Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001915-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001915-protein
Unique NameTCONS_00001915-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length395

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001915-protein ID=TCONS_00001915-protein|Name=TCONS_00001915-protein|organism=Clytia hemisphaerica|type=polypeptide|length=395bp
MKGRIIIFSILGCPFCIKCKGYLDQLGLNYIDVNLDKNSLARQKVIEMTG
QKTVPQVFFNERHVGGWDNLSKLSKEELNDLINLVEQNEPPKEAPNPSDW
MEADDETEVGKDMLEFHCELDEYAELTKELRDSGIVGDHWKNLKNYKNSF
VGKEAVDWLVKYKNLERKAAVEMCQQLVERHFGHNVKRGESEEFKDDDSV
YQFIEDVQANALNAGIKTQCEPRPASELGEELRQLILAIYNNHLSPDGKK
VDYRSIAKDEKFKLYATKTAELQRVNVEEATREEKLAFFINIYNALVIHA
FVVVGPPANLWQRYKFFNTVSYIIGGYTYSLNEIENGVLRSNRKPLGSFK
KPFSKTDPRLKIALETCEPKVHFALVCGAKSCPPIKTYSAKVREK
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000988XLOC_000988Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001915TCONS_00001915Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR014025Glutaredoxin_subgr
IPR000591DEP_dom
IPR011991WHTH_DNA-bd_dom
IPR002109Glutaredoxin
IPR006869DUF547
IPR012336Thioredoxin-like_fold
Vocabulary: Biological Process
TermDefinition
GO:0035556intracellular signal transduction
GO:0045454cell redox homeostasis
Vocabulary: Molecular Function
TermDefinition
GO:0015035protein disulfide oxidoreductase activity
GO:0009055electron carrier activity
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0045454 cell redox homeostasis
biological_process GO:0035556 intracellular signal transduction
molecular_function GO:0009055 electron carrier activity
molecular_function GO:0015035 protein disulfide oxidoreductase activity
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR014025Glutaredoxin subgroupPRINTSPR00160GLUTAREDOXINcoord: 61..74
score: 30.36
coord: 47..60
score: 50.89
coord: 5..23
score: 34.87
IPR000591DEP domainSMARTSM00049DEP_3coord: 130..205
e-value: 2.0E-8
score: 44.0
IPR000591DEP domainPFAMPF00610DEPcoord: 137..203
e-value: 1.8E-15
score: 56.7
IPR000591DEP domainPROSITEPS50186DEPcoord: 146..205
score: 9.355
IPR011991Winged helix-turn-helix DNA-binding domainGENE3D1.10.10.10coord: 116..227
e-value: 1.5E-19
score: 69.5
IPR011991Winged helix-turn-helix DNA-binding domainSUPERFAMILY46785"Winged helix" DNA-binding domaincoord: 116..214
NoneNo IPR availableGENE3D3.40.30.10coord: 4..112
e-value: 2.7E-19
score: 68.5
NoneNo IPR availableCDDcd04371DEPcoord: 128..202
e-value: 3.34245E-15
score: 69.2917
IPR002109GlutaredoxinPFAMPF00462Glutaredoxincoord: 5..64
e-value: 6.7E-17
score: 61.4
IPR002109GlutaredoxinPROSITEPS51354GLUTAREDOXIN_2coord: 1..92
score: 17.89
IPR006869Domain of unknown function DUF547PFAMPF04784DUF547coord: 278..391
e-value: 1.4E-36
score: 125.1
IPR012336Thioredoxin-like foldSUPERFAMILY52833Thioredoxin-likecoord: 3..76

Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00001915-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top