTGTGTTTAACAAAATGTAAGAAAA TGTATACCACCACAATAATTGTTTTTACAACAGTCATCATTATGATAAAA AAGAATTAACTTTCTTTACAATTTTCATGACGTTAAAGTTATTGAGAATT GTTTTTTGTAAAAGTTATTCATAAAAGATGTCTCGTGACAATTAATATGA CACAGAGAAAAACTTTGATAAAAATAGCAAATTTAGTTAAACACACACAA GAACTTTCTTNNAAAAGAGGGAGAGCTTAAAATACAATTTTGTGAACACG CACATAAAACTTTCTACTCATAGTTGTGTTTCGACTCGATACTTTAATTA GGGACACCCTGTATAGAAGTGGTACGTCTCGATACTTTTTTCGGGACACC CTGTAGAAGTGGTTCGACTCGATACTAACTTTTTTTCGGGATGCCCTGTA GAAGATTTTGACTTTTTGTCTTTGAAACTTTCGGTGTAGATTTAGCATAA TACAGTTGGCACTCTCTAACTTGAATTTCAAGGGAAATTTTATTTTCATA AAGTAGGGAGCCTATTGAATAGTAAAAGAGTATCGTTTTTAATAGTTTCT TTTCGGCGGTGACTTTAAATTATGGAATAGTAGAACATCGAATTAGAGAG CGTCAAATGTATTCCTGAAAAAGTGGTTCTAAAAAAGCTCTTAATAACTT AAAGAATATTTAGAACCAGAAATTCGAATTCATTTTCCCATTCCAACCAA CCAATGTTCTTTCAACGTTCATCTAACGTTATATGTTTTACTCTGTTTTC TCATACAGGTAAAAATTGCTGGTGGAAATGTAACAAGAAAGATGGGGAAT GTTCGACAGGTTTTTGCGGTAAAGACGGAGTTTGTTGTCGACGTGGTTGG GATACTTACAGATGTATCCGGACTACTGGTGCATGCAGATACAAACATTG CTGTGTCGGTACAGCGGCTATGGGAATCCAAAAACCTTGAGCCGTCTTTT GATCGAGTCTCTGGAATTGGATTACAAATGGTTACTTAAAGAAAATGATT ACGTTGTGAAAACGTATCATTTCTAAATTATAATAAACATCATTTTTAGA TTTTGTAGCAGTATTTAAACAGTATATGAAAGTAGATTTTTGTAGTTCTT ATGGAAGTTGTACGTGCATTATCGTTTAAGAACTAATAATATAAAGATTG AAATAATATTTATTTCTTTTTTAACACTATAACTTTCGTATATAGAATAA ATAGATACTGAGAAAAT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000989XLOC_000989Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001917-exon-sc0000012-1575043694:177001..177079TCONS_00001917-exon-sc0000012-1575043694:177001..177079Clytia hemisphaericaexon
TCONS_00001917-exon-sc0000012-1575043694:174650..174761TCONS_00001917-exon-sc0000012-1575043694:174650..174761Clytia hemisphaericaexon
TCONS_00001917-exon-sc0000012-1575043694:174231..174442TCONS_00001917-exon-sc0000012-1575043694:174231..174442Clytia hemisphaericaexon
TCONS_00001917-exon-sc0000012-1575043694:173331..173675TCONS_00001917-exon-sc0000012-1575043694:173331..173675Clytia hemisphaericaexon
TCONS_00001917-exon-sc0000012-1575043694:167107..167265TCONS_00001917-exon-sc0000012-1575043694:167107..167265Clytia hemisphaericaexon
TCONS_00001917-exon-sc0000012-1575043694:166643..166816TCONS_00001917-exon-sc0000012-1575043694:166643..166816Clytia hemisphaericaexon
TCONS_00001917-exon-sc0000012-1575043694:165313..165771TCONS_00001917-exon-sc0000012-1575043694:165313..165771Clytia hemisphaericaexon
TCONS_00001917-exon-sc0000012-1510915933:177001..177079TCONS_00001917-exon-sc0000012-1510915933:177001..177079Clytia hemisphaericaexon
TCONS_00001917-exon-sc0000012-1510915933:174650..174761TCONS_00001917-exon-sc0000012-1510915933:174650..174761Clytia hemisphaericaexon
TCONS_00001917-exon-sc0000012-1510915933:174231..174442TCONS_00001917-exon-sc0000012-1510915933:174231..174442Clytia hemisphaericaexon
TCONS_00001917-exon-sc0000012-1510915933:173331..173675TCONS_00001917-exon-sc0000012-1510915933:173331..173675Clytia hemisphaericaexon
TCONS_00001917-exon-sc0000012-1510915933:167107..167265TCONS_00001917-exon-sc0000012-1510915933:167107..167265Clytia hemisphaericaexon
TCONS_00001917-exon-sc0000012-1510915933:166643..166816TCONS_00001917-exon-sc0000012-1510915933:166643..166816Clytia hemisphaericaexon
TCONS_00001917-exon-sc0000012-1510915933:165313..165771TCONS_00001917-exon-sc0000012-1510915933:165313..165771Clytia hemisphaericaexon
TCONS_00001917-exon-sc0000012-1491911889:177001..177079TCONS_00001917-exon-sc0000012-1491911889:177001..177079Clytia hemisphaericaexon
TCONS_00001917-exon-sc0000012-1491911889:174650..174761TCONS_00001917-exon-sc0000012-1491911889:174650..174761Clytia hemisphaericaexon
TCONS_00001917-exon-sc0000012-1491911889:174231..174442TCONS_00001917-exon-sc0000012-1491911889:174231..174442Clytia hemisphaericaexon
TCONS_00001917-exon-sc0000012-1491911889:173331..173675TCONS_00001917-exon-sc0000012-1491911889:173331..173675Clytia hemisphaericaexon
TCONS_00001917-exon-sc0000012-1491911889:167107..167265TCONS_00001917-exon-sc0000012-1491911889:167107..167265Clytia hemisphaericaexon
TCONS_00001917-exon-sc0000012-1491911889:166643..166816TCONS_00001917-exon-sc0000012-1491911889:166643..166816Clytia hemisphaericaexon
TCONS_00001917-exon-sc0000012-1491911889:165313..165771TCONS_00001917-exon-sc0000012-1491911889:165313..165771Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000012supercontigsc0000012:165313..177079 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.0956879 0.446973 0.0712558 0.103259 0.0178418 0.0171646 14.6573 12.8293 75.3697 37.7351 61.7139 103.749 4.35898 3.37839 30.5027 25.4716 0.0951381 0.0879508 0.0659504 0 0.123022 0.0375461 0.0400362 0.0278651 0.0311971 0.0249784 0 0.0115414 0.0222928 0.0203908
Blast
BLAST of TCONS_00001917 vs. Swiss-Prot (Human)
Match: HMCN1 (Hemicentin-1 OS=Homo sapiens GN=HMCN1 PE=1 SV=2)

HSP 1 Score: 115.161 bits (287), Expect = 1.051e-26
Identity = 56/143 (39.16%), Postives = 84/143 (58.74%), Query Frame = 1
Query:  403 VDGKWSTWSAVGACNRKCGPGRRRFTRKCNNPKPAFGGKSCEGPKIKFESCNNGACPVNGKWSTWSSFGXXXXXXXXXXXXXXXXCNNPKPAFGGKSCIGPKIKFESCNNGACIPDLRNQGQNCWKKPTYFCG-----KKGLC 816
            + GKW+TW++  AC+  CG G R+ TR C++P P +GG+ CEG  ++ + CN+  CP +G WS WS +G C+R C  G+ R  R C+NP P+ GG++C GP  + + CN   C  D      + W + +  CG     +K LC
Sbjct: 4699 IHGKWATWASWSACSVSCGGGARQRTRGCSDPVPQYGGRKCEGSDVQSDFCNSDPCPTHGNWSPWSGWGTCSRTCNGGQMRRYRTCDNPPPSNGGRACGGPDSQIQRCNTDMCPVDGSWGSWHSWSQCSASCGGGEKTRKRLC 4841          

HSP 2 Score: 111.694 bits (278), Expect = 1.248e-25
Identity = 64/168 (38.10%), Postives = 91/168 (54.17%), Query Frame = 1
Query:  247 YEECFETKAADHGSRYPGQTSYEKCINTVFHHCEKGQNCIGTTDSVY---IYAKVVDGKWSTWSAVGACNRKCGPGRRRFTRKCNNPKPAFGGKSCEGPKIKFESCNNGACPVNGKWSTWSSFGXXXXXXXXXXXXXXXXCNNPKPAFGGKSCIGPKIKFESCNNGAC 741
            +EEC  T++   G+    QT    C N    H   G+ C G    +    I    V G WS W   G C+  CG G +   R CNNP PAFGG  C+G + + + CN   CP++GKW+TW+S+ AC+  CG G R+ TR C++P P +GG+ C G  ++ + CN+  C
Sbjct: 4595 WEEC--TRSCGRGN----QTRTRTCNNPSVQH--GGRPCEGNAVEIIMCNIRPCPVHGAWSAWQPWGTCSESCGKGTQTRARLCNNPPPAFGGSYCDGAETQMQVCNERNCPIHGKWATWASWSACSVSCGGGARQRTRGCSDPVPQYGGRKCEGSDVQSDFCNSDPC 4754          

HSP 3 Score: 107.842 bits (268), Expect = 2.677e-24
Identity = 55/133 (41.35%), Postives = 68/133 (51.13%), Query Frame = 1
Query:  403 VDGKWSTWSAVGACNRKCGPGRRRFTRKCNNPKPAFGGKSCEGPKIKFESCNNGACPVNGKWSTWSSFGXXXXXXXXXXXXXXXXCNNPKPAFGGKSCIGPKIKFESCNNGACIPDLRNQGQNCWKKPTYFCG 801
            VDG WS WS    C R CG G +  TR CNNP    GG+ CEG  ++   CN   CPV+G WS W  +G C+  CG G +   R CNNP PAFGG  C G + + + CN   C    +      W   +  CG
Sbjct: 4585 VDGSWSEWSLWEECTRSCGRGNQTRTRTCNNPSVQHGGRPCEGNAVEIIMCNIRPCPVHGAWSAWQPWGTCSESCGKGTQTRARLCNNPPPAFGGSYCDGAETQMQVCNERNCPIHGKWATWASWSACSVSCG 4717          

HSP 4 Score: 100.523 bits (249), Expect = 5.316e-22
Identity = 46/111 (41.44%), Postives = 63/111 (56.76%), Query Frame = 1
Query:  409 GKWSTWSAVGACNRKCGPGRRRFTRKCNNPKPAFGGKSCEGPKIKFESCNNGACPVNGKWSTWSSFGXXXXXXXXXXXXXXXXCNNPKPAFGGKSCIGPKIKFESCNNGAC 741
            G WS WS  G C+R C  G+ R  R C+NP P+ GG++C GP  + + CN   CPV+G W +W S+  C+  CG G +   R C++P P  GG+ C G   +   CN  AC
Sbjct: 4758 GNWSPWSGWGTCSRTCNGGQMRRYRTCDNPPPSNGGRACGGPDSQIQRCNTDMCPVDGSWGSWHSWSQCSASCGGGEKTRKRLCDHPVPVKGGRPCPGDTTQVTRCNVQAC 4868          

HSP 5 Score: 93.9745 bits (232), Expect = 6.068e-20
Identity = 54/134 (40.30%), Postives = 70/134 (52.24%), Query Frame = 1
Query:  403 VDGKWSTWSAVGACNRKCGPGRRRFTRKCNNPKPAFGGKSCEGPKIKFESCNNGACPVNGKWSTWSSFGXXXXXXXXXXXXXXXXCNNPKPAFGGKSCIGPKIKFESCNNGACIPDLRNQGQNCWKKPTYFCGK 804
            V G +S WSA  AC+  CG G ++ +R CN P PA GGK C+G  ++  +C N  CPV+G WS WS +  C R CG G +  TR CNNP    GG+ C G  ++   CN   C           W   +  CGK
Sbjct: 4528 VHGGFSQWSAWRACSVTCGKGIQKRSRLCNQPLPANGGKPCQGSDLEMRNCQNKPCPVDGSWSEWSLWEECTRSCGRGNQTRTRTCNNPSVQHGGRPCEGNAVEIIMCNIRPCPVHGAWSAWQPWGTCSESCGK 4661          
The following BLAST results are available for this feature:
BLAST of TCONS_00001917 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
HMCN11.051e-2639.16Hemicentin-1 OS=Homo sapiens GN=HMCN1 PE=1 SV=2[more]
back to top