Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001915 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001915
Unique NameTCONS_00001915
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1253

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001915 ID=TCONS_00001915|Name=TCONS_00001915|organism=Clytia hemisphaerica|type=transcript|length=1253bp
CCGGCTGAGCCCGACGGTTTCATGAGATtctaaatttagaaaataagcaa
ttttaaaagaaaacacaaTGAAGGGaagaattattattttttccattCTT
GGATGTCCATTCTGTATCAAATGTAAAGGTTATTTAGATCAACTTGGCTT
AAATTATATTGATGTCAATTTGGATAAGAACAGTTTGGCACGACAGAAAG
TCATTGAGATGACTGGCCAGAAGACGGTGCCTCAGGTTTTCTTCAATGAA
AGACATGTTGGTGGTTGGGACAATTTAAGCAAACTGAGCAAAGAGGAACT
GAACGACTTGATCAACCTAGTGGAACAGAATGAGCCACCAAAAGAAGCAC
CGAATCCTTCTGATTGGATGGAGGCTGATGACGAAACAGAAGTTGGTAAA
GACATGCTTGAGTTCCATTGTGAATTGGATGAATATGCAGAGTTGACAAA
GGAATTACGAGATAGCGGTATTGTTGGAGATCATTGGAAAAACTTgaaga
attacaaaaattcgTTCGTTGGAAAGGAAGCTGTTGATTGGCTTGTCAAA
TACAAGAATCTAGAAAGAAAAGCAGCAGTAGAGATGTGCCAACAACTGGT
GGAACGCCATTTCGGACATAACGTGAAACGTGGTGAATCAGAAGAATTTA
AAGATGATGATTCAGTATACCAATTCATAGAAGATGTACAGGCCAACGCC
TTGAATGCTGGTATCAAAACACAATGTGAACCAAGGCCTGCCAGCGAGCT
TGGTGAAGAGTTAAGACAACTGATCCTTGCCATCTATAATAATCATCTCT
CACCAGACGGAAAGAAAGTGGATTACAGATCAATCGCAAAAGACGAGAAA
TTTAAACTATACGCAACAAAGACAGCAGAATTACAAAGAGTCAACGTGGA
AGAAGCTACTCGTGAAGAGAAATTGGCTTTCTTCATCAACATCTATAACG
CACTGGTCATTCATGCTTTTGTTGTGGTCGGCCCACCTGCCAACTTGTGG
CAACGCTATAAGtttttcaacACTGTATCGTACATCATCGGTGGATACAC
TTATTCTTTAAACGAAATTGAAAATGGAGTGTTGAGGTCCAACCGGAAAC
CACTTGGCTCATTCAAGAAACCATTCAGCAAGACCGACCCTCGTCTCAAG
ATTGCACTGGAAACTTGTGAACCCAAGGTGCATTTTGCGTTGGTGTGTGG
TGCCAAAAGTTGTCCACCCATCAAAACTTATTCTGCTAAGGTACGTGAGa
aat
Run BLAST on NCBI

protein sequence of TCONS_00001915-protein

>TCONS_00001915-protein ID=TCONS_00001915-protein|Name=TCONS_00001915-protein|organism=Clytia hemisphaerica|type=polypeptide|length=395bp
MKGRIIIFSILGCPFCIKCKGYLDQLGLNYIDVNLDKNSLARQKVIEMTG
QKTVPQVFFNERHVGGWDNLSKLSKEELNDLINLVEQNEPPKEAPNPSDW
MEADDETEVGKDMLEFHCELDEYAELTKELRDSGIVGDHWKNLKNYKNSF
VGKEAVDWLVKYKNLERKAAVEMCQQLVERHFGHNVKRGESEEFKDDDSV
YQFIEDVQANALNAGIKTQCEPRPASELGEELRQLILAIYNNHLSPDGKK
VDYRSIAKDEKFKLYATKTAELQRVNVEEATREEKLAFFINIYNALVIHA
FVVVGPPANLWQRYKFFNTVSYIIGGYTYSLNEIENGVLRSNRKPLGSFK
KPFSKTDPRLKIALETCEPKVHFALVCGAKSCPPIKTYSAKVREK
Run BLAST on NCBI

transcript from alignment at sc0000012:125467..141627-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001915 ID=TCONS_00001915|Name=TCONS_00001915|organism=Clytia hemisphaerica|type=transcript|length=16161bp|location=Sequence derived from alignment at sc0000012:125467..141627- (Clytia hemisphaerica)
CCGGCTGAGCCCGACGGTTTCATGAGGTAAGGTTTGGAATAATTTTTTCC CTTTTACAGTCAGGAGTTTTTACCTAATTAGGAAAGTATTTTACGAAAGG CTTTCCTCCCTAAGAATGGAAAACTTTGCAAATGAGAATTCACCCCCCTG TAAAGTATGTGAATTGTTTTTTTGTTCAATAGAAGACTTTTGAGGAAGTG CCAAATATTTTGTTATCATCAAATCACCCTAGGTAGGGTGGACAGGCCAA AATTTTCCCCTCAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCAATTTCTTCTTATTTTT CGAAATTCCAGACGGCCTGTAGATTTTCAAATAAAGCACGTTGTGATAGA TTGTAGCCTAATCTTACCCTGGGTTTACTAAAAAAACCGCGATTGAAAAG ATGCACCAGCTCAATAGCGACTGCTATTTGTTTCAATGTGGGTCGAGAAT TTTCCGGTGNNCACATTTGGATGATTTAAAGGTAAGTACTAATGCCTTGA AGTTCATTTTTGTAAATTCTTCCTCGTTCCGCGCAAAAAATCCCGACGAG TGCGCACCCTACCCTAGGCGGCAATCAAAAGTATGTTGTGCGTTCGGGTC GTCCGACCGACTGTTTATTTACAAGAAAGAAAGTCGGTAAAATCTTCGGG TTTTTTTGGGCGCTGTTCGGAGCATGTCTTTGAATGATTATTTTTTGTTT ACTTAACCCACATTGAGTCCCGTTACGACCCTGTGCCTATGCCCCGGACA GTCCGGGGCAAATGTCTGGGGTCTGAAAAAAATAACTTTTTCCCCGAACC TACGTCCGGGGCTCCAATTTTTGCGCCATAAATTTACCCAGGAAGAATAT TTCAATGAATTAGAAAAAAGCCCTCGCGGTCAGCGCTTCTTCTATAAAAA GCGACCGCTCGGGCACGTGCGTTTGGTTTGGGAACGCGAAACACGAACGC AAACTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNAACCTTGAGCACAAAAAATGCTTTTTTAAACACTTTTTTC CACCGAAAAACAAATAACTTTTACAGACTTACCTTCCCCAAACATTGAAG AAGCCTCTAATAATTAAAGTAAATGAGATAAAATAAGATAAAACCTTAAA ATCAACCAGAATTTACAACCTTTCCTCCAAAGCAAAAGACGTGCTTTTCT CGCCGCCATCTTGAAATTAAAATGAGAATTCTAGAGAATTCCATTCGTTT CCAGCTCCCGCGGTCTTTTTTCATCCAATCAGATCGCGCGATTTCACTTT CGCTTTCTCTAGTCCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACC CGCGCGAAATACAGGGGGTCACAAATAGAAATACAGGGGGTCACACTACT GGCTACAGGAACTGAAAGCAAGCAATTAAGGCCAATATGTTTGGTTTTTC TGAAGGACAAAAGGTATAGGAAGCTTTACTGAAAGAGGGATAAGGCTGGG ACAATCTATTTAAAAGATATGGACGTAAAAAAGGCACTTTTTTGGGTGAT AATTAAGATTTTACTTAGAAACTTCAATTCTCTTACCCCCGTCTCGGCCC CCCCTGATATGAGCAAGGGAACCATGATGGCCACCCCTACTGAAAATTTC AGATCAAAACAAACAAGGAATTAATTCCTGTAACTCGAAGAAAATTGGAA AAAACTGGTTTTTGACTGTTTCCGATCCTAAAGTGCTATTTTTTGGTAAA AGCTATACAATTTATGTTTGGATTTCTAGAACGCTTACCCATTCATTGTT AATACATTTTTTATTTGAAAGTAATCTCTTCATGGAATAAAAAGATATAG TCAAATCTTGTAGGGTCATTTTTCAAAATTTTTTTNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNTCAAATACAGGCCTCACACACGAAAC GCCAAAATCAGGACATTACAAGATCTTTTGGAAGACGGCGTTTGTCCACG GAAGAATATTTCAATGAATTAGAAAAAAGCCAGCGCGGTCAGCGATTCTA TAAAAAGCAACCGCGCGGGGCTGTCTGGGGCGTCCGGGGTAGTCTCTCAA AAACAAATAATACGGACCCCGGGCACGCATCAAAAAAACCCCGGACTGTC CAGGGCATAGGCAGGGTCGTGTCCCGTTCAAGTTTTTTTATGTACCCTTA TTGAAATTTTCATGTCAAAAATCAGCAACGTGGTAGGGCCAATACCCTGG GGGCCAAAAATAAGGGCCGCTTTAAGGTTAACACATGCGCGCGCACATTT AGTTTGGCAAATTAAAGATGGCCGCATAAGATTCTGTTGATCTTAAAAAC CCGACAAAATTTACTACCGACCGACCGACTGACTGGATTTGAAGATGTTT TAGGACCCGAATGGGACATATTTTTGATTACCGCCCTACTACAATTGTTT TATTTTGTCCAATCAAAAAAGTTTTGTGTACAATTGTTTAAAGATAACAT CAAATCAAATGAAAGTTAAGTGATTTCATCCAATCAGAAAGAATTCTTTG ACAATCTAACTGTGGCATCAAATTTCCGCTTTGGTCTGAGAACTAAAGAT AAGAAAAAATTCAACTCTTTGATAGGGAGGTCAGGGCAAAACTCATCTAA TCACTTTGAAAATAGGTCCATCTGAAAAAGGGTAAAAAATGCAAGAAAAT GAGGGGTCATAGACCTCTCAGAAAAAAGCGGTTCCGAAGTTATGCCATTT TTTGTGGCTTAAAAAACAGCTCTTTCGGTAACAAATGGCCTAGGTTAAAT GGGTAAGAGAGGTAAAAAAAAGATTGAAGAAAAAAAAAACGGACGTAATA TATGCTAGTTACTTGTTTGATTGACCTTCATTTTAATAGAAAGAGAATTA AAATAAGAAATTTCAAGAATTGGAAAATTTGACACCCAGAGGGATCGAAC TCGGAAACCCATGCTTGTGAGACAAACGCTCTAACCATTTGAGCTAACCA CGCTTGGGAGATTTTGAGGGAAAGCTTGAAGTTATAAGAAAGAAAAAGGA AAGAAAGAAACAAGAAGAAAATTAGTTCCCGCTTTGATGTTATTATNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNGAAACGAGAAGAAAATTAGTTCCCGCT TTGATGTTATTATCGAAACAAAAGGATCATTCACGCCGACATTCCTTTTC ACACGTCAGCAATCTAGTTTTTTTAAATATAAAAACTAGATTGTAAGGTT GATTCTAAAAAAGAATAGTCGTTTCTTTAGACCAATACGTTTTTGGTAAC TTTCACATCATATGCAGCCATCTCATTGGTTAAATTTAGAAAAAGCACAA GCAAAAGCACTGAGTAGAAGATTTATTTCAATATAAACATCACATGAGGG TTATTTTTGTCAATTTGTTTATGTTTCAACTAATGTTGGAATGGGAAAGA GAAAGGTAAGTTTAGCCTAGCCTAATTGTCAGCTGTCAGGGGGCATAGAC CTTTTCGCCTTTCCATCCGCCATCTTGAATTGTATGCAAAAATACAGGAA CGAAAATGCCATGGTTGGATTTAGTTGGAAAGTATGCAAAACATATGCAA GTTTACACAAAGATTAAAAAGACAACAAAGCATCTTGTAAATAAATATTA TAATCATTAGAACAATAAAAGATGGAATTTTTTAATCCAAAAAGAAATAT TTACAGAATAACAAAAGCTTTTTAGAAATTTGTTCTTAAAGACATAGCAT ATTTTGTTTCCATGCCATTAAAACACTCCACAAAGACGGAGTACACACAT CAAACTTTCAAAACACGCAAACTGAAAGCAGTAATTATGACGTCACACAT CATCAATGTTTTGACTTGATCATTTGGCGGCTCTATTCCCAGAAGAATAA TTTACCGTCAGCCGAATAAGGATTATTTTTTACCTTCGCGGGTGATTTTT CAGTTTGAGTTTATGTCTAATGTTATGGTCTTTTGAAGTGCTTGTTCTAA GAGATGAGTGAATATAATTGTTTTTAGTTTTCAAGAGAAGCAAATTCTAT CTTTCTTTTACAAGATTACACTTTAATATAATGCCAATTATGCATGTAAG TTTTATATTAATACTTTCTTTTTGCATATGTTTTGCATACTTTCTAAGGG CATTTCACCACGGCAATTCGTCCACCATAATTCTTGCATACAATTCAATA TGGCGGATAGAAAGGCGAAAAGGTCTATTGCTTGAACATGCCACAGCAAT CACATGAAAAAATTATTGATTCCCTAGCCTAGGGATGGTTCATTTTCAGA TGTGGTTTTTTATTCGATCACATTAGCCTAGAATTTTAAGTTCGGGAAAG TAAGGAAACTAGGGAAACCTATTTTCCCATGCTGGAAGTATATTACCAAT GTGTTAGTGAAAACGGATTTCCACATGTGGAAAACTAATATTTTTAACTT TCTAGTTGCCCATTCAGAATTGCATCGGGAAATTAAAAATCCCAAGTTTT TCTAAACTGAAAATGGATGAGTCGGGAAAAGAGAAATCACGAGTTTTTAA AATGATTACTTTCTACAAGAAGCTAGGGTAAGGGAATATCACGAATTGTG ACCTTGCTTGCTTTATTCTATTCTTTCTCTGGATCGAGAAATGTGATTTC TCGAATTAGGGAAATAAACTTTCCCAGATTGGGAAATTCAATTTCCCGAA CTCTTTAATTTGAGTGTATCTTTTAAACAATTAATTAAATTAGAACAAAC CAAAATAAGACAATTCAATCGAAAATTTTAAACTGTCACAAATTAGAGCC TAAGTTCGGGAAAATTATTTTCAGGTTTGGGAAAATTGATTTCCCTAACT TGTATTACGCATGCGTGAGAAAAAACCACAAGTGATTTTTCACTCAAAAG TGTTCGAGTCGTATGTAAAGCAAACCATTACAAGGTTGTATTCGATCAGT GTGTAACACAACGCTAAAGGTGAGGTGTCCCGCCAGGGCGGCCTCATTCG TTCGCAATGGACTTGCGTCGCAAGGGCTCAGTGGATCGGTGAGACGGGTT TGAGGTCATTANNGTGACAAAAGTGCCGGGATTCTCAAAGTAGCGCAAGT ACATGTCAGAACGAATGAGAGCTATCGAACCAATGCTCACAGAATGATCG AATACATTTAATTATTTTATCAGCTTTCTATAAATCAAATTCGTGAATAT GGGTAACCCTATGGGGTTTTATTGGGGTTCGCTCGAGAAAAGCACTTTTC AATAATAGGGAAATTTAACATCCATAGGTAGTCATAAGATCGGGAAATTT CATTTCCATAACTAGGGAGCTGTTGCATCTTCCCTAGCTAGGGATTGGTT AGGGAAAATCCAGATTTCCAGATCTGGAAATATATATTTCCATAGCCTAG GGAATCAAAAAGTTTTTCCTGTGAATGTTATTGAATGGGGGTCAAGGGTA AATAAAAACTCCAATTGACATTTTCTTTGGGAAGTTTGAGTCTAGATGAC TCCCCTTAGTGCCTAATTATCTTCAAATTCGGGTCTGTTATCTGTNAAGT TTGCATATTTAACCATTGTTTGTAAACTGTTAGTATATACACAGTGTTAA GCAACGGGTCTGTTATCTGTCTAAATATCAAGCAAGATAAGAAATGATCA TTTCCCCTAAAAATGACAAAGGGGAATTTCCTCAAATACAAAATTCCATT TTTAATGTCCAAAAAAAGTATTCCAGCAAAACCAGCTTTAGTAAAAAATC ATAAAAAAATACTGAATCAATTTTGCACAATTTCTTCAAAAATTGGGCTC TGTCACATTTTGAGTATCACCATTATGGACTATCATGCAAAAAATCAGGA AAGAATTAATGAGCCGATCATGAGAAAAGCTGGTAACAGAAGCACAGACA AACAAAGGCTATTTTGAAGGTCCTCCAGGGGAATCAAAAATTTCAATTTA ACAATATGCAGAGCCGAGCTGAACAACCAACTAAAATGTTGTGATTGAAT TATCAAGAAGGCTGTGATTTTTTAACTGGCAGTGTGTTGAGCTAGGTGGA TGTTTACTCAACTGAAGAATTTGTTTTTCCAATTAGTTCTTGGTTCAATT GTTGCCCAAAATTTAGGAAATTTCATTAAAAAGTGCACGGTTTTGTTGCA CATGACTTATTTTGGGACTATTCAGGTAGGGTGTTTCTATTCTTATATTA TGTGGTCAACAGTTTTGAAAACCTTTTCTTTTTTTTAGTATTTAGTCACC CTAGTAGTCACAAAAATGTTGTGTTGAAAAAATTGTTGAGTTACAATGTT ACAATTATTCAATGATATCTTTTTGGCCTTTTAGATTCTAAATTTAGAAA ATAAGCAATTTTAAAAGAAAACACAATGAAGGGAAGAATTATTATTTTTT CCATTCTTGGATGTCCATTCTGTATCAAATGTAAAGGTTATTTAGATCAA CTTGGCTTAAATTATATTGATGTCAATTTGGATAAGAACAGTTTGGCACG ACAGAAAGTCATTGAGATGACTGGCCAGAAGACGGTGCCTCAGGTTTTCT TCAATGAAAGACATGTTGGTGGTTGGGACAATTTAAGCAAACTGGTAAGG TTAATTATAATTAGCCTTGAAATTGTTACATTTGAATAAATTTAAGGATT GCATTTTGTCAATAAACTGCCCTTTTGCCATTCACAATTACCATTTTGAC TTTTAAACATTACATAATCCTAGCCAAGATTAAAGTTAATCAGATTATCC TGAGACTATGATTATGTTATGTTTTTGGGTCGATACTTTGTTGCTAATTT TTGGAGTTTTAAGTGTATCGTGAATGGCAAAGGGTCTAATTCTACATGAC AATTGATATTTAACAAATCTCGAATCTCTTAGTAGCTAATGGTCAATGCT TTACGTGGGTAGTAATAGTAAACTCACAAAAAGTTTAACTTTTTATGAAT TTGATTTGAAGCCATAGAAGTTATTTCAAAAACTACTGAAAAAGTTTAGA AACAAGTTTTTTGCAACTTTTGCTTAAATCCCATAAAAACAAGGCTGTTA GATTCTTTAACTCAGATAAGTGCTCTGTATTTTTAGAGCAAAGAGGAACT GAACGACTTGATCAACCTAGTGGAACAGAATGAGCCACCAAAAGAAGCAC CGAATCCTTCTGATTGGATGGAGGCTGATGACGAAACAGAAGTTGGTAAA GGTATGAAAACTATTCGATAAAACCTGGAGTTTTTAACCAATCAATAAAC ACTTTCCAACAATAGAATTTATTGATACAAACCAACCTATCGGTTAAGAA CAGTGGCGTGGGAAGCATTTTGATATTAGTGACACTGCGAGGGGGAATTT TTAGATTTGGTACCTCTAGAATGCCAAAGAATGCTCTCAAAAAGTAACAA TTCATGACTAAAGAACAAAGAAAAGCTTATCCTTTGAAAATTTATTTGGG GTCAGTTCCCCCTTGCTACCCCGCTAGCTACAGTATTGAACAATTTGCAA TTATCGATAAAATCTATCAAGAAAACGAAGATAATCCTTTTCCCATGGAA GGTCACAAAGTTGGTCTAATATTAGGAGAAATTCAGCTAATATACTTAAG TGACCTGATGGCTGAAGTTACTGGACTTGCTTGTAAAAATAATTTGTGTA TCGTTTCTTATTTCAGACATGCTTGAGTTCCATTGTGAATTGGATGAATA TGCAGAGTTGACAAAGGAATTACGAGATAGCGGTATTGTTGGAGATCATT GGAAAAACTTGAAGAATTACAAAAATTCGTTCGTTGGAAAGGAAGCTGTT GATTGGCTTGTCAAATACAAGAATCTAGGTTGGTTGGTATTTTATTACTG TAAAATATAGTTTTGACGTTGTTGGTACCGGATGTTTCAAAAAAAAAGTG TACAAGTTTGAATTAAGATTGTGAGAAAACTGAAAATAGTACATACCTAA ACTTTTCACCATCAGAAGAAGAAAGGCTAACTTAAATTTTAAGCTATCAT ACTTTCAATTCAAGTTAGTCATTCCTCCTTCGAATGCCAAAAAGATTGGA TTTATAACATTTTTAGTTTTCTCACAAACTAAGTTCAAACTTGTACACTT TTTTCTGAAACACTCGGTATATTCTTTGCTCTTATTTTGTAAGTTGATGC ATAGTTCGTTCCCCCCTTTCTTAAGGGGGGGGGGGGNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGGG GGGGGGGGGGGGGTGACACCTTCTGAAAAATTAAAGAAGGGGCGATCAGA AATTTTCATGAAAAAGGGGGGATAGCAAGGAAGGATAGCAAGGAAGGATA GCAAGGAAGGGGGATGTTTAAGAAGGGGGATGTTTAAGAAGGGGGCGTTT AAGAAGGGGCGTTTAAGAAGGGGGCTTACAAAGTACTGCGCTTACATATG TATTGTAGATTATTTTCAGGTACTAAATTTCAAGGAAGTTTACTGTTAGA GTACTCTGAGTCAAAAAATAAGAAAGAAGTTTATTATTTCGCTTTCTCTC TCTAAAGATATTTCACCATATATTTGTTAGCTATTTTTGTCCAAAATCCT TGGGGGATAGGCATTTTTAAAGGTTGGGGAATGCCAAGAAGAGGGGATCA TTTAAGAAGGGGGGGTCATTTAAGTAGGGATATCATTTAAGAAGGGGGGA TCAGACCCTTTTCCGCACTATGTGATGAAATTAACTTTCTAGTTCTTTCT CCTGCGACTCAAATCTTAATGTTAAAATTCAAATCAAGCTATTTCAAAAG AATTTTAAACCCATAAAAGATAATTATCGTACCAGGATAATGTACATTTT AACCGGACAAATAGCCTTATTTCACAAAAAATCTGAAATTTCTATTTTTG AATGTTATTGCAAAGAATTCAATGCATGATGTGAATCGTGAATCAATATA CAGAATTGTATTTCTGTTTTATAGAAAGAAAAGCAGCAGTAGAGATGTGC CAACAACTGGTGGAACGCCATTTCGGACATAACGTGAAACGTGGTGAATC AGAAGAATTTAAAGATGATGATTCAGTATACCAATTCATAGAAGATGTAC AGGCCAACGCCTTGAATGCTGGTATCAAAACACAATGTGAACCAAGGCCT GGTATGTTGGTTGTATTTCATATAATCAAAAAAATATTTCAAAACCAAAA ATTTAAATTTAAATTTTTGGTTTTGAAATATATTTTTGATTAAAGAAGCT CTACTCCTGGTTGGTTTTATCGAGCACTCTTTGAATATGATTTCACCTCA TTTGATTCAATTCTCCTGTATCAACAAAAGTTAAAGTTCTTCTGTTCCTG GTGGCTTTGTACAAAGGATAGGAAGAGATTTTTCTGTCTTAAGATTTATC GAAATTTGAAGATTCTTTGTTACTACATTGTATAAATTAAAAATTCCATC TGCAGCGAAAAACTTTGGTTAGACCATATCGTTATCTTTGTACTCATTGC ACTTCAGTATATCATGGGTCTTGAGCGCTATCTAGTTACAAGCTTAAAGT AACAAAGCCTAGAACGTGGTCCTTTTCTTTCCTCTTTGTAGGCAAGAAGA GAAAAGGCTTTGGGTATTTTGTGCTTGTATTGAAAGTCATTTTACAAATA ATATGGGACATGGTGTTTGGGACTTGGAGGTTTTTGTTAAGACATCGATT CTTTTTGTATGTGAATTTGAACACCCAGGAAGACAGTAGGATTAATGAAG GCGATAGTCACGAGAAACTCTCTCCCCACCAAGGTACATACATGACTAAT TTCGACTAATAATTGGGATGAGAATTGTGTACAATATACAATTTAGAGTC TGGGCCCGAGTTTACTAGTAGTAAAGCAACTTTAAAATGCTTGTGACGAG AAGTGGTTGTTTCTGAGGTCGTTCGCCTTTACCTTCTAAATTTCAAACCG GTTTTCTTTTATGCAGCTTTGTATTGGGGGTGATTTTATGGTGTTAAAAT TCTATTCGACAAATTGAATTTAATACGAAGGTCAATTAACTGAAATTTGA AGTAAACTTTTGATCCTTTAATTGATTTTTTTAAGAATTACTGTTAAAGA TGATAAATAAAAACTTGATTTCAATTTTCAATTTTTTTTTCTTTGTTTCC CCTTTTCAGCCAGCGAGCTTGGTGAAGAGTTAAGACAACTGATCCTTGCC ATCTATAATAATCATCTCTCACCAGACGGAAAGGTTAGTCAACGTCACAT TATTTTTTGTTGAACCTATGTACGTGTTTTTAATAAGAGCATTCAAAACT TTTGGAGCCTTCGGATGTTCTTAACTTTTTGAGTTTTAAGGCTGAACATG TTTTTGTGCAATTTCCTAAGAAATTGGTTGTTTTAGATTTCATAAAGCTT TAAAATGCTCATAAGTTGCATAATATTCTCATATTTTGTTATTACATAAA TACTAACCAATGATGTCGTATATAGTTCCTAGTGTTCGATGCCTGACCAT TGTAGTAGATTGCACAGCAAACGAATCCAAAAGAATTAGAGTAGTCCTCG AGTAGTCTAGCATTCTAGATGACTAGACGATATTATCAGTAGAAAATAAG CAAAAAATAATGAGAGGGACAAAATTGTATTATATTATACAAACTGATAT TATCGCGTATTACACGTTTTTATAAGAACATAAGGCTTCGATGGCCGAAA TGTTAAGAACAAGTTAAGGATATCTTAAGGCTTTTCGGACTAAAAAACAG CCAATTTCTTAGGAAAAATGGACAAAAATACATAAAATGGGGAAAATAAG AACATGTTAAGAACATTTTTAGGCCTGAAACTCAAAAAGTTTAGTATCAT CATATAATACCCATATCATTGAATTAGACGGGATAGATTTATACTGAGAT ACGTATTACCAAATTTCTCTTTTCATCAGAAAGTGGATTACAGATCAATC GCAAAAGACGAGAAATTTAAACTATACGCAACAAAGACAGCAGAATTACA AAGAGTCAACGTGGAAGAAGCTACTCGTGAAGAGAAATTGGCTTTCTTCA TCAACATCTATAACGCACTGGTCATTCATGCTTTTGTTGTGGTCGGCCCA CCTGCCAACTTGTGGCAACGCTATAAGGTACATTGTAGAAATTCAGTACT GTAAATTTAGTACGCCGTCACCCGGCGTTGTATCCGCCGAAATGGGATAA GCTGAACGCATCTAAGCCCTTTGGACAGCAGAGAGGGTAATAAGATCTGA TTTAAGCCCAAGGAATAAAATTTTTTAACGTTTTGTGACGTCGTGGGGTC CTAAATGACGTCATGAAAAGGGTAACTTTTCACTTCACTGAAATTATCAC TTCATTGACCCAACGATTTCCGACCAAATAAGGGTCAATTCTTGATTAAA TTGTTCTCAAATTGGAGATATTGCATTTTTCAGGTTTTCACGACGTCAGT AAACAACAAAACTTGCTCTAAATTATATAAATTATATCATTGCTAGCCCC TAGACTAGCAAGCGTCTGTCTTTCCTTGGACACAGGAACGCGGGAATAGT GCTTATAATAAAGAGTTCTTATAAAAAATAGAAATTGTCGCGGGAGAGTG GATTGGAAGGACAGACTAGTTCCAAACGGTGCAATACGGGATTTTGCTTC AATCTAATCTCAGGCAACGTTCCCTCGAAAAAGAGGGAAGATAAAATGAA TGGACACGGCTTATTTTTTCTTCTATTCTCATCGCAATATTTGAGTTTCT CGGAGTTATGGATGAGAAAAAATATATAAAAAACACAAACAGAAAAACGT GGCGAGGACTTCTCCAACTTCTTTGCTAAACTGAGAAGAGAAGATTTTTA ATGCTTTTAAATGTTTATAAGCACAGATTTAAACTGTCTTGGCATTCTCT ATCTGAGATACTTTATTCATACATTGTTTTTGGCTTGGTTGGGACGTTGA TATATTCAAAAAACAAACAAACTNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNTCTATTGTACAAGTGCAGTATTTA TGACAATATGACACAGCTGAACACAGATTCCATGACTGCATGCAGGATAC TTTTTGCAGGGAATGTTCAATATGTTTATGCTAACATTCATTGCGTAACG GATCACTGCTTTTTCTATAGTACAAGTTAAACTTGATAACCTTATCCCAG AGAATGTAACTCTGGAATAGCTACAGAAATCCTCAAAAATTAAGATGGAA ATGGTATTTATATAACATTTTTGGTGGTGCAATACATGGTGTGGAAATGA TGAAAAGTGAAAGTGGTAATTTGGAATTTAAAAATTGAATGTTTTTTATA CGAAAACAATATTCTGACAAGCTGACCAGTGAGACACATCTTGGTTCTAT TTGTGAATGAAAATAACAACATTTTACATTGAGATGACTGGTTTTTTGGG TTTTCGGATGCCCGGCCGTTGTTTAGCTGGATTTCACTACCTTGAAATTG TTAGATGTACGAGGATGTTTTGGGGTTTCAGACTTCCAGGGGGCACTTAG GCAAAATTAAGTATGTGGACATGCCGCTGATCAGGGTCCCTTTTTCAGAC TCTAGAGATATATGATAGGGTGCCAAATTTGTACTAATTTTCAAGATAAT AACCCTGACTGGGTCGATTTTTGGTCATTTTAGACAATTTTTACAGTGAG AATATTAGAAATATTAGAAAATGTTTGAATTTTTCGTCTACTTTAAGTCA TTTTTGCCACTTCAAAGATTTTTTTCAATTGAATCATTTATCGTTCTGAA ATGGTCCCAAATTTACCAAACATTCATATCTTACATCTTTTCATTCAGAC AAACAAATCATACTTTTTGTGAATAGTTTTATTTAACTCCTTGTCTTGTT GTTGTTATCTTGTTTCAAGTACTTTCAAGTACTTTCAATTTTTTTTAAAT AAAAAAGCTTCTAAATTGACTGATATTCCATTGTACACCTTCTATATAAT ACATTAAAATCAAAAAATAATCAGGATGTGAGTTTGTTTTGATTTGAGTG AATTGAATTATATATCCAAATGTTGCACTATAAGATGATAAAACACCTCT CATTTAACAAAATAAAAAACAAGTTTTCAAAAAAAATATTTTCGGGGCTT CATGAACGCTGTTAATTTAGTTCAGCAATTAGTTTTTCAAGAGTCTCATT AAAAAAAACATAATAATAAAGTATAAAAAGTACCGAGTTTTGTTTACTTT TTTATTCTAATCCGTGAGAGTGAGTGCGCTGTTTTGAGTGAGCACTCCGC CGCGGTAGAAAAAGCACTCCACCGTTTATTTAGTAAATAGCGCCTTTTGG AAGTAGTCGTTGTATTCAGTGAACATATATAGAAATAGATCCCATTGCAA GTTCAATCTGCAGCGAAATACAACGACGTGGTTTACTAGTCTACTAGCCC CTGGACAATAGCTCATATAAAATTTCCCTCAATAAAAATAATTAATGGTT TTGCTATTGATTATTTTATAACACCCTGGTCTTTTCTCAAACGTTATCAA AAGTTAGAAGCTGTTTACTTAGCCCATAGTTTTACGTCTTTTCCAGGGCT ATTTTTTTTTGAATTGTGGGAAAGATACATTGTCAGATTATCCATTGTAA TTATCCAAGGAATTGTTCCGAGGGTAGAATTGTTTTGCTGATACAGTGAA ATCTTCATCATAACTCGAATGTCTCGTTAACTCGAACATGTTTTATGGTC CTTTCAATTAACAATGCGTTATAAACATTACAACCTTAACTGGAACAAAT TTGTGTCCACAGTGCGTGTTCGAGCTACGGAGATTCCATTGTACATCTCT ATTTCGTTCATTCTTTTCAGTTTTTCAACACTGTATCGTACATCATCGGT GGATACACTTATTCTTTAAACGAAATTGAAAATGGAGTGTTGAGGTCCAA CCGGAAACCACTTGGCTCATTCAAGAAACCATTCAGCAAGACCGACCCTC GTCTCAAGATTGCACTGGAAACTTGTGAACCCAAGGTGCATTTTGCGTTG GTGTGTGGTGCCAAAAGTTGTCCACCCATCAAAACTTATTCTGCTAAGGT ACGTGAGAAAT

Coding sequence (CDS) from alignment at sc0000012:125467..141627-

>TCONS_00001915 ID=TCONS_00001915|Name=TCONS_00001915|organism=Clytia hemisphaerica|type=CDS|length=8295bp|location=Sequence derived from alignment at sc0000012:125467..141627- (Clytia hemisphaerica)
TTTTTCAACACTGTATCGTACATCATCGGTGGATACACTTATTCTTTAAA
CGAAATTGAAAATGGAGTGTTGAGGTCCAACCGGAAACCACTTGGCTCAT
TCAAGAAACCATTCAGCAAGACCGACCCTCGTCTCAAGATTGCACTGGAA
ACTTGTGAACCCAAGGTGCATTTTGCGTTGGTGTGTGGTGCCAAAAGTTG
TCCACCCATCAAAACTTATTCTGCTAAGGTACGTGAGAAAAAAGTGGATT
ACAGATCAATCGCAAAAGACGAGAAATTTAAACTATACGCAACAAAGACA
GCAGAATTACAAAGAGTCAACGTGGAAGAAGCTACTCGTGAAGAGAAATT
GGCTTTCTTCATCAACATCTATAACGCACTGGTCATTCATGCTTTTGTTG
TGGTCGGCCCACCTGCCAACTTGTGGCAACGCTATAAGCCAGCGAGCTTG
GTGAAGAGTTAAGACAACTGATCCTTGCCATCTATAATAATCATCTCTCA
CCAGACGGAAAGAAAGAAAAGCAGCAGTAGAGATGTGCCAACAACTGGTG
GAACGCCATTTCGGACATAACGTGAAACGTGGTGAATCAGAAGAATTTAA
AGATGATGATTCAGTATACCAATTCATAGAAGATGTACAGGCCAACGCCT
TGAATGCTGGTATCAAAACACAATGTGAACCAAGGCCTGACATGCTTGAG
TTCCATTGTGAATTGGATGAATATGCAGAGTTGACAAAGGAATTACGAGA
TAGCGGTATTGTTGGAGATCATTGGAAAAACTTGAAGAATTACAAAAATT
CGTTCGTTGGAAAGGAAGCTGTTGATTGGCTTGTCAAATACAAGAATCTA
GAGCAAAGAGGAACTGAACGACTTGATCAACCTAGTGGAACAGAATGAGC
CACCAAAAGAAGCACCGAATCCTTCTGATTGGATGGAGGCTGATGACGAA
ACAGAAGTTGGTAAAGATGAAGGGAAGAATTATTATTTTTTCCATTCTTG
GATGTCCATTCTGTATCAAATGTAAAGGTTATTTAGATCAACTTGGCTTA
AATTATATTGATGTCAATTTGGATAAGAACAGTTTGGCACGACAGAAAGT
CATTGAGATGACTGGCCAGAAGACGGTGCCTCAGGTTTTCTTCAATGAAA
GACATGTTGGTGGTTGGGACAATTTAAGCAAACTGTTTTTCAACACTGTA
TCGTACATCATCGGTGGATACACTTATTCTTTAAACGAAATTGAAAATGG
AGTGTTGAGGTCCAACCGGAAACCACTTGGCTCATTCAAGAAACCATTCA
GCAAGACCGACCCTCGTCTCAAGATTGCACTGGAAACTTGTGAACCCAAG
GTGCATTTTGCGTTGGTGTGTGGTGCCAAAAGTTGTCCACCCATCAAAAC
TTATTCTGCTAAGGTACGTGAGAAAAAAGTGGATTACAGATCAATCGCAA
AAGACGAGAAATTTAAACTATACGCAACAAAGACAGCAGAATTACAAAGA
GTCAACGTGGAAGAAGCTACTCGTGAAGAGAAATTGGCTTTCTTCATCAA
CATCTATAACGCACTGGTCATTCATGCTTTTGTTGTGGTCGGCCCACCTG
CCAACTTGTGGCAACGCTATAAGCCAGCGAGCTTGGTGAAGAGTTAAGAC
AACTGATCCTTGCCATCTATAATAATCATCTCTCACCAGACGGAAAGAAA
GAAAAGCAGCAGTAGAGATGTGCCAACAACTGGTGGAACGCCATTTCGGA
CATAACGTGAAACGTGGTGAATCAGAAGAATTTAAAGATGATGATTCAGT
ATACCAATTCATAGAAGATGTACAGGCCAACGCCTTGAATGCTGGTATCA
AAACACAATGTGAACCAAGGCCTGACATGCTTGAGTTCCATTGTGAATTG
GATGAATATGCAGAGTTGACAAAGGAATTACGAGATAGCGGTATTGTTGG
AGATCATTGGAAAAACTTGAAGAATTACAAAAATTCGTTCGTTGGAAAGG
AAGCTGTTGATTGGCTTGTCAAATACAAGAATCTAGAGCAAAGAGGAACT
GAACGACTTGATCAACCTAGTGGAACAGAATGAGCCACCAAAAGAAGCAC
CGAATCCTTCTGATTGGATGGAGGCTGATGACGAAACAGAAGTTGGTAAA
GATGAAGGGAAGAATTATTATTTTTTCCATTCTTGGATGTCCATTCTGTA
TCAAATGTAAAGGTTATTTAGATCAACTTGGCTTAAATTATATTGATGTC
AATTTGGATAAGAACAGTTTGGCACGACAGAAAGTCATTGAGATGACTGG
CCAGAAGACGGTGCCTCAGGTTTTCTTCAATGAAAGACATGTTGGTGGTT
GGGACAATTTAAGCAAACTGTTTTTCAACACTGTATCGTACATCATCGGT
GGATACACTTATTCTTTAAACGAAATTGAAAATGGAGTGTTGAGGTCCAA
CCGGAAACCACTTGGCTCATTCAAGAAACCATTCAGCAAGACCGACCCTC
GTCTCAAGATTGCACTGGAAACTTGTGAACCCAAGGTGCATTTTGCGTTG
GTGTGTGGTGCCAAAAGTTGTCCACCCATCAAAACTTATTCTGCTAAGGT
ACGTGAGAAAAAAGTGGATTACAGATCAATCGCAAAAGACGAGAAATTTA
AACTATACGCAACAAAGACAGCAGAATTACAAAGAGTCAACGTGGAAGAA
GCTACTCGTGAAGAGAAATTGGCTTTCTTCATCAACATCTATAACGCACT
GGTCATTCATGCTTTTGTTGTGGTCGGCCCACCTGCCAACTTGTGGCAAC
GCTATAAGCCAGCGAGCTTGGTGAAGAGTTAAGACAACTGATCCTTGCCA
TCTATAATAATCATCTCTCACCAGACGGAAAGAAAGAAAAGCAGCAGTAG
AGATGTGCCAACAACTGGTGGAACGCCATTTCGGACATAACGTGAAACGT
GGTGAATCAGAAGAATTTAAAGATGATGATTCAGTATACCAATTCATAGA
AGATGTACAGGCCAACGCCTTGAATGCTGGTATCAAAACACAATGTGAAC
CAAGGCCTGACATGCTTGAGTTCCATTGTGAATTGGATGAATATGCAGAG
TTGACAAAGGAATTACGAGATAGCGGTATTGTTGGAGATCATTGGAAAAA
CTTGAAGAATTACAAAAATTCGTTCGTTGGAAAGGAAGCTGTTGATTGGC
TTGTCAAATACAAGAATCTAGAGCAAAGAGGAACTGAACGACTTGATCAA
CCTAGTGGAACAGAATGAGCCACCAAAAGAAGCACCGAATCCTTCTGATT
GGATGGAGGCTGATGACGAAACAGAAGTTGGTAAAGATGAAGGGAAGAAT
TATTATTTTTTCCATTCTTGGATGTCCATTCTGTATCAAATGTAAAGGTT
ATTTAGATCAACTTGGCTTAAATTATATTGATGTCAATTTGGATAAGAAC
AGTTTGGCACGACAGAAAGTCATTGAGATGACTGGCCAGAAGACGGTGCC
TCAGGTTTTCTTCAATGAAAGACATGTTGGTGGTTGGGACAATTTAAGCA
AACTGTTTTTCAACACTGTATCGTACATCATCGGTGGATACACTTATTCT
TTAAACGAAATTGAAAATGGAGTGTTGAGGTCCAACCGGAAACCACTTGG
CTCATTCAAGAAACCATTCAGCAAGACCGACCCTCGTCTCAAGATTGCAC
TGGAAACTTGTGAACCCAAGGTGCATTTTGCGTTGGTGTGTGGTGCCAAA
AGTTGTCCACCCATCAAAACTTATTCTGCTAAGGTACGTGAGAAAAAAGT
GGATTACAGATCAATCGCAAAAGACGAGAAATTTAAACTATACGCAACAA
AGACAGCAGAATTACAAAGAGTCAACGTGGAAGAAGCTACTCGTGAAGAG
AAATTGGCTTTCTTCATCAACATCTATAACGCACTGGTCATTCATGCTTT
TGTTGTGGTCGGCCCACCTGCCAACTTGTGGCAACGCTATAAGCCAGCGA
GCTTGGTGAAGAGTTAAGACAACTGATCCTTGCCATCTATAATAATCATC
TCTCACCAGACGGAAAGAAAGAAAAGCAGCAGTAGAGATGTGCCAACAAC
TGGTGGAACGCCATTTCGGACATAACGTGAAACGTGGTGAATCAGAAGAA
TTTAAAGATGATGATTCAGTATACCAATTCATAGAAGATGTACAGGCCAA
CGCCTTGAATGCTGGTATCAAAACACAATGTGAACCAAGGCCTGACATGC
TTGAGTTCCATTGTGAATTGGATGAATATGCAGAGTTGACAAAGGAATTA
CGAGATAGCGGTATTGTTGGAGATCATTGGAAAAACTTGAAGAATTACAA
AAATTCGTTCGTTGGAAAGGAAGCTGTTGATTGGCTTGTCAAATACAAGA
ATCTAGAGCAAAGAGGAACTGAACGACTTGATCAACCTAGTGGAACAGAA
TGAGCCACCAAAAGAAGCACCGAATCCTTCTGATTGGATGGAGGCTGATG
ACGAAACAGAAGTTGGTAAAGATGAAGGGAAGAATTATTATTTTTTCCAT
TCTTGGATGTCCATTCTGTATCAAATGTAAAGGTTATTTAGATCAACTTG
GCTTAAATTATATTGATGTCAATTTGGATAAGAACAGTTTGGCACGACAG
AAAGTCATTGAGATGACTGGCCAGAAGACGGTGCCTCAGGTTTTCTTCAA
TGAAAGACATGTTGGTGGTTGGGACAATTTAAGCAAACTGTTTTTCAACA
CTGTATCGTACATCATCGGTGGATACACTTATTCTTTAAACGAAATTGAA
AATGGAGTGTTGAGGTCCAACCGGAAACCACTTGGCTCATTCAAGAAACC
ATTCAGCAAGACCGACCCTCGTCTCAAGATTGCACTGGAAACTTGTGAAC
CCAAGGTGCATTTTGCGTTGGTGTGTGGTGCCAAAAGTTGTCCACCCATC
AAAACTTATTCTGCTAAGGTACGTGAGAAAAAAGTGGATTACAGATCAAT
CGCAAAAGACGAGAAATTTAAACTATACGCAACAAAGACAGCAGAATTAC
AAAGAGTCAACGTGGAAGAAGCTACTCGTGAAGAGAAATTGGCTTTCTTC
ATCAACATCTATAACGCACTGGTCATTCATGCTTTTGTTGTGGTCGGCCC
ACCTGCCAACTTGTGGCAACGCTATAAGCCAGCGAGCTTGGTGAAGAGTT
AAGACAACTGATCCTTGCCATCTATAATAATCATCTCTCACCAGACGGAA
AGAAAGAAAAGCAGCAGTAGAGATGTGCCAACAACTGGTGGAACGCCATT
TCGGACATAACGTGAAACGTGGTGAATCAGAAGAATTTAAAGATGATGAT
TCAGTATACCAATTCATAGAAGATGTACAGGCCAACGCCTTGAATGCTGG
TATCAAAACACAATGTGAACCAAGGCCTGACATGCTTGAGTTCCATTGTG
AATTGGATGAATATGCAGAGTTGACAAAGGAATTACGAGATAGCGGTATT
GTTGGAGATCATTGGAAAAACTTGAAGAATTACAAAAATTCGTTCGTTGG
AAAGGAAGCTGTTGATTGGCTTGTCAAATACAAGAATCTAGAGCAAAGAG
GAACTGAACGACTTGATCAACCTAGTGGAACAGAATGAGCCACCAAAAGA
AGCACCGAATCCTTCTGATTGGATGGAGGCTGATGACGAAACAGAAGTTG
GTAAAGATGAAGGGAAGAATTATTATTTTTTCCATTCTTGGATGTCCATT
CTGTATCAAATGTAAAGGTTATTTAGATCAACTTGGCTTAAATTATATTG
ATGTCAATTTGGATAAGAACAGTTTGGCACGACAGAAAGTCATTGAGATG
ACTGGCCAGAAGACGGTGCCTCAGGTTTTCTTCAATGAAAGACATGTTGG
TGGTTGGGACAATTTAAGCAAACTGTTTTTCAACACTGTATCGTACATCA
TCGGTGGATACACTTATTCTTTAAACGAAATTGAAAATGGAGTGTTGAGG
TCCAACCGGAAACCACTTGGCTCATTCAAGAAACCATTCAGCAAGACCGA
CCCTCGTCTCAAGATTGCACTGGAAACTTGTGAACCCAAGGTGCATTTTG
CGTTGGTGTGTGGTGCCAAAAGTTGTCCACCCATCAAAACTTATTCTGCT
AAGGTACGTGAGAAAAAAGTGGATTACAGATCAATCGCAAAAGACGAGAA
ATTTAAACTATACGCAACAAAGACAGCAGAATTACAAAGAGTCAACGTGG
AAGAAGCTACTCGTGAAGAGAAATTGGCTTTCTTCATCAACATCTATAAC
GCACTGGTCATTCATGCTTTTGTTGTGGTCGGCCCACCTGCCAACTTGTG
GCAACGCTATAAGCCAGCGAGCTTGGTGAAGAGTTAAGACAACTGATCCT
TGCCATCTATAATAATCATCTCTCACCAGACGGAAAGAAAGAAAAGCAGC
AGTAGAGATGTGCCAACAACTGGTGGAACGCCATTTCGGACATAACGTGA
AACGTGGTGAATCAGAAGAATTTAAAGATGATGATTCAGTATACCAATTC
ATAGAAGATGTACAGGCCAACGCCTTGAATGCTGGTATCAAAACACAATG
TGAACCAAGGCCTGACATGCTTGAGTTCCATTGTGAATTGGATGAATATG
CAGAGTTGACAAAGGAATTACGAGATAGCGGTATTGTTGGAGATCATTGG
AAAAACTTGAAGAATTACAAAAATTCGTTCGTTGGAAAGGAAGCTGTTGA
TTGGCTTGTCAAATACAAGAATCTAGAGCAAAGAGGAACTGAACGACTTG
ATCAACCTAGTGGAACAGAATGAGCCACCAAAAGAAGCACCGAATCCTTC
TGATTGGATGGAGGCTGATGACGAAACAGAAGTTGGTAAAGATGAAGGGA
AGAATTATTATTTTTTCCATTCTTGGATGTCCATTCTGTATCAAATGTAA
AGGTTATTTAGATCAACTTGGCTTAAATTATATTGATGTCAATTTGGATA
AGAACAGTTTGGCACGACAGAAAGTCATTGAGATGACTGGCCAGAAGACG
GTGCCTCAGGTTTTCTTCAATGAAAGACATGTTGGTGGTTGGGACAATTT
AAGCAAACTGTTTTTCAACACTGTATCGTACATCATCGGTGGATACACTT
ATTCTTTAAACGAAATTGAAAATGGAGTGTTGAGGTCCAACCGGAAACCA
CTTGGCTCATTCAAGAAACCATTCAGCAAGACCGACCCTCGTCTCAAGAT
TGCACTGGAAACTTGTGAACCCAAGGTGCATTTTGCGTTGGTGTGTGGTG
CCAAAAGTTGTCCACCCATCAAAACTTATTCTGCTAAGGTACGTGAGAAA
AAAGTGGATTACAGATCAATCGCAAAAGACGAGAAATTTAAACTATACGC
AACAAAGACAGCAGAATTACAAAGAGTCAACGTGGAAGAAGCTACTCGTG
AAGAGAAATTGGCTTTCTTCATCAACATCTATAACGCACTGGTCATTCAT
GCTTTTGTTGTGGTCGGCCCACCTGCCAACTTGTGGCAACGCTATAAGCC
AGCGAGCTTGGTGAAGAGTTAAGACAACTGATCCTTGCCATCTATAATAA
TCATCTCTCACCAGACGGAAAGAAAGAAAAGCAGCAGTAGAGATGTGCCA
ACAACTGGTGGAACGCCATTTCGGACATAACGTGAAACGTGGTGAATCAG
AAGAATTTAAAGATGATGATTCAGTATACCAATTCATAGAAGATGTACAG
GCCAACGCCTTGAATGCTGGTATCAAAACACAATGTGAACCAAGGCCTGA
CATGCTTGAGTTCCATTGTGAATTGGATGAATATGCAGAGTTGACAAAGG
AATTACGAGATAGCGGTATTGTTGGAGATCATTGGAAAAACTTGAAGAAT
TACAAAAATTCGTTCGTTGGAAAGGAAGCTGTTGATTGGCTTGTCAAATA
CAAGAATCTAGAGCAAAGAGGAACTGAACGACTTGATCAACCTAGTGGAA
CAGAATGAGCCACCAAAAGAAGCACCGAATCCTTCTGATTGGATGGAGGC
TGATGACGAAACAGAAGTTGGTAAAGATGAAGGGAAGAATTATTATTTTT
TCCATTCTTGGATGTCCATTCTGTATCAAATGTAAAGGTTATTTAGATCA
ACTTGGCTTAAATTATATTGATGTCAATTTGGATAAGAACAGTTTGGCAC
GACAGAAAGTCATTGAGATGACTGGCCAGAAGACGGTGCCTCAGGTTTTC
TTCAATGAAAGACATGTTGGTGGTTGGGACAATTTAAGCAAACTG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000988XLOC_000988Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001915-proteinTCONS_00001915-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001915-exon-sc0000012-1575043694:141602..141627TCONS_00001915-exon-sc0000012-1575043694:141602..141627Clytia hemisphaericaexon
TCONS_00001915-exon-sc0000012-1575043694:133334..133593TCONS_00001915-exon-sc0000012-1575043694:133334..133593Clytia hemisphaericaexon
TCONS_00001915-exon-sc0000012-1575043694:132727..132841TCONS_00001915-exon-sc0000012-1575043694:132727..132841Clytia hemisphaericaexon
TCONS_00001915-exon-sc0000012-1575043694:132100..132261TCONS_00001915-exon-sc0000012-1575043694:132100..132261Clytia hemisphaericaexon
TCONS_00001915-exon-sc0000012-1575043694:130627..130803TCONS_00001915-exon-sc0000012-1575043694:130627..130803Clytia hemisphaericaexon
TCONS_00001915-exon-sc0000012-1575043694:129545..129618TCONS_00001915-exon-sc0000012-1575043694:129545..129618Clytia hemisphaericaexon
TCONS_00001915-exon-sc0000012-1575043694:128651..128848TCONS_00001915-exon-sc0000012-1575043694:128651..128848Clytia hemisphaericaexon
TCONS_00001915-exon-sc0000012-1575043694:125467..125707TCONS_00001915-exon-sc0000012-1575043694:125467..125707Clytia hemisphaericaexon
TCONS_00001915-exon-sc0000012-1510915933:141602..141627TCONS_00001915-exon-sc0000012-1510915933:141602..141627Clytia hemisphaericaexon
TCONS_00001915-exon-sc0000012-1510915933:133334..133593TCONS_00001915-exon-sc0000012-1510915933:133334..133593Clytia hemisphaericaexon
TCONS_00001915-exon-sc0000012-1510915933:132727..132841TCONS_00001915-exon-sc0000012-1510915933:132727..132841Clytia hemisphaericaexon
TCONS_00001915-exon-sc0000012-1510915933:132100..132261TCONS_00001915-exon-sc0000012-1510915933:132100..132261Clytia hemisphaericaexon
TCONS_00001915-exon-sc0000012-1510915933:130627..130803TCONS_00001915-exon-sc0000012-1510915933:130627..130803Clytia hemisphaericaexon
TCONS_00001915-exon-sc0000012-1510915933:129545..129618TCONS_00001915-exon-sc0000012-1510915933:129545..129618Clytia hemisphaericaexon
TCONS_00001915-exon-sc0000012-1510915933:128651..128848TCONS_00001915-exon-sc0000012-1510915933:128651..128848Clytia hemisphaericaexon
TCONS_00001915-exon-sc0000012-1510915933:125467..125707TCONS_00001915-exon-sc0000012-1510915933:125467..125707Clytia hemisphaericaexon
TCONS_00001915-exon-sc0000012-1491911889:141602..141627TCONS_00001915-exon-sc0000012-1491911889:141602..141627Clytia hemisphaericaexon
TCONS_00001915-exon-sc0000012-1491911889:133334..133593TCONS_00001915-exon-sc0000012-1491911889:133334..133593Clytia hemisphaericaexon
TCONS_00001915-exon-sc0000012-1491911889:132727..132841TCONS_00001915-exon-sc0000012-1491911889:132727..132841Clytia hemisphaericaexon
TCONS_00001915-exon-sc0000012-1491911889:132100..132261TCONS_00001915-exon-sc0000012-1491911889:132100..132261Clytia hemisphaericaexon
TCONS_00001915-exon-sc0000012-1491911889:130627..130803TCONS_00001915-exon-sc0000012-1491911889:130627..130803Clytia hemisphaericaexon
TCONS_00001915-exon-sc0000012-1491911889:129545..129618TCONS_00001915-exon-sc0000012-1491911889:129545..129618Clytia hemisphaericaexon
TCONS_00001915-exon-sc0000012-1491911889:128651..128848TCONS_00001915-exon-sc0000012-1491911889:128651..128848Clytia hemisphaericaexon
TCONS_00001915-exon-sc0000012-1491911889:125467..125707TCONS_00001915-exon-sc0000012-1491911889:125467..125707Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000012supercontigsc0000012:125467..141627 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
12.1609 12.9239 3.8092 2.44683 16.6328 15.0171 16.8092 21.2408 16.6138 16.4227 14.9206 10.2075 18.17 13.9796 14.1828 17.726 14.6686 15.1132 11.343 17.3886 11.0532 9.95222 14.3386 15.4801 6.61002 10.9613 10.2513 6.2659 14.4837 12.9889
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR014025Glutaredoxin_subgr
IPR000591DEP_dom
IPR011991WHTH_DNA-bd_dom
IPR002109Glutaredoxin
IPR006869DUF547
IPR012336Thioredoxin-like_fold
Vocabulary: Biological Process
TermDefinition
GO:0035556intracellular signal transduction
GO:0045454cell redox homeostasis
Vocabulary: Molecular Function
TermDefinition
GO:0015035protein disulfide oxidoreductase activity
GO:0009055electron carrier activity
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0045454 cell redox homeostasis
biological_process GO:0035556 intracellular signal transduction
molecular_function GO:0009055 electron carrier activity
molecular_function GO:0015035 protein disulfide oxidoreductase activity
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00001915 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top