Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001863 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001863
Unique NameTCONS_00001863
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2307

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001863 ID=TCONS_00001863|Name=TCONS_00001863|organism=Clytia hemisphaerica|type=transcript|length=2307bp
CGTTACCTTCAGTCAAGCTAACATGGTCTTCATCCAACCATTGTTTAGTT
ATTCCGAACAAATTCTTCTCTCGCTGTGAAGGCTCTAGTAACCAGTGAGC
TACTTTCGGGTCTTTCAAAACTGCTTTTGGTAACAAAGTATCGCACAACT
CGTATATGATCTTCAACTGCTCCTTCAGGTCAAAACCCATGATAGTCGAA
GATGCATGCTGGTTAAGGACGGATTGGATACTCTTTAAACGGACTGGCAA
AGGCAGTTCCTGGCAGACATCTGGAGGTAAGGCAGTATCGTCCAATTCGT
TGTGACGTACACCGTCTTCCTGCAAACTGATGTAGTATGAATCCTTTTTA
CCCCAGCATATGGCAAGTCCTGTCAACTGTAAATCATCTCTGGTATATAG
TAAACGATTGCTGGTTGACGACATTGCAGATGGTTTGGATGTGGTTGAAA
CGTCTCTGGCAGATCTCAAGGGACGGCCGATCTTTGATGAAGTTGTTTGA
CTGGTGGGTTTATGAGTTTCACAAGAGAAGGCAACGGTGAAGGATGATTT
GGCTTTCCATTCTTGGATGAATGTCAAGAATAACGTTTTGGAGGATGCGA
CATCGATAATTAGGAATTCATTAGATGCACTTTCGTTTAGGTTGGTTTCT
TGAGGAGTGACTCTCTCTGTTGCTTGAGATGTAGAATTCTTAGTGAAAAG
TTCAGTACTCTCGAATAGGTCTCCACTGTTGTCATTGCTTTCAATGTTCT
GATCGAATAAATCAACCTCCGGTGAAGTAACTGACGTTAAATTTCGTTGC
AAAGTTGATGCTTCCCCGGTTAAAGCGTCATTGAATTGGGAATGTAATTT
CATGGGTGGTAATATTTTAGGAAAAGTGTCCAGTGCTTCGTCAGTTGTTG
ATAGTCGCAAGGAAAGGTTTGGCGAGGGTGTGGTCACACTTAGTTCGGTT
TTCGGCGACTCGATTAGTATTGGTGATTTTTCTTTCGGTTTTAAAGCACT
GTCAGACAAGAGTAAGAGCGAATCAGATGATTCCAAGTAATCGCTTGTCT
TTCgtttggttttcttactgttCACAGAACCCTGTTGCTCCTGGTGGTTG
AGTTCACATTCTGCAATCGTTCGAGATTCTGGTTCGTCCTTGGTAACAAT
ATCTCTGGTTTTATTAACTGTGTGGGTTGAGAAGCTTGgaattttatcat
tcaaaaacaaagaatctTGGGTGTGCAGTTTATCACAAAAATTCCCAGTG
TTCAGGATTCGATCTTCGGAAAGGTTCGGTGTTTGCTCTGACATAGTTTG
GTCTTGATTCTTAGTTGAAAAGCTATTGAAGTCTTGGTTTGGTATCAAGA
ATAACGAGTCTTGAGTTTCGGATTTATCGGATAATTGGTTGTGGAGCACT
GTATCTTTCAATTGTTCAATCAAAATGTCTGTAGTCATTTTAATATcaga
ttgattttcttttcctaGTATGTTTGGCAATGATTCGCCAAAGAGTAACG
AATCATTACTCAAATTTTCAACCATCTTTTGAGCAGTGTTAATGActtga
ttttcttgaaatagAGACATGTCATTATCAGCCAAAGATAAATTTCTACT
GAGATTCTGAGTCGAAAGATTCTGTATTTCTCGTAACACAGGACTAGGCG
ATTGAGACGTGCTTTTCTGCAAAGCATACGCTAGTTGTGTTCCAACTTTT
GAGTTACTATCAACTCTTTCACCACTACGTTGTTCGGGAGATAAACGTTT
CGAAGATCTCAACGGAGTGATTTTCTCAGCCGATGCTCTTTTACGATTCC
TACGTTTTATAGTACTCTTAGTGAGGCTGGATCTTCTTTTCTTGCCTGAT
GAACTGGAGGAAGATTTAGAGATTGTCGAATTCTTGGATGAGAGATTTAA
CTGCCCAATGGGAATGCCTAGTGCTTGTGCATCCGCTGCAAGGATACGTT
TGGCTTCGTCAATGATCAATCTGCCAGCTTCCTGCTCCGACAAGCCTTCT
TTCCCACTCAACCATAAACATTTAGGTACTGATTTACCCACCATTTCAGC
ATCCTTTCCTTTTAGTTTGTTACTGTAAAACGGTGTCGATTCACGAAGCA
ATTTAGAGATTTCTTTTTCACTTGCATTGGCTATGGCACTCACAGTTTGA
AATCCGTTCTGATAGAATAAACGAGCAGTGAAACGATTCAGTAACGATAT
GCGAACCAGATTACACAGGTCCCGGCAAACACCAAATGACAAACGACTTT
GAAATTGCTCCAGTAAGACTTCTAAACATGACCAGCCAAGTTTCTTACAA
AACACGG
Run BLAST on NCBI

transcript from alignment at sc0000012:1138497..1140868+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001863 ID=TCONS_00001863|Name=TCONS_00001863|organism=Clytia hemisphaerica|type=transcript|length=2372bp|location=Sequence derived from alignment at sc0000012:1138497..1140868+ (Clytia hemisphaerica)
CGTTACCTTCAGTCAAGCTAACATGGTCTTCATCCAACCATTGTTTAGTT ATTCCGAACAAATTCTTCTCTCGCTGTGAAGGCTCTAGTAACCAGTGAGC TACTTTCGGGTCTTTCAAAACTGCTTTTGGTAACAAAGTATCGCACAACT CGTATATGATCTTCAACTGCTCCTTCAGGTCAAAACCAATGATANCAACA AAGTATCACACAACTCGTATATGATCTTCAACTGCTCCTTCAGGTCAAAA CCCATGATAGTCGAAGATGCATGCTGGTTAAGGACGGATTGGATACTCTT TAAACGGACTGGCAAAGGCAGTTCCTGGCAGACATCTGGAGGTAAGGCAG TATCGTCCAATTCGTTGTGACGTACACCGTCTTCCTGCAAACTGATGTAG TATGAATCCTTTTTACCCCAGCATATGGCAAGTCCTGTCAACTGTAAATC ATCTCTGGTATATAGTAAACGATTGCTGGTTGACGACATTGCAGATGGTT TGGATGTGGTTGAAACGTCTCTGGCAGATCTCAAGGGACGGCCGATCTTT GATGAAGTTGTTTGACTGGTGGGTTTATGAGTTTCACAAGAGAAGGCAAC GGTGAAGGATGATTTGGCTTTCCATTCTTGGATGAATGTCAAGAATAACG TTTTGGAGGATGCGACATCGATAATTAGGAATTCATTAGATGCACTTTCG TTTAGGTTGGTTTCTTGAGGAGTGACTCTCTCTGTTGCTTGAGATGTAGA ATTCTTAGTGAAAAGTTCAGTACTCTCGAATAGGTCTCCACTGTTGTCAT TGCTTTCAATGTTCTGATCGAATAAATCAACCTCCGGTGAAGTAACTGAC GTTAAATTTCGTTGCAAAGTTGATGCTTCCCCGGTTAAAGCGTCATTGAA TTGGGAATGTAATTTCATGGGTGGTAATATTTTAGGAAAAGTGTCCAGTG CTTCGTCAGTTGTTGATAGTCGCAAGGAAAGGTTTGGCGAGGGTGTGGTC ACACTTAGTTCGGTTTTCGGCGACTCGATTAGTATTGGTGATTTTTCTTT CGGTTTTAAAGCACTGTCAGACAAGAGTAAGAGCGAATCAGATGATTCCA AGTAATCGCTTGTCTTTCgtttggttttcttactgttCACAGAACCCTGT TGCTCCTGGTGGTTGAGTTCACATTCTGCAATCGTTCGAGATTCTGGTTC GTCCTTGGTAACAATATCTCTGGTTTTATTAACTGTGTGGGTTGAGAAGC TTGgaattttatcattcaaaaacaaagaatctTGGGTGTGCAGTTTATCA CAAAAATTCCCAGTGTTCAGGATTCGATCTTCGGAAAGGTTCGGTGTTTG CTCTGACATAGTTTGGTCTTGATTCTTAGTTGAAAAGCTATTGAAGTCTT GGTTTGGTATCAAGAATAACGAGTCTTGAGTTTCGGATTTATCGGATAAT TGGTTGTGGAGCACTGTATCTTTCAATTGTTCAATCAAAATGTCTGTAGT CATTTTAATATcagattgattttcttttcctaGTATGTTTGGCAATGATT CGCCAAAGAGTAACGAATCATTACTCAAATTTTCAACCATCTTTTGAGCA GTGTTAATGActtgattttcttgaaatagAGACATGTCATTATCAGCCAA AGATAAATTTCTACTGAGATTCTGAGTCGAAAGATTCTGTATTTCTCGTA ACACAGGACTAGGCGATTGAGACGTGCTTTTCTGCAAAGCATACGCTAGT TGTGTTCCAACTTTTGAGTTACTATCAACTCTTTCACCACTACGTTGTTC GGGAGATAAACGTTTCGAAGATCTCAACGGAGTGATTTTCTCAGCCGATG CTCTTTTACGATTCCTACGTTTTATAGTACTCTTAGTGAGGCTGGATCTT CTTTTCTTGCCTGATGAACTGGAGGAAGATTTAGAGATTGTCGAATTCTT GGATGAGAGATTTAACTGCCCAATGGGAATGCCTAGTGCTTGTGCATCCG CTGCAAGGATACGTTTGGCTTCGTCAATGATCAATCTGCCAGCTTCCTGC TCCGACAAGCCTTCTTTCCCACTCAACCATAAACATTTAGGTACTGATTT ACCCACCATTTCAGCATCCTTTCCTTTTAGTTTGTTACTGTAAAACGGTG TCGATTCACGAAGCAATTTAGAGATTTCTTTTTCACTTGCATTGGCTATG GCACTCACAGTTTGAAATCCGTTCTGATAGAATAAACGAGCAGTGAAACG ATTCAGTAACGATATGCGAACCAGATTACACAGGTCCCGGCAAACACCAA ATGACAAACGACTTTGAAATTGCTCCAGTAAGACTTCTAAACATGACCAG CCAAGTTTCTTACAAAACACGG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000983XLOC_000983Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001863-exon-sc0000012-1491911889:1138497..1138674TCONS_00001863-exon-sc0000012-1491911889:1138497..1138674Clytia hemisphaericaexon
TCONS_00001863-exon-sc0000012-1510915933:1138497..1138674TCONS_00001863-exon-sc0000012-1510915933:1138497..1138674Clytia hemisphaericaexon
TCONS_00001863-exon-sc0000012-1575043694:1138497..1138674TCONS_00001863-exon-sc0000012-1575043694:1138497..1138674Clytia hemisphaericaexon
TCONS_00001863-exon-sc0000012-1491911889:1138740..1140868TCONS_00001863-exon-sc0000012-1491911889:1138740..1140868Clytia hemisphaericaexon
TCONS_00001863-exon-sc0000012-1510915933:1138740..1140868TCONS_00001863-exon-sc0000012-1510915933:1138740..1140868Clytia hemisphaericaexon
TCONS_00001863-exon-sc0000012-1575043694:1138740..1140868TCONS_00001863-exon-sc0000012-1575043694:1138740..1140868Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000012supercontigsc0000012:1138497..1140868 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
1.09986e-07 0.563284 0.143542 0 5.30854 3.56034 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0.0265465 0 1.32116 1.2452 0 0 0.385102 0
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR012337RNaseH-like_dom
Vocabulary: Molecular Function
TermDefinition
GO:0003676nucleic acid binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0003676 nucleic acid binding
Blast
BLAST of TCONS_00001863 vs. Swiss-Prot (Human)
Match: DPOLQ (DNA polymerase theta OS=Homo sapiens GN=POLQ PE=1 SV=2)

HSP 1 Score: 115.161 bits (287), Expect = 5.635e-26
Identity = 54/133 (40.60%), Postives = 90/133 (67.67%), Query Frame = -3
Query: 1913 VFCKKLGWSCLEVLLEQFQSRLSFGVCRDLCNLVRISLLNRFTARLFYQNGFQTVSAIANASEKEISKLLRESTPFYSNK--LKGKDAEMVGKSVPKCLWLSGKEGLSEQEAGRLIIDEAKRILAADAQALGI 2305
            VF  +LGW  +E+LL QFQ RL+FG+ R+LC+LVR+SLLN   AR+ Y +GF TV+ +A A+  E+  +L+ + PF S +  +  ++  +  +   + +W++G++GL+E+EA  LI++EA+ IL  D   +G+
Sbjct:  764 VFSNRLGWHNMELLLSQFQKRLTFGIQRELCDLVRVSLLNAQRARVLYASGFHTVADLARANIVEVEVILKNAVPFKSARKAVDEEEEAVEERRNMRTIWVTGRKGLTEREAAALIVEEARMILQQDLVEMGV 896          

HSP 2 Score: 113.62 bits (283), Expect = 1.690e-25
Identity = 67/205 (32.68%), Postives = 113/205 (55.12%), Query Frame = -3
Query:    5 IIDVASSKTLFLTFIQEWKAKSSFTVAFSCETHKPTSQTTSSKIGRPLRSARDVSTTSKPSAMSSTSNRL-LYTRDDLQLTGLAICWGKKDSYYISLQEDGVRHNELDDTALPPDVCQELPLPVRLKSIQSVLNQHA--SSTIMGFDLKEQLKIIYELCDTLLPKAVLKDPKVAHWLLEPSQREKNLFGITKQWLDEDHVSLTEG 610
            IIDVAS + LF TFI+EW+ K  F+++ +CE  +  + + ++ IG   + A      S P  +    +   +   DD  + GLA+CWG +D+YY SLQ++  +H+E+  + +PP +   L L  R+  +QS L + +    +++ +D  +  KI+   C   L ++  +DPKVA WLL+P  +E  L  I   +L  + + L EG
Sbjct: 1827 IIDVASDQNLFQTFIKEWRCKKRFSISLACEKIRSLTSSKTATIGSRFKQA------SSPQEIPIRDDGFPIKGCDDTLVVGLAVCWGGRDAYYFSLQKEQ-KHSEISASLVPPSLDPSLTLKDRMWYLQSCLRKESDKECSVVIYDFIQSYKILLLSCGISLEQS-YEDPKVACWLLDPDSQEPTLHSIVTSFLPHE-LPLLEG 2022          
The following BLAST results are available for this feature:
BLAST of TCONS_00001863 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
DPOLQ5.635e-2640.60DNA polymerase theta OS=Homo sapiens GN=POLQ PE=1 ... [more]
back to top