Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001916 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001916
Unique NameTCONS_00001916
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1538

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001916 ID=TCONS_00001916|Name=TCONS_00001916|organism=Clytia hemisphaerica|type=transcript|length=1538bp
agaAATCAAGTACATCATGATGTTGCAATTATTCATCGCAATTTATTTGG
CATCGGGATGTTTTGCAGACATTCTAGactGTGGTAATGGTTCCAAACTA
AGCCGTATTGGATGTTTTACAAAGAATGATAATGCCCCTACCAAGTTCAT
AATGAGAAAGCCAGTCTATGGTGATGGATCAATAAAGagTTTGGCTTGTG
ACTGTGCAGCAAAAGCAAAAGAAGGAGCACTAGTTCTAACCGACTACGAG
GAATGTTTTGAAACTAAGGCTGCGGATCACGGGAGTCGTTATCCTGGTCA
AACTTCATACGAGAAATGTATCAACACAGTCTTTCATCATTgtgaaaaag
gtcaaaattgtATTGGTACCACTGATTCTGTTTATATTTATGCAAAAGTA
GttGATGGAAAATGGAGTACATGGTCCGCTGTCGGAGCATGTAATCGAAA
ATGTGGTCCAGGGCGCCGACGATTCACAAGAAAATGTAATAACCCAAAGC
CTGCTTTTGGTGGAAAATCATGCGAAGGACCGAAAATCAAATTCGAGTCC
TGCAACAATGGAGCGTGTCCGGTTAATGGAAAATGGAGTACATGGTCATC
TTTCGGAGCATGTAATCGAAGATGTGGTCCAGGGCGCCGACGAGCAACAA
GAAATTGCAATAACCCAAAGCCTGCTTTTGGCGGAAAATCATGCATAGGA
CCGAAAATCAAATTCGAGTCCTGCAACAATGGAGCGTGTATTCCAGattT
AAGAAACCAAGGACAAAATTGTTGGAAAAAACCTACCTATTTCTGTGGTA
AAAAAGGTCTTTGCAGTCGAAAAGGATGGGGTCGATGGCAAGACGCTGCA
TTCCCCTGCGTTAATAGGCACTGTTGTACTGAGCCAGCTCTTGTTAAGAA
CCTAGGCTCAAATTGCTGGTCGAAGTGTGGTAGAAAGGGTGGTTACTGTC
CTGGATTTTGTGGCGTGAACGGGCGTTGTTGTCGAAGAGGATGGAATGAT
GCTGGGTGCGCAGGAATGGCCACACCGTGCAATGGGAAGCATTGTTGTAC
AACTAAAAGACGAGATGTCCAAAATAGCGGTAAAAATTGCTGGTGGAAAT
GTAACAAGAAAGATGGGGAATGTTCGACAGGTTTTTGCGGTAAAGACGGA
GTTTGTTGTCGACGTGGTTGGGATACTTACAGATGTATCCGGACTACTGG
TGCATGCAGATACAAACATTGCTGTGTCGGTACAGCGGCTATGGGAATCC
AAAAACCTTGAGCCGTCTTTTGATCGAGTCTCTGGAATTGGATTACAAAT
GGTTACTTAAAGAAAATGATTACGTTGTGAAAACGTATCATTTCTAAATT
ATAATAAAcatcatttttagattttgtagCAGTATTTAAACAGTATATGA
AAGTAGATTTTTGTAGTTCTTATGGAAGTTGTACGTGCATTATCGTTTAA
GAACTAATAATATAAAGATTGAAataatatttatttcttttttaacacTA
TAACTTTCGTATATAGAATAAATAGATACtgagaaaat
Run BLAST on NCBI

protein sequence of TCONS_00001916-protein

>TCONS_00001916-protein ID=TCONS_00001916-protein|Name=TCONS_00001916-protein|organism=Clytia hemisphaerica|type=polypeptide|length=419bp
EIKYIMMLQLFIAIYLASGCFADILDCGNGSKLSRIGCFTKNDNAPTKFI
MRKPVYGDGSIKSLACDCAAKAKEGALVLTDYEECFETKAADHGSRYPGQ
TSYEKCINTVFHHCEKGQNCIGTTDSVYIYAKVVDGKWSTWSAVGACNRK
CGPGRRRFTRKCNNPKPAFGGKSCEGPKIKFESCNNGACPVNGKWSTWSS
FGACNRRCGPGRRRATRNCNNPKPAFGGKSCIGPKIKFESCNNGACIPDL
RNQGQNCWKKPTYFCGKKGLCSRKGWGRWQDAAFPCVNRHCCTEPALVKN
LGSNCWSKCGRKGGYCPGFCGVNGRCCRRGWNDAGCAGMATPCNGKHCCT
TKRRDVQNSGKNCWWKCNKKDGECSTGFCGKDGVCCRRGWDTYRCIRTTG
ACRYKHCCVGTAAMGIQKP
Run BLAST on NCBI

transcript from alignment at sc0000012:165313..177077-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001916 ID=TCONS_00001916|Name=TCONS_00001916|organism=Clytia hemisphaerica|type=transcript|length=11765bp|location=Sequence derived from alignment at sc0000012:165313..177077- (Clytia hemisphaerica)
AGAAATCAAGTACATCATGATGTTGCAATTATTCATCGCAATTTATTTGG CATCGGGATGTTTTGCAGACATTCTAGGTAGGCTGTTTATTATAAAAACC CCTTCATAGGGATCAGTTTAAATGTTTTCAAATCACAGGGCGAGGAGAGA AATCAAGGAACCAAATGATATGGAAGATTGTTAACCCTTTATAAGGGGGG TTTGTACTTTTCCGGTGTGGCGGGATTGGCCCTTTTTTAGTACGGTATTA CGGGATTTGACGAAAAAAGAGACGGGAAAACGGTATTTCAAAATCAGACG GTGACGGTATTTAGGTACATTTTCGCCCTGTACAAGCCGGTGTGACGGTG TTATTATTTTTTCAATTTTCGGGATTCCGGGATTCAGCAAANGTGTGACG GTGTTATTATTTTTCCAATTTTCGGGATTCCGGGATTCAGCAAAAATTTT GACGGGAAAACGGTATTTCGAACCCCTACAAACCCCCCCCCTCCTTTATA TGCCATGGTCATTTTTTTCTAAGTTTTTTAAAGAAAATCACTAGTTAAAA CTTTAAAGGCTTATATCTCGAGATCTAGAAGGAGTTAGAAGCTTGTTCAT AGCTCGTTTGATAGCTTGGAGTCTCCTCTTTCTTTAAGGCACCTTTGAGG CCGCCCGATTTAGGAAGGGCGGGGTGGGCTGCGCGGACCTGTCTAAATGA TAGAAAGATGCCCAATGGTAAAACTTTAAATTAATTCGCTGGAGGACAGA ATCAAGTAAAACAGGGCTAAATTTGGTGGTTCTTGGATCACTCGTTGANA CAGAATCAAGTAAAACAGGGCCAAATTTGGTGGTTCTTGGATCACTCGTT GACCAAAAATGGTCAAAAAACGGTCAAAATCTTAAAAGAGTGGATTTTTG TCAAATCTTTGCATTTTTTTGACTTTTTGGCTTAAAATCTCGCTGGAAAG GCTCCTGTTGATTTTTTTTANATGATCAAAAAACGGTCAAAATCTTAAAA GAGTGGATTTTTGTCAAATCTTTGCATTTTTTTGACTTTTTGGCTTAAAA TATCGCTGGAAAGGCTCCCTGTTGATTTTTTTTTTTGCTTCACCATGAAG CCCAATCCAATTCATACGAGTTAGACTAACAATGATGATTTCTAACTCAA ACTGTGCATTACAGCCCATGTCTGATATATACGACATTGGCATTTAAAGG GTTGATTTGAAGGGAATCTCAAATTTGATTTCAGAACTTTATATGGTTGA AATAATTTTTCATGTTAGGAAATTTTTGAGTAATTTATGTGAATAAGGTC ATTAGTAGGGGATCTTAACTTGACCTGTGGAGCTGCTGGTACTTAGAAAT GGTGTCAGGAAAATTGCCCCCGAGAAAATTGNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNAGGGGGCAGTTTTCCTAGGGGGCAATTTTCCGGGGGGCAATTTTCC GGGGGCAGTTTTCCGGGGGGCAATTTTCTCGGGGGCAATTTTCCTAGAAC CCTTAGAAATATGTTAAAATTAGCTCTAAATTCAACCTATATCTCCTTAA AAAATGTTTTTCAATAGTTAGTTTGAAAAATAATTGACTGGAAATTTACC AAATAGTAACTTTTTTTTAATTATTTTCTCTCCTTTAAAGTTGAAATGAT CTCAAATATTTTTCAGACTGTGGTAATGGTTCCAAACTAAGCCGTATTGG ATGTTTTACAAAGAATGATAATGCCCCTACCAAGTTCATAATGAGAAAGC CAGTCTATGGTGATGGATCAATAAAGAGGTATTTTCTTTTTCTTCAAATA GTCATAGCTTAAAAGATCAGGTTGAAATGAAACCTTCCGGCGAGTTAAGG GATTCTTTACAGCCAATTTTCACTATTCTGCCTTTTAGCTCCGATAATCG CCAGGCTTAGCTTTGTCCTTAAATCTTATTTTTTTTGCATTTATGTATGA GCCTTTTAAAGTCTTGTTATTATTATAAATTACAGTTTGGCTTGTGACTG TGCAGCAAAAGCAAAAGAAGGAGCACTAGTTCTAACCGACTACGAGGAAT GTTTTGAAACTAAGGCTGCGGATCACGGGAGTCGTTATCCTGGTCAAACT TCATACGAGAAATGTATCAACACAGTCTTTCATCATTGTGAAAAAGGTCA AAATTGTATTGGTACCACTGATTCTGTTTATATTTATGCAAAAGTAGGTA TGTATAAATTGCATTTAGCCTGAGATCAGGTTGTGATTTGTCTTCTGTTC ATCACGCTAAAGCTCAAACTAAACGAATGGGTGAAAAAACGATCTGAAAA ATATTCAATCTCGATTTACTTTTAAACCTATAAGATTTTGCTATTTCAAG GCGAAAACAAGCTCTCTGATTAAACTCCCAAAAAGGGCCCCCCCCCCCAA AAAAAAGTTCTTGTTGAATTTAATTCGCCATAACATTATAACAAATCAAA GGTTTTAGTTTACTGAAAAGACACAATTAGTAATAAGAGATTTGAACCAT ACAACGCTCTGTTTTGTTTTCACTCAGTTATACCAGGTGAATCATTTTGA CATTATGCCATGGCAAGGGATACTCAGTAGTATAAAGAACATTCCCTACA ATTTTAGATTTATTGAAATTAAAAATGATTTGAAAGAATTTGCAATAAAG TCAAAATTGGCCCAACCGTTCCCTTAAAAGTTCAGTGTTTGGCGACTATA TTGTCTTTATCAAATTAAACTATTCTTAACAATCTTTTAAAATCAATTTT AGTTGATGGAAAATGGAGTACATGGTCCGCTGTCGGAGCATGTAATCGAA AATGTGGTCCAGGGCGCCGACGATTCACAAGAAAATGTAATAACCCAAAG CCTGCTTTTGGTGGAAAATCATGCGAAGGACCGAAAATCAAATTCGAGTC CTGCAACAATGGAGCGTGTCCGGTTAATGGAAAATGGAGTACATGGTCAT CTTTCGGAGCATGTAATCGAAGATGTGGTCCAGGGCGCCGACGAGCAACA AGAAATTGCAATAACCCAAAGCCTGCTTTTGGCGGAAAATCATGCATAGG ACCGAAAATCAAATTCGAGTCCTGCAACAATGGAGCGTGTATTCCAGGTA TTCTTTTTAAATCACGGTGTAAATCACTTTTGATTGAGTGTATTTTATTG TAGGAGATGTATATATATGACCCTGTCTCGCAGCTCCAATGAAACTTTTT CCCGTAGCGGGGATGAGAAGTTCTATCGAAATCCAAATGAATTCAATGAG GATAGTAATTCTATTGCTCTAAGGTGAAAAGATCCAGTGGTGATGGTTTT GGAGTGCAATTTTTTCCGTTCAATAATAAATAGGGATGAAAACAAAGTCC ATTTCTCAGTGGGGTTGAAATTTTTGGGGTATTTTTCCCACGGGGGACGA AATTTCGGTCAAATCTTCCAATGAGTTGGGGGTCCCACCAGGTCTGTGAC ACAGGAGTGTATATTGCCTAAATTGTTTTTAAAATACTTTGTATCAAACC TAAACATTGGCCAAAATTATCTAATTGCCCCGCAGGGGCTTTTGTTGATT CTCGCAGTGGGCTTGTTTGCCAGAAAAATATTCATGTTCATGTTCATGAT GTTGTTTCTTTCGATTCTGAGCGGGCCGCCGCGGTTAAAGAATGCTCGCG CGCACCTATCATTTTATCTATTTTGTTGCGACTTGTATTAATTCTCACGT TTTAGTTCTTACAACGTAAACAATGGATGGCGCATAACATGAGCATTTTT CTTTTTCTTATAAGCATCTACTTTATAAGCATCAAATCAATAACTCTTGA TAGACGGTGATATACCCTTCGTGAATTAGTTCTTACAAAGTAAACAAGGG ACGGCGCATAATATGAACATATTTATTTTTCTTATGATTTTTCTTATAAG CACCTACTTTAAAAGAATCAAATCAATAACTCTTGATAAAGAGCCATACA TTTTTCGGTAATTAGCTCTTACAAAGTAAACAAGGGACAGTGCACAATAT GAGCCTGTTTATTGTTCTTATAAGCATCTAGTTTATAAGATTCAGATCAA TAACTCTTGATCAACAGCTTTATACCTTTTGGCATAGTTCTTATAAAGTA AACCAGGGACAGTGCACAATGAGAGCATTTTTATTTGTCTTATAAGCACC TACTTCATAAGAATCAAATCAATAACTTTTGATAAACAGCCATATATCTT TCGGTACAGCGAATAGAAATTTGTAGCTGTGCGCTTATTGGATGGCGCTC CAATAAAACGATCTGTTGGAATGCGGCCTTCAAACGTTCATTCTCGATTA TGAATGCGTTCGCGGGGCATTCATAGCGACAGCTACTTGCCCGGGGGGTA CTACCCTTGTCGACCGACGGGGGTGCTCCGCTGAGGTTCGAAAAATGGAC CCTACGTGGGACTCGAAATTTGCGAAAAAAGTGACCCTGNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNGCTCCAATAAAACGATCTGGTGGAATGCGGCCTTCAAACGTTCAT TCTCGATTATGAATGCGTTCGCGGGGCATTCATAGCGACAGCTACTTGCT AGTAAATATCAATGAAATAAGTAGTAGTTATCCTATATTGTACGAGTAAA AGTGTGATAACTGGTTTATCGTCAACTTGAAAAATATTAACAAACTTTTC TCTCTCCATTTTATTTGTCTTCTCTCTCTTCTTTGTTTTGTTTTTTCACA AATCAACATCAAAACATTAACATCTTCGAAAATGATTCGAATGCTCATTA AAATATTAAAATATAAATAATTTTTGTGAGTATTGAGAGGAAAAAAGAAA ACATTCCTGAGAATAACTTTCGGGATAAGATACAAAAATAAATCCAAATA TGATCTCTCGCTTACCAGACCCCTTTTTGAACGCGGTCTTGTATGTGTAC GGTACAATAAGCAGATATTCAATAGGTAAAAATTGGTTATTGAGATCCCG GGGGGGGTACTACCCTTGTCGACCGACGGGGGTGCTCCGCTGAGGTTCGA AAAATGGACCCTACGTGGGACTCGAAATTTGCGAAAAAGGTGACCCTGNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNA TATGCAATCCCTTATTCTCAAATAAAAATATTGCTTCATACTGTTTTTAC CTTCCAAAAACAACAAAAATCTGGCGGACTGTTTTACAGTCCGCCAAAGC AAAAACATATTACCATATACTACTGGGCCACTTAATCGCGCCATCCAGTC TATCAAAAAGCTTTAAGTGGACCCCGGGCTAGAGGTCGATGTAATGTTCA ACGAGGCGAAGCCGAGTTGAATATATATCACCGAGGGTTAATAAATCCAA TAGCCAACGAAAACCTATCGAATATATGTTTTATTATATACCTAGAGGCA AAAACAAAACTGAAATTATGTAAATAGTCAAACGATTCACATAAAACACT CCCATAATAGAACGGTCGAATGTTTTTCTTTTTTAATGATTTTCTTAATT AAAAGAATCTAACTTTGAAAGCAAAATTTGAAGAAAAAAAAATTCTACCG TGGTATAATAGCCATGGTGTATCAGGAATTATTCAATGGCTGTTTTTGCC TACTTGTATATAATAATATAGAATACAGCATTTATATATGCGTTTTTATA TCTCAAGCAGACGACGACATTGAGAGAAGTTACCAAAATCTGATTAAAAC TGAAGTCTGTCTCAATATAGTTTGCAGAGGAGACAAAAAAGGCTGTAACT TTTGATAGAATTCGAATTAGAAAACAGTTTTGTGCTCGTTTGAAAGATAA TCCAGAGTGGAATATTTGCAAAAAAGAAAAATCTTTAAAAAAATGGAAAA AAGAAGATGAAAAAAGAAGAAGAATAAAATCAACTTCTTATAGATTAATG CTGTGATCTTCATTTTTATATCAGAGGTTCTTTAATCTTAGAACGTCATA AATGGGAAAGAAATCAAAGAATATTTGTTTAGTAAAAAAATACAACTTAA AACTTTGCTTTGGTCGACTTTTTTGTTGTTTTTAGGTGGTTTTCGAAAAG TTAAGATCAATCCATCTTTGATCTAGTCTAGCTTGAAAAGCTTGTAATAA GTTAAACAAGATAGGGCACTCTAATTTGTTTAACGCTCTCAAACTTCAAA CTTTTAGAAGTCTTGTCGAGCCCATTCTTCTTTATGGCTCAGAGACTTGG ACTATGACAAAAACTATGCTGAAGAGCCTGATGGCTGTTATACAAACCTT TTGCAAAGAATACAGAATCTTGATTGGCGCAACCACCCAACCCTTCACGA GATCTATCATGGACTCTTTCTCAGGTCAATGTTTCCGTGCACCAAATGAA ATCGTATCTGAAATCCTACTTCGGTGTCCTGCTGGCCCTAGGCGCTCGAA AAAGCACACACTTCTTGATATTTCAGGGCCGGCGAAACTGGGGGGCCGGG GGGCCATGCCCCCCCCCACTTTTTTGCTAAGAAAGGCCCAACCATGGTGG CGCCTCCTTAGACACTTACTATTTGGCCCCTCCACTTTCAAAATTGATTC GCCGGCCCTGTATTTTGAAACGAAAAACAGGAATAGAGATTGAGGAACTG AGTACTGCAATGGCTGATCGCAAACTGTGGATTGAGGGTTATTCTTTGTT TCCGACCTAGGTGATGATAATGAGGATGCGTTTTTAGCCAATCAGATTTC TCATATTTCTCATGTTGACGATAAAGGAAGGAAATTCCAAACGTTGTATA TTTATCTTTGTCTTTTGATGTTTTTTTAAACTTATTACCCCTGTCTTTGT GCCTTACCAAGAACCCAGATTGTTTTCAAAATAAAAATAATATACCACCT TTCTTTCTTTTTAGATTTAAGAAACCAAGGACAAAATTGTTGGAAAAAAC CTACCTATTTCTGTGGTAAAAAAGGTCTTTGCAGTCGAAAAGGATGGGGT CGATGGCAAGACGCTGCATTCCCCTGCGTTAATAGGCACTGTTGTACTGA GCCAGCTCTTGTTAAGAACCTAGGTAAGATTAATTTTTCATTGACCTTAA AACTATTAGGAGTTTTAAGAATTTTGCAGCAATTTAGATAATCCCTTCAT TTAAACTCAGGGAATATAATAGCTAGCCAGTGGATACAAGACATCAAATT TGGTTGGAACAAAGTAATTTTATAAAACGTTGAAGTTACCTGCAACAAAA ACAATATGCTATCCAAAAGAGGGTCCCATTAACTTGCATGAGAAATGAGG CGCTAAAATTCTGCATCTTTATACTACAGTTCTGTAGTTTCATAACACAA TTATATTTAAGGCTCAAATTGCTGGTGGAAGTGTGGTAANTCTTTGTTTC CGACCTAGGTGATGATAATGAGGATGCGTTTTTAGCCAATCAGATTTCTC ATATTTCTCATGTTGACGATAAAGGAAGGAAATTCCAAACGTTGTATATT TATCTTTGTCTTTTGATGTTTTTTTAAACTTATTACCCCTGTCTTTGTGC CTTACCAAGAACCCAGATTGTTTTCAAAATAAAAATAATATACCACCTTT CTTTCTTTTTAGATTTAAGAAACCAAGGACAAAATTGTTGGAAAAAACCT ACCTATTTCTGTGGTAAAAAAGGTCTTTGCAGTCGAAAAGGATGGGGTCG ATGGCAAGACGCTGCATTCCCCTGCGTTAATAGGCACTGTTGTACTGAGC CAGCTCTTGTTAAGAACCTAGGTAAGATTAATTTTTCATTGACCTTAAAA CTATTAGGAGTTTTAAGAATTTTGCAGAAATTTAGATATTCCCTTCATTT AAACTCAGGGAATATAATAGCTAGCCAGTGGATACAAGACGTCGAATTTG GTGTTGGAACAAAGTAATTTTATAAAACGTTGAAGTTACCTGCAACAAAA ACAATATGCTATCCAAAAGAGGGTCCCGTTAACTTGCATGAGAAATGAGG CGCCAAAATTCTGCATCTTTATACTACAGTTCTGTATTTTCATAACAAAA TTATATTTAAGGCTCAAATTGCTGGTCGAAGTGTGGTAGAAAGGGTGGTT ACTGTCCTGGATTTTGTGGCGTGAACGGGCGTTGTTGTCGAAGAGGATGG AATGATGCTGGGTGCGCAGGAATGGCCACACCGTGCAATGGGAAGCATTG TTGTACAACTAAAAGACGAGATGTCCAAAATAGCGGTTGGTTCATATTTA CACCAATCTTTGTACAGGGTGTCCCGAAAAAAAGTTACGTGTTCGAATAT GATTCTGAGTAGTAGGTTGTTGCGTGTGTTTAACAAAATGTAAGAAAATG TATACCACCACAATAATTGTTTTTACAACAGTCATCATTATGATAAAAAA GAATTAACTTTCTTTACAATTTTCATGACGTTAAAGTTATTGAGAATTGT TTTTTGTAAAAGTTATTCATAAAAGATGTCTCGTGACAATTAATATGACA CAGAGAAAAACTTTGATAAAAATAGCAAATTTAGTTAAACACACACAAGA ACTTTCTTNNAAAAGAGGGAGAGCTTAAAATACAATTTTGTGAACACGCA CATAAAACTTTCTACTCATAGTTGTGTTTCGACTCGATACTTTAATTAGG GACACCCTGTATAGAAGTGGTACGTCTCGATACTTTTTTCGGGACACCCT GTAGAAGTGGTTCGACTCGATACTAACTTTTTTTCGGGATGCCCTGTAGA AGATTTTGACTTTTTGTCTTTGAAACTTTCGGTGTAGATTTAGCATAATA CAGTTGGCACTCTCTAACTTGAATTTCAAGGGAAATTTTATTTTCATAAA GTAGGGAGCCTATTGAATAGTAAAAGAGTATCGTTTTTAATAGTTTCTTT TCGGCGGTGACTTTAAATTATGGAATAGTAGAACATCGAATTAGAGAGCG TCAAATGTATTCCTGAAAAAGTGGTTCTAAAAAAGCTCTTAATAACTTAA AGAATATTTAGAACCAGAAATTCGAATTCATTTTCCCATTCCAACCAACC AATGTTCTTTCAACGTTCATCTAACGTTATATGTTTTACTCTGTTTTCTC ATACAGGTAAAAATTGCTGGTGGAAATGTAACAAGAAAGATGGGGAATGT TCGACAGGTTTTTGCGGTAAAGACGGAGTTTGTTGTCGACGTGGTTGGGA TACTTACAGATGTATCCGGACTACTGGTGCATGCAGATACAAACATTGCT GTGTCGGTACAGCGGCTATGGGAATCCAAAAACCTTGAGCCGTCTTTTGA TCGAGTCTCTGGAATTGGATTACAAATGGTTACTTAAAGAAAATGATTAC GTTGTGAAAACGTATCATTTCTAAATTATAATAAACATCATTTTTAGATT TTGTAGCAGTATTTAAACAGTATATGAAAGTAGATTTTTGTAGTTCTTAT GGAAGTTGTACGTGCATTATCGTTTAAGAACTAATAATATAAAGATTGAA ATAATATTTATTTCTTTTTTAACACTATAACTTTCGTATATAGAATAAAT AGATACTGAGAAAAT

Coding sequence (CDS) from alignment at sc0000012:165313..177077-

>TCONS_00001916 ID=TCONS_00001916|Name=TCONS_00001916|organism=Clytia hemisphaerica|type=CDS|length=10080bp|location=Sequence derived from alignment at sc0000012:165313..177077- (Clytia hemisphaerica)
GTAAAAATTGCTGGTGGAAATGTAACAAGAAAGATGGGGAATGTTCGACA
GGTTTTTGCGGTAAAGACGGAGTTTGTTGTCGACGTGGTTGGGATACTTA
CAGATGTATCCGGACTACTGGTGCATGCAGATACAAACATTGCTGTGTCG
GTACAGCGGCTATGGGAATCCAAAAACCTTGAGCTCAAATTGCTGGTCGA
AGTGTGGTAGAAAGGGTGGTTACTGTCCTGGATTTTGTGGCGTGAACGGG
CGTTGTTGTCGAAGAGGATGGAATGATGCTGGGTGCGCAGGAATGGCCAC
ACCGTGCAATGGGAAGCATTGTTGTACAACTAAAAGACGAGATGTCCAAA
ATAGCGGTCTTTGCAGTCGAAAAGGATGGGGTCGATGGCAAGACGCTGCA
TTCCCCTGCGTTAATAGGCACTGTTGTACTGAGCCAGCTCTTGTTAAGAA
CCTAGATTTAAGAAACCAAGGACAAAATTGTTGGAAAAAACCTACCTATT
TCTGTGGTAAAAAAGTTGATGGAAAATGGAGTACATGGTCCGCTGTCGGA
GCATGTAATCGAAAATGTGGTCCAGGGCGCCGACGATTCACAAGAAAATG
TAATAACCCAAAGCCTGCTTTTGGTGGAAAATCATGCGAAGGACCGAAAA
TCAAATTCGAGTCCTGCAACAATGGAGCGTGTCCGGTTAATGGAAAATGG
AGTACATGGTCATCTTTCGGAGCATGTAATCGAAGATGTGGTCCAGGGCG
CCGACGAGCAACAAGAAATTGCAATAACCCAAAGCCTGCTTTTGGCGGAA
AATCATGCATAGGACCGAAAATCAAATTCGAGTCCTGCAACAATGGAGCG
TGTATTCCAGTTTGGCTTGTGACTGTGCAGCAAAAGCAAAAGAAGGAGCA
CTAGTTCTAACCGACTACGAGGAATGTTTTGAAACTAAGGCTGCGGATCA
CGGGAGTCGTTATCCTGGTCAAACTTCATACGAGAAATGTATCAACACAG
TCTTTCATCATTGTGAAAAAGGTCAAAATTGTATTGGTACCACTGATTCT
GTTTATATTTATGCAAAAGTAGACTGTGGTAATGGTTCCAAACTAAGCCG
TATTGGATGTTTTACAAAGAATGATAATGCCCCTACCAAGTTCATAATGA
GAAAGCCAGTCTATGGTGATGGATCAATAAAGAGGAAATCAAGTACATCA
TGATGTTGCAATTATTCATCGCAATTTATTTGGCATCGGGATGTTTTGCA
GACATTCTAGGTAAAAATTGCTGGTGGAAATGTAACAAGAAAGATGGGGA
ATGTTCGACAGGTTTTTGCGGTAAAGACGGAGTTTGTTGTCGACGTGGTT
GGGATACTTACAGATGTATCCGGACTACTGGTGCATGCAGATACAAACAT
TGCTGTGTCGGTACAGCGGCTATGGGAATCCAAAAACCTTGAGCTCAAAT
TGCTGGTCGAAGTGTGGTAGAAAGGGTGGTTACTGTCCTGGATTTTGTGG
CGTGAACGGGCGTTGTTGTCGAAGAGGATGGAATGATGCTGGGTGCGCAG
GAATGGCCACACCGTGCAATGGGAAGCATTGTTGTACAACTAAAAGACGA
GATGTCCAAAATAGCGGTCTTTGCAGTCGAAAAGGATGGGGTCGATGGCA
AGACGCTGCATTCCCCTGCGTTAATAGGCACTGTTGTACTGAGCCAGCTC
TTGTTAAGAACCTAGATTTAAGAAACCAAGGACAAAATTGTTGGAAAAAA
CCTACCTATTTCTGTGGTAAAAAAGTTGATGGAAAATGGAGTACATGGTC
CGCTGTCGGAGCATGTAATCGAAAATGTGGTCCAGGGCGCCGACGATTCA
CAAGAAAATGTAATAACCCAAAGCCTGCTTTTGGTGGAAAATCATGCGAA
GGACCGAAAATCAAATTCGAGTCCTGCAACAATGGAGCGTGTCCGGTTAA
TGGAAAATGGAGTACATGGTCATCTTTCGGAGCATGTAATCGAAGATGTG
GTCCAGGGCGCCGACGAGCAACAAGAAATTGCAATAACCCAAAGCCTGCT
TTTGGCGGAAAATCATGCATAGGACCGAAAATCAAATTCGAGTCCTGCAA
CAATGGAGCGTGTATTCCAGTTTGGCTTGTGACTGTGCAGCAAAAGCAAA
AGAAGGAGCACTAGTTCTAACCGACTACGAGGAATGTTTTGAAACTAAGG
CTGCGGATCACGGGAGTCGTTATCCTGGTCAAACTTCATACGAGAAATGT
ATCAACACAGTCTTTCATCATTGTGAAAAAGGTCAAAATTGTATTGGTAC
CACTGATTCTGTTTATATTTATGCAAAAGTAGACTGTGGTAATGGTTCCA
AACTAAGCCGTATTGGATGTTTTACAAAGAATGATAATGCCCCTACCAAG
TTCATAATGAGAAAGCCAGTCTATGGTGATGGATCAATAAAGAGGAAATC
AAGTACATCATGATGTTGCAATTATTCATCGCAATTTATTTGGCATCGGG
ATGTTTTGCAGACATTCTAGGTAAAAATTGCTGGTGGAAATGTAACAAGA
AAGATGGGGAATGTTCGACAGGTTTTTGCGGTAAAGACGGAGTTTGTTGT
CGACGTGGTTGGGATACTTACAGATGTATCCGGACTACTGGTGCATGCAG
ATACAAACATTGCTGTGTCGGTACAGCGGCTATGGGAATCCAAAAACCTT
GAGCTCAAATTGCTGGTCGAAGTGTGGTAGAAAGGGTGGTTACTGTCCTG
GATTTTGTGGCGTGAACGGGCGTTGTTGTCGAAGAGGATGGAATGATGCT
GGGTGCGCAGGAATGGCCACACCGTGCAATGGGAAGCATTGTTGTACAAC
TAAAAGACGAGATGTCCAAAATAGCGGTCTTTGCAGTCGAAAAGGATGGG
GTCGATGGCAAGACGCTGCATTCCCCTGCGTTAATAGGCACTGTTGTACT
GAGCCAGCTCTTGTTAAGAACCTAGATTTAAGAAACCAAGGACAAAATTG
TTGGAAAAAACCTACCTATTTCTGTGGTAAAAAAGTTGATGGAAAATGGA
GTACATGGTCCGCTGTCGGAGCATGTAATCGAAAATGTGGTCCAGGGCGC
CGACGATTCACAAGAAAATGTAATAACCCAAAGCCTGCTTTTGGTGGAAA
ATCATGCGAAGGACCGAAAATCAAATTCGAGTCCTGCAACAATGGAGCGT
GTCCGGTTAATGGAAAATGGAGTACATGGTCATCTTTCGGAGCATGTAAT
CGAAGATGTGGTCCAGGGCGCCGACGAGCAACAAGAAATTGCAATAACCC
AAAGCCTGCTTTTGGCGGAAAATCATGCATAGGACCGAAAATCAAATTCG
AGTCCTGCAACAATGGAGCGTGTATTCCAGTTTGGCTTGTGACTGTGCAG
CAAAAGCAAAAGAAGGAGCACTAGTTCTAACCGACTACGAGGAATGTTTT
GAAACTAAGGCTGCGGATCACGGGAGTCGTTATCCTGGTCAAACTTCATA
CGAGAAATGTATCAACACAGTCTTTCATCATTGTGAAAAAGGTCAAAATT
GTATTGGTACCACTGATTCTGTTTATATTTATGCAAAAGTAGACTGTGGT
AATGGTTCCAAACTAAGCCGTATTGGATGTTTTACAAAGAATGATAATGC
CCCTACCAAGTTCATAATGAGAAAGCCAGTCTATGGTGATGGATCAATAA
AGAGGAAATCAAGTACATCATGATGTTGCAATTATTCATCGCAATTTATT
TGGCATCGGGATGTTTTGCAGACATTCTAGGTAAAAATTGCTGGTGGAAA
TGTAACAAGAAAGATGGGGAATGTTCGACAGGTTTTTGCGGTAAAGACGG
AGTTTGTTGTCGACGTGGTTGGGATACTTACAGATGTATCCGGACTACTG
GTGCATGCAGATACAAACATTGCTGTGTCGGTACAGCGGCTATGGGAATC
CAAAAACCTTGAGCTCAAATTGCTGGTCGAAGTGTGGTAGAAAGGGTGGT
TACTGTCCTGGATTTTGTGGCGTGAACGGGCGTTGTTGTCGAAGAGGATG
GAATGATGCTGGGTGCGCAGGAATGGCCACACCGTGCAATGGGAAGCATT
GTTGTACAACTAAAAGACGAGATGTCCAAAATAGCGGTCTTTGCAGTCGA
AAAGGATGGGGTCGATGGCAAGACGCTGCATTCCCCTGCGTTAATAGGCA
CTGTTGTACTGAGCCAGCTCTTGTTAAGAACCTAGATTTAAGAAACCAAG
GACAAAATTGTTGGAAAAAACCTACCTATTTCTGTGGTAAAAAAGTTGAT
GGAAAATGGAGTACATGGTCCGCTGTCGGAGCATGTAATCGAAAATGTGG
TCCAGGGCGCCGACGATTCACAAGAAAATGTAATAACCCAAAGCCTGCTT
TTGGTGGAAAATCATGCGAAGGACCGAAAATCAAATTCGAGTCCTGCAAC
AATGGAGCGTGTCCGGTTAATGGAAAATGGAGTACATGGTCATCTTTCGG
AGCATGTAATCGAAGATGTGGTCCAGGGCGCCGACGAGCAACAAGAAATT
GCAATAACCCAAAGCCTGCTTTTGGCGGAAAATCATGCATAGGACCGAAA
ATCAAATTCGAGTCCTGCAACAATGGAGCGTGTATTCCAGTTTGGCTTGT
GACTGTGCAGCAAAAGCAAAAGAAGGAGCACTAGTTCTAACCGACTACGA
GGAATGTTTTGAAACTAAGGCTGCGGATCACGGGAGTCGTTATCCTGGTC
AAACTTCATACGAGAAATGTATCAACACAGTCTTTCATCATTGTGAAAAA
GGTCAAAATTGTATTGGTACCACTGATTCTGTTTATATTTATGCAAAAGT
AGACTGTGGTAATGGTTCCAAACTAAGCCGTATTGGATGTTTTACAAAGA
ATGATAATGCCCCTACCAAGTTCATAATGAGAAAGCCAGTCTATGGTGAT
GGATCAATAAAGAGGAAATCAAGTACATCATGATGTTGCAATTATTCATC
GCAATTTATTTGGCATCGGGATGTTTTGCAGACATTCTAGGTAAAAATTG
CTGGTGGAAATGTAACAAGAAAGATGGGGAATGTTCGACAGGTTTTTGCG
GTAAAGACGGAGTTTGTTGTCGACGTGGTTGGGATACTTACAGATGTATC
CGGACTACTGGTGCATGCAGATACAAACATTGCTGTGTCGGTACAGCGGC
TATGGGAATCCAAAAACCTTGAGCTCAAATTGCTGGTCGAAGTGTGGTAG
AAAGGGTGGTTACTGTCCTGGATTTTGTGGCGTGAACGGGCGTTGTTGTC
GAAGAGGATGGAATGATGCTGGGTGCGCAGGAATGGCCACACCGTGCAAT
GGGAAGCATTGTTGTACAACTAAAAGACGAGATGTCCAAAATAGCGGTCT
TTGCAGTCGAAAAGGATGGGGTCGATGGCAAGACGCTGCATTCCCCTGCG
TTAATAGGCACTGTTGTACTGAGCCAGCTCTTGTTAAGAACCTAGATTTA
AGAAACCAAGGACAAAATTGTTGGAAAAAACCTACCTATTTCTGTGGTAA
AAAAGTTGATGGAAAATGGAGTACATGGTCCGCTGTCGGAGCATGTAATC
GAAAATGTGGTCCAGGGCGCCGACGATTCACAAGAAAATGTAATAACCCA
AAGCCTGCTTTTGGTGGAAAATCATGCGAAGGACCGAAAATCAAATTCGA
GTCCTGCAACAATGGAGCGTGTCCGGTTAATGGAAAATGGAGTACATGGT
CATCTTTCGGAGCATGTAATCGAAGATGTGGTCCAGGGCGCCGACGAGCA
ACAAGAAATTGCAATAACCCAAAGCCTGCTTTTGGCGGAAAATCATGCAT
AGGACCGAAAATCAAATTCGAGTCCTGCAACAATGGAGCGTGTATTCCAG
TTTGGCTTGTGACTGTGCAGCAAAAGCAAAAGAAGGAGCACTAGTTCTAA
CCGACTACGAGGAATGTTTTGAAACTAAGGCTGCGGATCACGGGAGTCGT
TATCCTGGTCAAACTTCATACGAGAAATGTATCAACACAGTCTTTCATCA
TTGTGAAAAAGGTCAAAATTGTATTGGTACCACTGATTCTGTTTATATTT
ATGCAAAAGTAGACTGTGGTAATGGTTCCAAACTAAGCCGTATTGGATGT
TTTACAAAGAATGATAATGCCCCTACCAAGTTCATAATGAGAAAGCCAGT
CTATGGTGATGGATCAATAAAGAGGAAATCAAGTACATCATGATGTTGCA
ATTATTCATCGCAATTTATTTGGCATCGGGATGTTTTGCAGACATTCTAG
GTAAAAATTGCTGGTGGAAATGTAACAAGAAAGATGGGGAATGTTCGACA
GGTTTTTGCGGTAAAGACGGAGTTTGTTGTCGACGTGGTTGGGATACTTA
CAGATGTATCCGGACTACTGGTGCATGCAGATACAAACATTGCTGTGTCG
GTACAGCGGCTATGGGAATCCAAAAACCTTGAGCTCAAATTGCTGGTCGA
AGTGTGGTAGAAAGGGTGGTTACTGTCCTGGATTTTGTGGCGTGAACGGG
CGTTGTTGTCGAAGAGGATGGAATGATGCTGGGTGCGCAGGAATGGCCAC
ACCGTGCAATGGGAAGCATTGTTGTACAACTAAAAGACGAGATGTCCAAA
ATAGCGGTCTTTGCAGTCGAAAAGGATGGGGTCGATGGCAAGACGCTGCA
TTCCCCTGCGTTAATAGGCACTGTTGTACTGAGCCAGCTCTTGTTAAGAA
CCTAGATTTAAGAAACCAAGGACAAAATTGTTGGAAAAAACCTACCTATT
TCTGTGGTAAAAAAGTTGATGGAAAATGGAGTACATGGTCCGCTGTCGGA
GCATGTAATCGAAAATGTGGTCCAGGGCGCCGACGATTCACAAGAAAATG
TAATAACCCAAAGCCTGCTTTTGGTGGAAAATCATGCGAAGGACCGAAAA
TCAAATTCGAGTCCTGCAACAATGGAGCGTGTCCGGTTAATGGAAAATGG
AGTACATGGTCATCTTTCGGAGCATGTAATCGAAGATGTGGTCCAGGGCG
CCGACGAGCAACAAGAAATTGCAATAACCCAAAGCCTGCTTTTGGCGGAA
AATCATGCATAGGACCGAAAATCAAATTCGAGTCCTGCAACAATGGAGCG
TGTATTCCAGTTTGGCTTGTGACTGTGCAGCAAAAGCAAAAGAAGGAGCA
CTAGTTCTAACCGACTACGAGGAATGTTTTGAAACTAAGGCTGCGGATCA
CGGGAGTCGTTATCCTGGTCAAACTTCATACGAGAAATGTATCAACACAG
TCTTTCATCATTGTGAAAAAGGTCAAAATTGTATTGGTACCACTGATTCT
GTTTATATTTATGCAAAAGTAGACTGTGGTAATGGTTCCAAACTAAGCCG
TATTGGATGTTTTACAAAGAATGATAATGCCCCTACCAAGTTCATAATGA
GAAAGCCAGTCTATGGTGATGGATCAATAAAGAGGAAATCAAGTACATCA
TGATGTTGCAATTATTCATCGCAATTTATTTGGCATCGGGATGTTTTGCA
GACATTCTAGGTAAAAATTGCTGGTGGAAATGTAACAAGAAAGATGGGGA
ATGTTCGACAGGTTTTTGCGGTAAAGACGGAGTTTGTTGTCGACGTGGTT
GGGATACTTACAGATGTATCCGGACTACTGGTGCATGCAGATACAAACAT
TGCTGTGTCGGTACAGCGGCTATGGGAATCCAAAAACCTTGAGCTCAAAT
TGCTGGTCGAAGTGTGGTAGAAAGGGTGGTTACTGTCCTGGATTTTGTGG
CGTGAACGGGCGTTGTTGTCGAAGAGGATGGAATGATGCTGGGTGCGCAG
GAATGGCCACACCGTGCAATGGGAAGCATTGTTGTACAACTAAAAGACGA
GATGTCCAAAATAGCGGTCTTTGCAGTCGAAAAGGATGGGGTCGATGGCA
AGACGCTGCATTCCCCTGCGTTAATAGGCACTGTTGTACTGAGCCAGCTC
TTGTTAAGAACCTAGATTTAAGAAACCAAGGACAAAATTGTTGGAAAAAA
CCTACCTATTTCTGTGGTAAAAAAGTTGATGGAAAATGGAGTACATGGTC
CGCTGTCGGAGCATGTAATCGAAAATGTGGTCCAGGGCGCCGACGATTCA
CAAGAAAATGTAATAACCCAAAGCCTGCTTTTGGTGGAAAATCATGCGAA
GGACCGAAAATCAAATTCGAGTCCTGCAACAATGGAGCGTGTCCGGTTAA
TGGAAAATGGAGTACATGGTCATCTTTCGGAGCATGTAATCGAAGATGTG
GTCCAGGGCGCCGACGAGCAACAAGAAATTGCAATAACCCAAAGCCTGCT
TTTGGCGGAAAATCATGCATAGGACCGAAAATCAAATTCGAGTCCTGCAA
CAATGGAGCGTGTATTCCAGTTTGGCTTGTGACTGTGCAGCAAAAGCAAA
AGAAGGAGCACTAGTTCTAACCGACTACGAGGAATGTTTTGAAACTAAGG
CTGCGGATCACGGGAGTCGTTATCCTGGTCAAACTTCATACGAGAAATGT
ATCAACACAGTCTTTCATCATTGTGAAAAAGGTCAAAATTGTATTGGTAC
CACTGATTCTGTTTATATTTATGCAAAAGTAGACTGTGGTAATGGTTCCA
AACTAAGCCGTATTGGATGTTTTACAAAGAATGATAATGCCCCTACCAAG
TTCATAATGAGAAAGCCAGTCTATGGTGATGGATCAATAAAGAGGAAATC
AAGTACATCATGATGTTGCAATTATTCATCGCAATTTATTTGGCATCGGG
ATGTTTTGCAGACATTCTAGGTAAAAATTGCTGGTGGAAATGTAACAAGA
AAGATGGGGAATGTTCGACAGGTTTTTGCGGTAAAGACGGAGTTTGTTGT
CGACGTGGTTGGGATACTTACAGATGTATCCGGACTACTGGTGCATGCAG
ATACAAACATTGCTGTGTCGGTACAGCGGCTATGGGAATCCAAAAACCTT
GAGCTCAAATTGCTGGTCGAAGTGTGGTAGAAAGGGTGGTTACTGTCCTG
GATTTTGTGGCGTGAACGGGCGTTGTTGTCGAAGAGGATGGAATGATGCT
GGGTGCGCAGGAATGGCCACACCGTGCAATGGGAAGCATTGTTGTACAAC
TAAAAGACGAGATGTCCAAAATAGCGGTCTTTGCAGTCGAAAAGGATGGG
GTCGATGGCAAGACGCTGCATTCCCCTGCGTTAATAGGCACTGTTGTACT
GAGCCAGCTCTTGTTAAGAACCTAGATTTAAGAAACCAAGGACAAAATTG
TTGGAAAAAACCTACCTATTTCTGTGGTAAAAAAGTTGATGGAAAATGGA
GTACATGGTCCGCTGTCGGAGCATGTAATCGAAAATGTGGTCCAGGGCGC
CGACGATTCACAAGAAAATGTAATAACCCAAAGCCTGCTTTTGGTGGAAA
ATCATGCGAAGGACCGAAAATCAAATTCGAGTCCTGCAACAATGGAGCGT
GTCCGGTTAATGGAAAATGGAGTACATGGTCATCTTTCGGAGCATGTAAT
CGAAGATGTGGTCCAGGGCGCCGACGAGCAACAAGAAATTGCAATAACCC
AAAGCCTGCTTTTGGCGGAAAATCATGCATAGGACCGAAAATCAAATTCG
AGTCCTGCAACAATGGAGCGTGTATTCCAGTTTGGCTTGTGACTGTGCAG
CAAAAGCAAAAGAAGGAGCACTAGTTCTAACCGACTACGAGGAATGTTTT
GAAACTAAGGCTGCGGATCACGGGAGTCGTTATCCTGGTCAAACTTCATA
CGAGAAATGTATCAACACAGTCTTTCATCATTGTGAAAAAGGTCAAAATT
GTATTGGTACCACTGATTCTGTTTATATTTATGCAAAAGTAGACTGTGGT
AATGGTTCCAAACTAAGCCGTATTGGATGTTTTACAAAGAATGATAATGC
CCCTACCAAGTTCATAATGAGAAAGCCAGTCTATGGTGATGGATCAATAA
AGAGGAAATCAAGTACATCATGATGTTGCAATTATTCATCGCAATTTATT
TGGCATCGGGATGTTTTGCAGACATTCTAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000989XLOC_000989Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001916-exon-sc0000012-1575043694:177001..177077TCONS_00001916-exon-sc0000012-1575043694:177001..177077Clytia hemisphaericaexon
TCONS_00001916-exon-sc0000012-1575043694:174650..174761TCONS_00001916-exon-sc0000012-1575043694:174650..174761Clytia hemisphaericaexon
TCONS_00001916-exon-sc0000012-1575043694:174231..174442TCONS_00001916-exon-sc0000012-1575043694:174231..174442Clytia hemisphaericaexon
TCONS_00001916-exon-sc0000012-1575043694:173331..173675TCONS_00001916-exon-sc0000012-1575043694:173331..173675Clytia hemisphaericaexon
TCONS_00001916-exon-sc0000012-1575043694:167904..167963TCONS_00001916-exon-sc0000012-1575043694:167904..167963Clytia hemisphaericaexon
TCONS_00001916-exon-sc0000012-1575043694:167107..167205TCONS_00001916-exon-sc0000012-1575043694:167107..167205Clytia hemisphaericaexon
TCONS_00001916-exon-sc0000012-1575043694:166643..166816TCONS_00001916-exon-sc0000012-1575043694:166643..166816Clytia hemisphaericaexon
TCONS_00001916-exon-sc0000012-1575043694:165313..165771TCONS_00001916-exon-sc0000012-1575043694:165313..165771Clytia hemisphaericaexon
TCONS_00001916-exon-sc0000012-1510915933:177001..177077TCONS_00001916-exon-sc0000012-1510915933:177001..177077Clytia hemisphaericaexon
TCONS_00001916-exon-sc0000012-1510915933:174650..174761TCONS_00001916-exon-sc0000012-1510915933:174650..174761Clytia hemisphaericaexon
TCONS_00001916-exon-sc0000012-1510915933:174231..174442TCONS_00001916-exon-sc0000012-1510915933:174231..174442Clytia hemisphaericaexon
TCONS_00001916-exon-sc0000012-1510915933:173331..173675TCONS_00001916-exon-sc0000012-1510915933:173331..173675Clytia hemisphaericaexon
TCONS_00001916-exon-sc0000012-1510915933:167904..167963TCONS_00001916-exon-sc0000012-1510915933:167904..167963Clytia hemisphaericaexon
TCONS_00001916-exon-sc0000012-1510915933:167107..167205TCONS_00001916-exon-sc0000012-1510915933:167107..167205Clytia hemisphaericaexon
TCONS_00001916-exon-sc0000012-1510915933:166643..166816TCONS_00001916-exon-sc0000012-1510915933:166643..166816Clytia hemisphaericaexon
TCONS_00001916-exon-sc0000012-1510915933:165313..165771TCONS_00001916-exon-sc0000012-1510915933:165313..165771Clytia hemisphaericaexon
TCONS_00001916-exon-sc0000012-1491911889:177001..177077TCONS_00001916-exon-sc0000012-1491911889:177001..177077Clytia hemisphaericaexon
TCONS_00001916-exon-sc0000012-1491911889:174650..174761TCONS_00001916-exon-sc0000012-1491911889:174650..174761Clytia hemisphaericaexon
TCONS_00001916-exon-sc0000012-1491911889:174231..174442TCONS_00001916-exon-sc0000012-1491911889:174231..174442Clytia hemisphaericaexon
TCONS_00001916-exon-sc0000012-1491911889:173331..173675TCONS_00001916-exon-sc0000012-1491911889:173331..173675Clytia hemisphaericaexon
TCONS_00001916-exon-sc0000012-1491911889:167904..167963TCONS_00001916-exon-sc0000012-1491911889:167904..167963Clytia hemisphaericaexon
TCONS_00001916-exon-sc0000012-1491911889:167107..167205TCONS_00001916-exon-sc0000012-1491911889:167107..167205Clytia hemisphaericaexon
TCONS_00001916-exon-sc0000012-1491911889:166643..166816TCONS_00001916-exon-sc0000012-1491911889:166643..166816Clytia hemisphaericaexon
TCONS_00001916-exon-sc0000012-1491911889:165313..165771TCONS_00001916-exon-sc0000012-1491911889:165313..165771Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001916-proteinTCONS_00001916-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000012supercontigsc0000012:165313..177077 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.686095 0 0.560839 0.671436 0.108262 0.116062 0.0748214 2.87489 37.7627 5.399 128.485 55.4211 5.32574 2.76799 5.67194 17.7577 0.687302 0.724187 0.420538 0 0 0.255024 0.298062 0.249599 0.222346 0.177757 0 0.0803016 0.162753 0.116506
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000884TSP1_rpt
Blast
BLAST of TCONS_00001916 vs. Swiss-Prot (Human)
Match: HMCN1 (Hemicentin-1 OS=Homo sapiens GN=HMCN1 PE=1 SV=2)

HSP 1 Score: 114.775 bits (286), Expect = 1.254e-26
Identity = 56/143 (39.16%), Postives = 84/143 (58.74%), Query Frame = 2
Query:  401 VDGKWSTWSAVGACNRKCGPGRRRFTRKCNNPKPAFGGKSCEGPKIKFESCNNGACPVNGKWSTWSSFGXXXXXXXXXXXXXXXXCNNPKPAFGGKSCIGPKIKFESCNNGACIPDLRNQGQNCWKKPTYFCG-----KKGLC 814
            + GKW+TW++  AC+  CG G R+ TR C++P P +GG+ CEG  ++ + CN+  CP +G WS WS +G C+R C  G+ R  R C+NP P+ GG++C GP  + + CN   C  D      + W + +  CG     +K LC
Sbjct: 4699 IHGKWATWASWSACSVSCGGGARQRTRGCSDPVPQYGGRKCEGSDVQSDFCNSDPCPTHGNWSPWSGWGTCSRTCNGGQMRRYRTCDNPPPSNGGRACGGPDSQIQRCNTDMCPVDGSWGSWHSWSQCSASCGGGEKTRKRLC 4841          

HSP 2 Score: 111.694 bits (278), Expect = 1.504e-25
Identity = 64/168 (38.10%), Postives = 91/168 (54.17%), Query Frame = 2
Query:  245 YEECFETKAADHGSRYPGQTSYEKCINTVFHHCEKGQNCIGTTDSVY---IYAKVVDGKWSTWSAVGACNRKCGPGRRRFTRKCNNPKPAFGGKSCEGPKIKFESCNNGACPVNGKWSTWSSFGXXXXXXXXXXXXXXXXCNNPKPAFGGKSCIGPKIKFESCNNGAC 739
            +EEC  T++   G+    QT    C N    H   G+ C G    +    I    V G WS W   G C+  CG G +   R CNNP PAFGG  C+G + + + CN   CP++GKW+TW+S+ AC+  CG G R+ TR C++P P +GG+ C G  ++ + CN+  C
Sbjct: 4595 WEEC--TRSCGRGN----QTRTRTCNNPSVQH--GGRPCEGNAVEIIMCNIRPCPVHGAWSAWQPWGTCSESCGKGTQTRARLCNNPPPAFGGSYCDGAETQMQVCNERNCPIHGKWATWASWSACSVSCGGGARQRTRGCSDPVPQYGGRKCEGSDVQSDFCNSDPC 4754          

HSP 3 Score: 107.457 bits (267), Expect = 3.344e-24
Identity = 55/133 (41.35%), Postives = 68/133 (51.13%), Query Frame = 2
Query:  401 VDGKWSTWSAVGACNRKCGPGRRRFTRKCNNPKPAFGGKSCEGPKIKFESCNNGACPVNGKWSTWSSFGXXXXXXXXXXXXXXXXCNNPKPAFGGKSCIGPKIKFESCNNGACIPDLRNQGQNCWKKPTYFCG 799
            VDG WS WS    C R CG G +  TR CNNP    GG+ CEG  ++   CN   CPV+G WS W  +G C+  CG G +   R CNNP PAFGG  C G + + + CN   C    +      W   +  CG
Sbjct: 4585 VDGSWSEWSLWEECTRSCGRGNQTRTRTCNNPSVQHGGRPCEGNAVEIIMCNIRPCPVHGAWSAWQPWGTCSESCGKGTQTRARLCNNPPPAFGGSYCDGAETQMQVCNERNCPIHGKWATWASWSACSVSCG 4717          

HSP 4 Score: 100.523 bits (249), Expect = 6.236e-22
Identity = 46/111 (41.44%), Postives = 63/111 (56.76%), Query Frame = 2
Query:  407 GKWSTWSAVGACNRKCGPGRRRFTRKCNNPKPAFGGKSCEGPKIKFESCNNGACPVNGKWSTWSSFGXXXXXXXXXXXXXXXXCNNPKPAFGGKSCIGPKIKFESCNNGAC 739
            G WS WS  G C+R C  G+ R  R C+NP P+ GG++C GP  + + CN   CPV+G W +W S+  C+  CG G +   R C++P P  GG+ C G   +   CN  AC
Sbjct: 4758 GNWSPWSGWGTCSRTCNGGQMRRYRTCDNPPPSNGGRACGGPDSQIQRCNTDMCPVDGSWGSWHSWSQCSASCGGGEKTRKRLCDHPVPVKGGRPCPGDTTQVTRCNVQAC 4868          

HSP 5 Score: 93.9745 bits (232), Expect = 7.116e-20
Identity = 54/134 (40.30%), Postives = 70/134 (52.24%), Query Frame = 2
Query:  401 VDGKWSTWSAVGACNRKCGPGRRRFTRKCNNPKPAFGGKSCEGPKIKFESCNNGACPVNGKWSTWSSFGXXXXXXXXXXXXXXXXCNNPKPAFGGKSCIGPKIKFESCNNGACIPDLRNQGQNCWKKPTYFCGK 802
            V G +S WSA  AC+  CG G ++ +R CN P PA GGK C+G  ++  +C N  CPV+G WS WS +  C R CG G +  TR CNNP    GG+ C G  ++   CN   C           W   +  CGK
Sbjct: 4528 VHGGFSQWSAWRACSVTCGKGIQKRSRLCNQPLPANGGKPCQGSDLEMRNCQNKPCPVDGSWSEWSLWEECTRSCGRGNQTRTRTCNNPSVQHGGRPCEGNAVEIIMCNIRPCPVHGAWSAWQPWGTCSESCGK 4661          
The following BLAST results are available for this feature:
BLAST of TCONS_00001916 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
HMCN11.254e-2639.16Hemicentin-1 OS=Homo sapiens GN=HMCN1 PE=1 SV=2[more]
back to top