Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001861 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001861
Unique NameTCONS_00001861
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2433

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001861 ID=TCONS_00001861|Name=TCONS_00001861|organism=Clytia hemisphaerica|type=transcript|length=2433bp
TTCAGGGAAAAGTAAAGACAAGAATCAATAAAACAAACTTTCTAAAGACT
GCATGTTATTACGAAAGAAAAATTCGCTAAGaaatttctatcaacaattc
cAAATAAGTTTTCAACGGCATTACTGCAAGAATGTAGCATTGCCATTGCA
TAATTATCTAGATGAACAAATTCGTAATTTTTGTATCATTGCTCATGTTG
ACCATGGTAAAAGTACTTTAGCGGATCGTCTTTTGGAAGTAACAGGCACA
ATTCAAAAAGATGCAAAAAACAAGCAAGTTCTTGATAAACTTCAAGTGGA
GAGAGAACGTGGCATAACAGTCAAAGCACAAACCTCATCAATGTTCTACA
AAGCtaacaatcaaaagacttttctATACAATCTTATTGACACGCCAggt
CATGTAGATTTTAGTTATGAAGTATCAAGGTCATTAGCAGCATGTCAAGG
AGCATTGTTGGTTGTTGACGCAGCACAGGGTGTTCAAGCTCAAACCGTAG
CAAATTTTTACGGTGCTTTAGACGCTGGTTTGACCATACTCCCAGTTGTC
AACAAGATCGATTTGGCATCAGCAGACGTTGAAAGTTGTGTCAAACAGCT
GGAAAGTGTTTTTGACTTTGCACGAGATGAAATACAATTGGTTTCAGCCA
AGGAAGGCATTGGAATTGACAAACTACTCGAAGCTGTTCACACAATTATA
CCATCACCAATTGTTGAAATGAATCAAGATGTCTCATTATTACTGTTCGA
TTCATGGTTTGACAAATACCGTGGTGTCGTGTGCCTAATGGCTGTCAAAC
ATGGACAATTAAATGTTGGTGATAAGTTACAATCTCATTTCACGAAAGAA
TCATATGACGTCATTGAGATGGGAATCTTACACCCGGATGAAGTTCCGGT
AGACACATTatacGCAGGTCAAGCCGGCTATGTTGTCCTCGGGATAAGAG
ACGTGAAAAAGGCTATACTTGGAGACATTTATCATAAATATGGCAGCAAT
ATTGATGAAGCAGTGTCTGAAAGATATACCTTCAAACAACCCACGCCAAT
GGTATTTGCAGGTGCTTTCCCATCCGATCAAAGTGTGTATGAGAACATGA
AAAAATCCATACAAAAATTAACCCTAAACGATGCAAGTGTAACTGTTCAT
CCTGATAGCAGTGCAGCTCTTGGTCAAGGTTGGCGTTTGGGATTCTTGGG
ATTACTTCACATGGatgttttcaagcaaagattagCTCAGGAATATGACA
CAGATGTGATAATGACAACACCAAATGTCCCTTATCAAGCTGTACTAAAA
GGGAATGAAGATGAGAAGATCACCATAAGAAGTCCTGAAGATTTTCCAGA
AGCGATCCAGACAGTAGCTTTGTACGAACCAATGATCACTGGCACTCTCA
TCTTCCCTGAACAGtatttggggaaaatcatcacACTTTGTGAACAAAAG
CGAGGCGTTCAACTAAACATTACTTATATTGATGACACTCGAATCATGAT
GAAATACAAACTGCCTCTCAATGAAGTCGTTGTAgacttctttgataaac
tgaagTCTATATCTTCAGGATACGCAAGTTTTGATTACGAAGAGAGTGGG
TTTGAAGAGACCAACATCGAAAAGATGGAGATTTTATTAAATGGAAAGTC
AATAGATGCACTGAGTACTATTGTCCATCGCTCAAAAGTACGAGAGCTTG
GGAAAAGTTATTGCTTTAAACTAAAGAACACTATACCAAGACAATTATTC
GAAGTGGTCATACAAGCTTCAGTCCGAAACAAAGTGATTGCTCGTGATGT
GGTCAAGCCTGTACGCAAAGATGTTACTGCGAAATGTTATGGAGGTGACC
TCACTCGAAAACGAAAATTGTTGGATCGCCAGAAAGAAGGGAAAAAACGG
ATGAAAAAGTTCGGCAAAGTTGAAGTACCCCATGAAGTTTTCTTGTCTTT
ATTGCAACGGTGAAAGAATTTGGAGTTGAATGGATATTTTCAAAAGTGAC
AGAAAAGTGATCCCAAGTactcaaaaacaagaaaatatgcTTCCATGTTT
ATACGTGAGACAACATGGAAAACaaacttgaaattcaattttcgaATTTT
AGCTACTGTATCTTTACCTTACAGAGAACTTATTTTAGCACATTTGCTGC
TCACCGACATCATTTCCGccaactttaatttttttcctctGAAAAACTTG
TTTGCTTGGTCGAAACTGTAGAAAAGCTCGAAATGGACATATTTTACCAA
TTTACTGGGTGTTTTACTCGTTAAAGTTGGGATATGATAATTATTATATG
CaacaaacacccctgtctcggtgACCCGTCGGGAATCTTTTAGCCAGCtg
ggatgaaatattttatttttatttttacagtttGAAAATTCGATGTGATG
TTCTCAAAGTTTTAATGCATAATTCAGAATTGG
Run BLAST on NCBI

protein sequence of TCONS_00001861-protein

>TCONS_00001861-protein ID=TCONS_00001861-protein|Name=TCONS_00001861-protein|organism=Clytia hemisphaerica|type=polypeptide|length=636bp
MLLRKKNSLRNFYQQFQISFQRHYCKNVALPLHNYLDEQIRNFCIIAHVD
HGKSTLADRLLEVTGTIQKDAKNKQVLDKLQVERERGITVKAQTSSMFYK
ANNQKTFLYNLIDTPGHVDFSYEVSRSLAACQGALLVVDAAQGVQAQTVA
NFYGALDAGLTILPVVNKIDLASADVESCVKQLESVFDFARDEIQLVSAK
EGIGIDKLLEAVHTIIPSPIVEMNQDVSLLLFDSWFDKYRGVVCLMAVKH
GQLNVGDKLQSHFTKESYDVIEMGILHPDEVPVDTLYAGQAGYVVLGIRD
VKKAILGDIYHKYGSNIDEAVSERYTFKQPTPMVFAGAFPSDQSVYENMK
KSIQKLTLNDASVTVHPDSSAALGQGWRLGFLGLLHMDVFKQRLAQEYDT
DVIMTTPNVPYQAVLKGNEDEKITIRSPEDFPEAIQTVALYEPMITGTLI
FPEQYLGKIITLCEQKRGVQLNITYIDDTRIMMKYKLPLNEVVVDFFDKL
KSISSGYASFDYEESGFEETNIEKMEILLNGKSIDALSTIVHRSKVRELG
KSYCFKLKNTIPRQLFEVVIQASVRNKVIARDVVKPVRKDVTAKCYGGDL
TRKRKLLDRQKEGKKRMKKFGKVEVPHEVFLSLLQR
Run BLAST on NCBI

transcript from alignment at sc0000012:1049367..1095674+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001861 ID=TCONS_00001861|Name=TCONS_00001861|organism=Clytia hemisphaerica|type=transcript|length=46308bp|location=Sequence derived from alignment at sc0000012:1049367..1095674+ (Clytia hemisphaerica)
TTCAGGGAAAAGTAAAGACAAGAATCAATAAAACAAACTTTCTAAAGACT GCATGTTATTACGAAAGAAAAATTCGCTAAGGTATAATATTAGTCTTCTT AAAGTCAAACTTTATCTAAAatcattttgattggcttaggtcatcatcaa aatcataaaagtaaaaaaaaatcaacttaaaatttattgtaaaaaatttg aaatatttggaaaatgacAGAATATCACAATCCAAACCTTAAGCATAGTT CCAAGCAGCTTATATACCAAATATGCTTAACCACTACTTTACCTTGAAAC CAATACATTATGCCTGCAATTTCATTGGACAACACAAAGTTCTTGAAGCC TTTTTTACTGCATTTAAAGTTCCATGGTTGAACAACCAAATGCAAACATG TAAAATGACACTTTTCAGCAACAGAATCCATATGATGAAAAAGTTTGTAT GGAATTTTCTTACACTGCCATAACTTTTAATGCTTcctttttagcttttt taatCGCTTTCAATTATCCATGTTGTTgcaaaaataagcaaaaaatattt agtGATTCCTATGATGGCCTCAGCCAGAAATACTTTCCTCTGCTGATTTT AAATATATCAATTTTACTTCCACTTCAACTGTGGTGAGATTTTGCTCAAA AATAAGCCTTGATTAAACTGTTTATTATTTCGAATCATTANAAAAGGAAG CCTTGATTAAACTTTCTCTCATTTTCATAAATTGTTATCTCAAATCATTG TTATtattggcaaatttttattttacagaaatttctatcaacaattccAA ATAAGTTTTCAACGGCATTACTGCAAGGTaagtattttattttgttactt GGGCACAGATATTTATTGTTGACAAACTCAAACTTAATCTGTTTAGAACG AAATTTcatttgtaaattttattgtttaagcCCTTGTTTCAATCTACAGT AGAAAGTATAAACGGAAGCAAGCTATTTTAAAttcttatcaaaaatatat tttagacTCTCCAATTATTAATCTTCTCAATGTTTCAAATGTAAGATACA AATATTTAGAGATAATTTACTTTATTTTAGAATGTAGCATTGCCATTGCA TAATTATCTAGATGAACAAATTCGTAATTTTTGTATCATTGCTCATGTTG ACCATGGTAAAAGTACTTTAGCGGATCGTCTTTTGGAAGTAACAGGTGGA TATGTcaatttataattattttataagCTATGTATACCGGAGCATTGCAG CTGACTGGAATCGGTTGCTACTTCTTTTATACTCTTCTTATTGGATAAAC TTGAGTTTTGTAACAGGGGCGGGttctgatttccaaaaaaaacaaaaaga ttttgtaggatttccgaaattccaaactaaaagaaaaaaacagaataCCA AAATCTCGTAATCTAGTGAAAGTAAATTTTATAGAAATTCAGGCTTAtat aattttattgttttatataATTCAAGGTATCTACTTTATTTCTGTTTACA GGCACAATTCAAAAAGATGCAAAAAACAAGCAAGTTCTTGATAAACTTCA AGTGGAGAGAGAACGTGGCATAACAGTCAAAGCACAAGTACTATTTCTCG CACATTTTCTCTCATGTTTGTGGTTCTGCTCATAAAATAATTATGCAATA ATATTAATAGTTAATTTCAACTATGCCTGTCAGGTGTTCTTTTGATTGCA AAGAGCTAAGCAAATATATCTATCATTGCATCGGTTTGGCCTTTGTATAA TGCGTAGGTTTAGACTTTGATCACTCCATCTATACCACAAGAGATGCCAA TGACACTACGACTTTCGATATCAAGGACTTAGCACACAACATAAACAACA ACTTAAACACGACATTTTAATGTTATCTACCGTTATCTTTCAGACCTCAT CAATGTTCTACAAAGCtaacaatcaaaagacttttctATACAATCTTATT GACACGCCAGTAAGTAAGACGTGAAAACCTGTTATAAGCTACAAAATTTG ATTATTATGTATTCATGTAACCCTTTGATATTTGAAGAAGCTaggagaaa tatttaaaatatataaaattatatataaaataaGTAAAggaaacaattga aacaatttcTGGCACATTATCATTAacaaggtttttttatttttagggtC ATGTAGATTTTAGTTATGAAGTATCAAGGTCATTAGCAGCATGTCAAGGA GCATTGTTGGTTGTTGACGCAGCACAGGTGTATATAAAATAAACACGATA CTCCATATTAAACTATAtattaaaaagctcaaaatgattTCGGGGAAAAA CCCCACCAGCAATATTGGTACCCTATTTTTAACATCTTGAAACATTGACA TCAAATCACCTAATATGGAAATGTAGACagactttatttttatcataaaa cttttttaaagattcaagGAACATTAATTTGAACCGTCAGAGACACATTT CTATTAGGGCATCATAATTTCTCAGGATTAGAGGGATAAGGCGAAACTAA GAAGAGACTTGTTTAAACGATTATTTCCATGATCTCTAGAGAGACCTCCA AAAAGTAACATCCAAATCTAAAGTTTTCCTATCCCATGTGTGTATCTCAA AATAGAATTTGATCCTTTTAATGTTTTCGAACCAAAATAAGGAAGTACAA ATATAAATCGTAAATATCTTGACCTTGAAAAACAAGTAGCCGGTTAACTT TCGAAGTTTACTATAAGGCTTatagaaaaaatgttttagaCAAATCTCAT GTTTTTTTGTGTCCCTCCTTTTAATCTACAACAtaataaatttggatttt aggCAATAAAATAATGTTGCATCTTTATTTATATTCACAGGGTGTTCAAG CTCAAACCGTAGCAAATTTTTACGGTGCTTTAGACGCTGGTTTGACCATA CTCCCAGTTGTCAACAAGGTATCTTGGTTTCATGTTCATAATTATGTTAC TtattactcttttgtgcttaggGGTGGGTGGAATAATCAGGAGGGGTTGG TACTCTGGGAGAAAATCCATGATTGGCGGGGGGTCAAtattttaagtgat tttggggtgattttcccaaaaaacccTAGTTAGTTTTATTAGTTTTATTC CTATTCTATGCTCCTTTGTCTTAGATCGATTTGGCATCAGCAGACGTTGA AAGTTGTGTCAAACAGCTGGAAAGTGTTTTTGACTTTGCACGAGATGAAA TACAATTGGTGTGTATTGTTTCAAAAAAGTGTCAATTAGCTCAGTATATC TTCAATCGATAGGGTTATGGAAAACTCTGGAtacaaatcaaaatttcttg cTGGGCCTGGATGCGAATCATCAAAGTAGTCTGCCAACCTAGGCTTCTTA TCGGAGCAATGGCCTTTCGAGTGAAAACGTGCCATGTTCGGAGTAATCAG GGTTTGCTCGGAGATTAATAGTAAAGTATTTATGAGTACAGTCTTCCTTC CGAAATGGTGTTGTATATTTTTCTTATCTATTCCATAGGTTTCAGCCAAG GAAGGCATTGGAATTGACAAACTACTCGAAGCTGTTCACACAATTATACC ATCGTAATCTATAactgttctttagaaaaataaccATGAAAATCTTTATC ACCGATAGTATTTTTGTGGAAATCTTCGAAATGttcctctttttttttat aaaactcaGACCTTTGTCCTTTCAAATTTAACGATGGCCATTTCTTAGAT GACTATTTCTTAGTAAACATTGAGCAGCTTGCTTAATGTTCATAATACAA CACCTTCCAACAAGGACTTTTTACTGTACCACAAATAGTCGGATCAAAAT TGTAAATAACTTTAACGGTTTCACAAATTTTAGACCAATTGTTGAAATGA ATCAAGATGTCTCATTATTACTGTTCGATTCATGGTTTGACAAATACCGT GGTGTCGTGTGCCTAATGGCTGTCAAACATGGACAATTAAATGTTGGTAA GTTCAAGATAagagtattcatgatatgcaccattgcaatgtcttccattc cacccaatagctgattggttcaaagttacgtattgactgattttacgtca cttacaaccaatgagcgattggttccgtgatgtaatgtcagaagacattg cagtggtgcatatcatgaatatactGAATAAATCAGATCAACAAACTTGT TTGCATGATGTTTCTCTATACAGATATACATGCTGCAAATAATTAGTCGA ATCGATGTTTAAGGATTGCCACATgacaattttgttattttgtataAGCA ACTAGATTGCTCGACCCCTGGAGTCGGTCAAATATTCCTTACTGTCTATC TGGTAAAGAAAAAGCCTTTATGATAATCTAACTATGGCAAACGGTTGTCC TTGTGACCCATTAAGCAATTGTTATAAGCCGTAATCATACCAAATTTCTC GTATACCttcagggaagaaatttttgcggaatttaatttcgtggtttTTG ACAAATTCTGCGAAATTACGGGAAACACTAATATTCTTAGGATTTAAGAA ACTACCtctaaagttgtttttttttagggcaaaataggccatattgtaaa caaaaaaactctctcaaccgcgaaattaaattccgtgaaacttccGAATT TTAAGCTGTGAaccgctaaattaaattccgccAAAGTATCTTCCCTTAAG GCTAGAGTGACAATTAGCGTTAGAGCCGGAGCTAAAATTCGAGCTGCTTT CAAAAAAGGTGTCGATGAAAGTGAATTGATGGCATTCTAATTTTCCATCA GCCCAAAACTTTGTTCTCTCGATTTTTCTTAGGTGATAAGTTACAATCTC ATTTCACGAAAGAATCATATGACGTCATTGAGATGGGAATCTTACACCCG GATGAAGTTCCGGTAGACACATTGTAAGTTTAAAAATGAGATCGAAATCA ATCTCTAAAAATTGCTGAATCGAAATAATATCCTTTTAGGAAAGGAGCCA CGTATTTCATTGATTTAAGTCATTTAAACCAAGACTAAATTAGCCAAATA GTCTTTAAGACAgtttatttcaatttatttcatCTTTGAAGTTATGATAT CAATCAACAGACAaaaacaccttcaaattagcctattatcataggctgat tagcctatcataggctatttagactattttgtataggctatttagccgaa aatcgataaaaacctcgatttctgacgaaatataaatagttgNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNattt ctgacgaaatataaatagtcgcgtctatttttcaccattacttcattgcc caaagccaaaagaatctttttcacttAAACTGATATAACATTCAATTTTA NNNNagaaatatgaataaatttattatccatcggctaactaaccgattat aggctaattttctgataatgaAGTGCCGTGTACAAAAACACATGTTtgtt aaaaaatccaaaaagtggaatatttcctaaatcaaaattgacccaaagtc aaaatttgtcatgaacatttctctgacaatgagaaaccatgtattcctta gagaagacgcgactatttatatttcgtcagaaatcgagtTTTTTATCGAT tctcggctaaatagcctatataaaatagtgtaaatagcctatatatgata ggctaatttgaagatGTTCTTGACTGATCAACGCTCTTGAAATGGGTGAA CCTAGATCTTCAATGGAATGCCTTTATCTATCATGCGATCTCGAAAAATC ACCTTTATTTTTTCGCtgaatcttttttttctaaagatacGCAGGTCAAG CCGGCTATGTTGTCCTCGGGATAAGAGACGTGAAAAAGGCTATACTTGGA GACATTTATCATAAATATGGCAGCAATATTGATGAAGCAGTGTCTGAAAG ATATACCTTCAAACAACCCACGCCAATGGttttagtagagggcattttgt aaaatcgctcgactgttttgttaaaagcacttgttatacatttttggaaa gctaaggggtaggggaatcgaaattactatgttNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNggcaaaaatcatagggttaaaaatt aatgaaaattttagctcgagaaaacggagacctgttgtatatatttggaa agctctcaaaaaattaggattagagatatattgcaagtataggtgatttc agtacctaactcgagatattgaacttcaaaaagcgcaaaaactggacaaa atagctgttactggctgaaaaacacggatttcaagggttaatatctcgag ttaggtacagaaatcacctatacttgcaatatatctctaatcttaatttt ttgagagctttccaaaaatatacaacagNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNcgattcccctaccccttagctttcc aaaaatgtataacaagtgcttctaacaaaacagtcaagcgattccaaaaa atcgaacaaaattccccctactatttgATTCTGTTCTTTTATTACGTTTG ATGAAATTATCATTTTAACTATTATTTGAAACTTAATCCAACAGCAGGAA AATCTTATTATTTTACCTGATCAtttgccagatgacgtcatcaagtggCT GGCGGaataaattttgcagattttatAAGTCGATGAGGAGTATGAAACTC TGTTGAAAATTACGGTATAAAATATCCCCCGAATATGTTTTATGTTGATT TCACGATGACGTTAACTatagcattttctttgaaaatcgaaaaatgctta gAATTTCTGAATCAGTTGACGAAAATCATTGTTTATACAGTTGAGTCTCA GTCTCTATATAATGCAAAAccacacggggaacacaaatttgttcgagtta aggaaatttcgagttatggagtaaggttcaTAAGGCGGTGTTATCTGAAG AGACGAGAAAAttcgttcgagttaaggagatattcgagttatagagtttc GAGTTAACGAGATGTTTTCTTACNGAAAAttcgttcgagttaaggagata ttcgagttatagagtttcGAGTTAACGATGTTTTCTTAACACATAGGTAT TTGCAGGTGCTTTCCCATCCGATCAAAGTGTGTATGAGAACATGAAAAAA TCCATACAAAAATTAACCCTAAACGATGCAAGTGTAACTGTTCATCCTGA TAGCAGGTATGTACCTTTGTAGTCTAGTCCTTCCTGGactttcataaaaa taaaatgccCTTTAAAACAATAATCCTTAAACTATACTTTAAActaagaa aagcaaaaaaaacaaaacaagctGATCAAAATTTTACGTGGATTTCACCC CCGGTTTTGCAACAATGATGAGACTGACGGCACTTCACGTCACCGatcaa tttctttattttccagTGCAGCTCTTGGTCAAGGTTGGCGTTTGGGATTC TTGGGATTACTTCACATGGatgttttcaagcaaagattagCTCAGGTAAC CATGTGACTTAAGAAGTGGTTGGaagataccgggtgcgccacaaaaaagt ttctctctttgaaactgattttctcgaaatcgaaAGANctttgttattca aaaaaactgaagatgctctaagagagagcgaaatattttaaaccagtatg tttttattctgagtTTTACTTCGTCCGCAATGCTGAATTGAatataaact ttcgcgatttaccatgttaagaattttcaaaaacattaactttcgcgaaa agggccaaaatttgcgaaaatcgcgaaagtttctgctcgcgaaagtttgt acgccgaggctttggtaaaaaattaattaactgTAATTTTAGTAAAATCA ATCACTGGAGTGAGCTTAAAAACCTTTACAGTATCACATTTGACAGCAAG TCTACCAGAAGTGTTcacgttttttataacaacaaagttataagaacatt aagcTTCGAGGCAGAACAAATCTAAGAAACTTTTTAAGACTTTCGAGAAT AttaaaaatgttcatttttttagaaaattacacTAAAGTACTCGtaatgc tgaaaataaaaacattttgggaaagttttaggctgaaaacccaaaaaagt taagaccaCCTGAACTCATCAAAAACTtctgacattcttataaaagattt GTGATATTCAAAGGTATTGagtaaaacttttttatatCAGGATTCTTTTT CATCTCTTATGACAGGAATATGACACAGATGTGATAATGACAACACCAAA TGTCCCTTATCAAGGTAATCCTTCTTATTACTTATTTATGGTATCCCTTT AACAAAGAGAATGGCTAACGAAAGATAGGAGTCTCTAATTGTCCTTTGTG Agtattgtgattgttttcttgttcacttttttataagaagagggcaattt aatttgttatttTACGTACCAGACTACggcgaaaataataaaaataaaag tagaatttcacttataaaatctcctaaaaaagcagcaaaaatttctacat cttgacaaaaagctcgaatttatggattgaacataaaattctcaaaaaac ttgtaaaactaccaaaactttgaaaatttgacagtctgtacacgtttttt ttttataagaacaaactatgaaagaacataatgcttcgatgtccaaaatg ttaagaacaagttaaggacattttaaggctttgcggaaaTGAAAGCACCC GATTTCCTAGAGAAATGGgtaaaaatagtcaaaaaatggtcaaaataaga acatgttaagaacatttttaggcttaaagcccaaaaaatgaagaacatcc aaaggctttaaaaattttggatgttctaatGGGATGGGGACGTGGTCAGA TGGTCCCActtgctgaaaaattgaaaaatctcgagaaaaccTCATTTTCG CCCAATCTTGAATAACTTAaagtagaaaaaagttttcaaattttcaccaa aggtATAAATCGATGAAAGGAAGCAATTCACGAAAAAGGTTTTGATGATG TCAGCTAAATtagctaaaaaaagttttgcctgaaatatgctgacgtcagc aaaaaagtttcatatttttttcgtaaaatttgaAGCCAAAAGCTTTCTCC TACTGGAAGTTATTCAGGTTCTTAtttctgtgacgtcatcacaatAATTA AAAGTTGgcaaaaaagaaatgtttttttaaaatttttcgatttttagcaA GCGGGACCATCTGACAATGCCCCATCTcattttttatatcaaaatgcttc gaaaaaaactaaaaagcttttactttaagGGGCAGGACCTCATGCGACCA TTGGGGAGTGCCTTAGGTACCCCGAgcaatcttatttttattttgaattt tagggtcggtcaggcccgtaaaacaactaatcaaattgatCTTGCCTAAG CATaagtttataagcatatgttaTAAGCTTATAAGCAACTTTTCTAGAGC GCTGACCTTTTTAAAAGCTGTTCGAGCTTTCCtagaccaaagattttcgc ctgcggcgcaaaattacaaataaactttcattctttgagccgaatcaatg tttcgacttgaaaaatttgtttcaggaaagtctaagcatataattaagca taaattaaggctgaaaatgaatTTTAGCTAAACATATTGGGCATCAACCC GATTTTCCCGTACAAAGAGTGTACGGTGCCATCACTCAGATAAAAGCGTG TGGGAAGCTTACACTTTGTATTGCGGTGTGATAGCGAATATTGGTCAGGT GTCAACTAAAGATACAAAGATACACTGATGACATCTTTAGAGAAGCCGAG TGTACTAAGGTTCGAGAATATCGAATTTCCGAAAACCGAACCTTAGGGAG ACAAGCACTTTTAGCAAAAGAGTAATCTTAAAGAGACTTAAACACTTCAA ATTTGGTCGAAAGTGTCTGtcttttagaaaattttaaataataaacTATA CTTTTCACAGcagatatattttttaaatatctgtcATAAGTATATTTTCG TACACACGTAAAGGGTACAGAAGAACTgacgaaaaaggaaaaaaataaaa gcatATCGGGgcctggaattcccgagttatttttcctgAGTTATCTTTTT CCGAGCTGTTTTGCATGTGACGTCATGGTTTCAGTTTTGTGTCGTcattt gtgacgtcatcacaaaaatcataacttttcgagttacactcattttttta taagcataacgtttataaacatactgaagctcaaatttccagaaaaatta aacatatgctaagcataccttgaggctcagccaaaaaaaattttagaatc atgatttccaaaacttcagaaGTGTAGCAGTCTGTTTTTGAAACATGAAC NaatcataatttccaaaacttcagaaGTGTAGCAGTCTGTTTTTGAAACA TGAACACACAACTATAAAGATTCGAAATTATATGGTAaacatttgaaaac aatagaatgtcttcatttttctcaAGATTAAAGAGgggaaaatttgcgaa aatttttacccccctcccttcatatttttttttaccaagtatagggttaa gcataggctcaaaattgagctctacttaagcatagtgagcttcagccgaa atataccgtatgcttataaaacaaaatgagtgtattttgtgtttttttac tTACTCGAAAGGTTAAAAGGTTGAAAAAAAACTCGAGTTTTCATTCTtgt aatgacgtcataatgacgtcacaaaagtgaaattatgacgtcatatgcAA AATAGCTAgggaaaataactcgggaaaaaATAACTCAGGAATTCCATGCT CCAAGGAAATCGAAGTTACTTATCGGtattaaataaatttatttgatatc GGCTTATCGGAAAGAAATGTTTTATGACCAATCAGTAATAATAAAACTTA TCCGCGACGTGAAAATAACCAAAGAAAACTTTTGTCCACTAAACAGAGGT TTCTGCATTTTAGGTTCTCATCTATAAAGTAAAGTTGCTTAAGAGGGAGA ACACCAACCATCCCATCCCTACAGAGAATAAGTCTTTCCCGCCAGCCTCA TTTTTAAAGGGCGGCACATAcggtaccctccatttgcctaagtatccccc cccGGGAGTAGAGTATTGGTAATTATAGCTATAAGATTGACTCGGAATTG GGACGATAGCTAGTCCCTGCGACTAGAAGTAATAAAATACCTATGCAGCC AAACGAAGATAAAACCGGTTATGCAAGGTctatttgtcattttcaatatt ttaatgtgaaagtaaaataaataactaactttacttgaaaaaataacATG ATACTGATAGACCACCAATGAAATAGATGATGAAATATGAAATTAGGTTG GACTATACAAAATTGAATAGGAGATAGGAATTGAAAATACTAACTTGGGC TTGATTGAGACTATATGGATAAGTAAACGAACAACTGAATAGGCATATGG AATAGATACTAAATTATATCAAGCATGGTGATAGACTATCTACTTTCACT GTAATTTTTGTCTGATTCACGCAAAATTTTCTAAACGCtcatttatataa aaataaatctcTTAAAAATTGTTTAAACCTGGGCTTCTGGTAAAAAAGCC AATGAAATCGGGTAATAAAATCCGAATTCATGTAAGTCGTAGATGccaca aaaatataaaaaacagatcactttttaaaattttggtgacaaaaatttca agtcaagaCTTCACGGGTCTGAGATTAACAATACCATCACCTTGGAAATA GCTTTACATTTTCCTTATCatgcattttttgattttttaaaaattcacgT GCTGGTCCATCTTTCGGAGTACACACATGCGTATCTACCATATTATTGAT GGAGTATTTTAATACATCCAAGATTATTTCAATGTTCTGGTTATCCAAAA TGTCGGTATTGTTGTAAAGTAAATATATTGATTCAACGATGAAATTATCA AACAATACTTGATGTAAATTAGCGAAATCCTTATGATTTGCGTAATTTAA CGTAAGGTGGTTCTCGCGGTTGCAGAAAATTATCGTTGAAATGTCAGTGA ATCCAATTGAGACTTTTACCGTTTCGTGATTACCAAGACCTAAAAGGATA AGTTGGATCATGTCACTGTCGATTTTTTCTGACGGATTGAAGTTGAGGTA TTCGATCGACTTTATATTTAAGCAATCAAGTAATGATTCCATCCCAGCTG CTTCTGACGGCTTTAAACTGTATACAATAACTTCTCTAATATGATCTTCA AATATGTACCTTCCTGTTTGAATAAGCGTCAGAAAAAGCTTCCACTCTCT CACCTCATTACTACTAtgaatttttaaagtttcagtTGACCTATCATATT CCGGTAGCTTGAGAGTTTTGATACCAATTTTTTGAAGGATAGCATCTACC ATTTCGAAGTCACAGTCAGCATTTGCGTTAATGAGACAGGTGGTGATCTT TTGCCCTTCTTCTAAACAAATATCAAGGTGTTTACGAgtaagaaataaaa acttaacaACAGCTGTGCACTCTCTTGTATCGTCTATAACCAGCATTTCC TTATCTTGGATCATGTTATTTGGTAACATAACGGTCCTTATAGTGTGGGA AAGGGTCAGTCTTCCATCTTGAATTAAATTAATCAATTCAATACATTCTT CTGAATCGCTGAGGNGGAGTATTTTAATACATCCAAGATTATTTCAATGT TCTGGTTATCCAAAATGTCGGTATTGTTGTAAAGTAAATATATTGATTCA ACGATGAAATTATCAAACAATACTTGATGTAAATTAGCGAAATCCTTATG ATCTGCGTAATTTAACGTAAGGTGGTTCTCGTTGTTGCAGAAAATTATCG TTGAAATGTCAGTGAATCCAATTGAGACTTTTACCGTTTTGTGATTACCA AGACctaaaaactttttggaaataAGTTGGATCATGTCACTGTCGATTTT TTCTAACGGATTGAAGTTGAGGTATTCGATCGACTTTATATTTAAGCAAT CAAGTAATGATTCCATCCCAGCTGCTTCTGACGGCTTTAAACTGTATACA ATAACTTCTCTAATATGATCTTCAAATATGTACCTTCCTGTTTGAATAAG CGTCAGAAAAAGCTTCCACTCTCTCACCTCATTACTACTAtgaattttta aagtttcagtTGACCTATCATATTCCGGTAGCTTGAGAGTTTTGATACCA ATTTTTTGAAGGATAGCATCTACCATTTCGAAGTCACAGTCAGCATTTGC GTTAATGAGACAGGTGGTGATCTTTTGCCCTTCTTCTAAACAAATATCAA GGTGTTTACGAgtaagaaataaaaacttaacaACAGCTGTGCACTCTCTT GTATCGTCTATAACCAGCATTTCCTTATCTTGGATCATGTTATTTGGTAA CATAACGGTCCTTATAGTGTGGGAAAGGGTCAGTCTTCCATCTTGAATTA AATTAATCAATTCAATACATTCTTCTGAATCGCTGAGGCTCAATAATTTA CCATTAAGGATAAGTGTTTTTGGGAGAGTGATTGTTCTAACGTTTAGCTT TTCAAGAAGGAAATTCACGCCTTCTGAACGACCGATTATGAAGTCTTTAT AAAAGTTTTCGTCGATAACGCAGTTCATTAACTTCGGAGTGTTAATTACC GAAAGCTTACCTTCGTAAATTACGTCTATTGTGGATACGCATTCTAATGA ACCGTCAAGGGTTAAGACATAATCTTTCGTCATCCTCTCGGGTAGAACCA ACGTTTTAATGTTCAAAATCTTTATAAGATAATTCACCTTTTGTGGGCGA TTGCTCATGTGTTGGTCGTAAAATGTGTGATTGATAACACAGTTCATCAA CTTCGGAGTTTCACTTATTGTAAGATTACTTTCGTAAATTATATCGATGA AGTGTATGCATTCTGCTGAGTTGTACAGGCTCAATGACTTTCCTCTCATC ATTTTCTCTGGTACAGTTATCGGCAGTTTCGATTTCTTAATTAAGAAGAT GGCATTTCTGACGTCGTCATCTCTAGTGCAGTTTATCACCTNCTCATCGA CGCCGTCGACGACAATCATAACTCTGTCAGCGATTTCCTTCAAGTCGGCA ACTGTAATGAGCTTAAATATTTCTGGATAAAACTTTTCGAAAAGATCTTC CGAGCTTTTGACTCCATGAAGGACAGTGTTAAGCTCTCTGCATGCAAAAC TAAAGACGAATTCAATTGGGNAAAAAGTCTTTACAGACCGGTTGATTGCA GTCAATCATAAGAACATTTCTGTGAAACATACTTTGCGGAATGATAGTCT TTTTCATgtatttctgaaataaaaagcTTTGAAACCAATTCGATGCCCTT TGTATAAAGGGCGTTGTTGTTGTGTAAAGTCTAGTCAAGTTATCAAAGAA TGTAATGAAAAGACTATTCTCTTTATCTTTTCGCATTCGTTCGATCCCCA GGATTGTCGGTAAACAGCTGGATAGCTCACGGTTTGACAAATAAGGGCTA NCACGGTCTGAGTTGGTGAACTCCTCTTCTACTTTACTGCTCTTGAGAAC CGATAGGTTGACATATGTTTCTTCCCTCGGAATGTAGCAGACATCACTCT CTGATAAGGAGAAGGGCTGGTCGACAAGATGGTTGATGAGACCGTTGACT TTGTTCTGTTTTAGCATGATCGAAGCGGCGAACAAAGCTGAAAATAGATA GTAAATCTAATCAAGTTCACGATCCTGTTTCTCACGCTATACATTCCTGA CAATGCTATTGACTGGGCTACAACATTAATATATTGTCAGGAATGTATTG GTAAGTGCTTGCAATATATCGGAGAGAACTTACAATACATTTCAAAGTGC TCATGACATACACAGGGTAATTTTTTTGATTCCCTAGGCTAtggaaatat atattttcagaTCTGGAAATCTGGATTTTTCCCTAACCAATCCCTAGCTA GGGAAGATGCAACAGCTCCCtagttatggaaatgaaatttcccGATCTTA TGACTACCTATGGATGTTAAATTTCCCTATTATTGAAAAGTGCTTTTCTC GAGCGAAACCCAATAAAACCTCATAGGGTTACCCATATTCACGAATTAAA TCCTGATTTATAGAAAGCTGGTAAAGTAattaaatgtattcgatcattct gtgagcattggttcgatagctctcattcgttctgacatgtacttgtgcta ctttgagaatcccggcacttttgtCACAACNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNtcac cgatccactgagcccttgcgacgcaagtccattgcgaacgaatgaggccg ccctggcgggacgcctcacctttagcgttgtgttacacactgatcgTATA CAACCCTATAATAGTTTGCTTTACATAAGACTCGAAcacttttgagtgaa aaatcacttgtggttttttctcacgcatgcgtaatacaagttagggaaat caattttccctaacctgaaaataattttcccgAACTTTAGGCTCTAATTT GTGacagtttaaaaatttttgattgaattgtcttatttgaaggtttgaaa aataagttttgacTTGATTAATTGTTTAAAGGATACACTCAAATTAAAGA GTTCGGGAAATCGAATTTCCCAATCTGGGAAACTTTATTTCCCTAATTCG AGAAATCACATTTCCCGATCCAGAGAAAGAATAGAATAAAGCAAGCAAGG TCACAATTCGTGATATTTCCTTTCCCTAGCTTGTAGAAAGTAATCATTTT AAAAACTCGTAATCTCTCTTTTCCCAACTCATCCATAATCAGTTTAGAAA AACTTGggatttttaatttcgcgatgCAATTCTGAATGGGCAActagaaa gttaaaaatattagttttccACAATCCGTTTTCACTAACACATTAGTAAT ACTCTTCCAGCATGGGAAAATAGGTTTCCCTAGTTTCCTTACTTTCCCGA ACTTAAAATTCTAGACTAATGTGATCGAATAAAAAACCACATCTGAAAAT GAACAATCCCTAGGCTAGggaataaataattttttcctgtgatattGAGA AGcttgatttgtaatacctgaagggaagaaattttggcggatggccgaaa aacttaaatttggcgggaacttaatttaaatccaaatccgccaaattttc tatccgacaaaatttcttcccttaaggcacTCAAAGCAACTGTTGTTTCC TTCTTATATTACGGTCCCGAGGCcatattaaagtctattcacgataagtg tgcactcttttttcttttacctataacttttgaaggaattcttcaatctt tataaatttggtatcattggaaagatattattattatttcattaaaatat ttattcaatataaagttatgatacaaagttaataagtgattgaccccaaa aaacagcaaaaaactgcagaaaacagcgtttttagacgtcaatcagctta taactttgtttgatatcttttgactgaatgattattcaCNttctttagag cttttttagcgtgGACGACCAAGCGTGTAAGTCTCTACGGTACGAGAGTG AATAAAATTGAATACAATTAAATCAATCGAGTATAATCGAACATAATCAG TACAATCGAAGGATCGAAGGGCAAATCCTTGGTGATATTTGATTGCGATT ATTATTCTattgcattcaattgattcgacgttcgattcattcgattgaca ccgtctggccatAACATGTGAAGGTGGAAATCAATCTACAGTACATCTTA TTCCccattcaattcaatttttcaatttgtttatcTTTATGATAGTACGA ACATTAAATATAAATACAAGtctgggaataaaaatatcctatATGAGGAT TTCTNtctttccaatgataccaaatttataaagattgaagaattccttca aaagttataggtaaaagaaaaaagagtgcacacttatcgtgaatagactt taggtaGTTATTCGCGTTGAATGCACGGTTTATCATTCACTTATTCGCAG AAAACACTCAATTCATTCAAATAACTTGTCATTTTCGAACTTTTCACTTT CTCATTTAAACATCGATTTCATTGTGNAAGTTTTTGATTGTAACGAGTGG GAGAATGTTAAATAGACCTATTGCTAGTCCGggtgtcctgttgaataatt aaaaactctagcACTAAAACAAAGACCTCATATAGCACATGATTATTCTG AttatgcatttatttttcttaatcattgtTTTAGGCTGGtctttttaaat tattcaacatcctgactagcaaaaggtctatcttGAATAATAAGATTACC CTGCCAGCACAGCAGCCTTACTGAAGCACCGGACACAAAATGGCTGGTGT CAACCAAGAAAACTTTATCACTGGACAATCCTAACAAAACAAGGGACCAG ATTTGAATCACTCTTACTGTTGCTGGGTAAAAGGAAAAAGTCTGGTGCTT GACCAGCTTCAAGAATTTGTGCAACTTAACACTAGACAAACACCAGACAG TTTTGAGCGGTGTAATCTAATAATACTTTTCATCATCCAATAGAAGATGA GCAAAAGTCTGGTGCATCGGCAGGGTAGATGAAGCTCCAacatcacaaaa acaaaacacaaaagaataATTTATGAGTTTATTCATTCTTATtgttgttt tgatgctggagtcTGGAGTTTTCTTAATTATTTTCAACTTGACATTGCAC TCCTGAAGGGGCCATCgacaaatcattttcaattttcaatggcaTTCGGC TGTTAACGGGTGGAGGAAGGTTGACCCCATGCTGCTAAGAAGATTTGCAA AGgtcaataatgtttttttttttcataagcataacATTGCCTTTCTATAA GCatgaggatgaattgtccaggggtattgaaaacatactaaaaaattgca atgtccagggggtaaattccaatgtccaagGGTAATTTTTGtatccacgg ggttgatttgatgtttgtccaggggtataacctgtgtccagggggttaaa aatcaaaatatccaggggtaattcatgaaaaaaataatatatcctccacc ccccatgaacggattttttctggaagagcccattttgaTATCCATATCTC TTATTGTTTAATAAAATTCGAACCTGAAATACCTGGGGTACAGCAGGTGG GAAAAAATTGAGTGACAGTGCTAACAAGCCCCTTATTCTGTCTTGGCCAC AAGCCTTGGTTGAGCTTTTTTACCATATTTTCATTCAGTTGGAAAATTTG GGCTTAAAACAGCCATATTTTAGTCAGTTTATTAATTGATACTCTCATTT TTCAGTTTGGAAAAATgggctctttcagaaaaaaattgtacatggggggt ggaggatataacaatttttagtgatttaccccccaaatagggtgactttt ggcccccccagacaataggttttaccccgaacaagcatctgctgacccct cggacaccccaaattacccccggacagagcaaatctACCCCCCGGataaa atatcctccacccccatgtacaatttttttctggaagagcccaatctaaC TCAGATTGAGCCTTTTGGTATANNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNT ACTGTAGCCTAGGATAATTTATACTATTCTTCTGTATGAAGTCAATTGTG AAATTGCCATCTATAGAAAGCCTTTTctacgcttataaaaaagaatcttg atgataatttatggaaaggatttaggggggggggtttgtcacactgacgg gattggccctttttaagTACGGtgttacgggatttgacgaaaaaaagacg ggaaaacggtattttaaaatcagacgatGACGATATTTAGCCTATTTTTT Tgccattatgccggtattttaacctctacaaactggtgtgacggtgttat catttttttccattttcgggattccgggattcagccaaaattttgacggg aaaacggtatttcgaacccctacaaaccaatgaagtataaccccgaaggg ctagaatcgaatcccATTGGTAAgttttgaagccaacaaatcctaccaaa ctTGCGCgtccttgagcggctcgcctggtttttacacaaatgacggattg aaactaaaatttaacgctaaatttcgaaaaaaatatcaatcgtaaacaaa ggaattgctacaTTCAATCTATCGTCAAAAATGTGGCGCATTTtttaaag gcttcactttttcttgcctgagaaaggttagagattgaactctagccctt cgggttttaaactcaatgctaCAAACCCATTTAGGTTctctatgaaaaag taaaatggtatcTACAACCTCGTGTACAATATTCTTCATGCATCACGTTT AACACGTCGTTGTACAGCAAATACCCCCTGCTTGACCTCGttattttatg gtcaatttttctcattttgaatattatgcgaaattttcgacttccgAGTC GTCTTGTTTCTAATTACAACAAAATtcgaaattatttctttttttttatt tcccctTTTGttgattaaaggttttatttttacataagtgtgcccgtttc atatcagacacatatttcataccaggacagtgtctcACTTATATTATcct tatataagcaaaaaatgtttttcttttcttttttctgaccaatcttgctc cacatccgtgtcaatccaatgtgaaaaagcttgcgaattaaaattgatga gtaagcaaacgatatcactcttatttaaaaataaaacctttaatgatAAA GCCTGCCGTCCactagtctagcatgctagacgacttaactcagtaaaaaa tatgaagtagaaaacttgacaggagcatcaatatagtttattttaaccat attccgacataaaaatttctcgctttccacaaaaacgttataaacgactg gattcccagtctagcCGTCCACTAGTACTATTCTTGGTTATCGTGAAATG TAATCGCGAAATGTTATCTCATGTCTCAagttatttttagattttacatG TCCACTATTAAATAGGATAATTGCGAAATAGATATAATTTCTTTCCAACT TCAAGATGACTGCTTTTTCAGCGGTATCTGGAAAATTAAAATAACCATTC ATTTAGATCCAACACCATCACAAGAGTAGGATAGATACAGTAAAACAATT TGCAATATCCACATAAAGTAATAGAAATTGGATGATAAAAATCAGACAAT TCTGTGGATTGTTATTTTTACGTTCTTCCATTCCaagaaattttctgatt ttgctCCAACAATTCTTcttgagtgtttttttttttttttttggccggGA TGCGACTTATCATACAAGCATGTATAATTCCTGACGGCTTCAGATAGTTT GCCTCTTGGCATGTTGATACAAAATACAAtcacactacacgtttttttta actagaacacctaaaatttggctgagactggatgtgcttattgttaagca attttcagcctaaaacgttcttaaatgcgttcttaatttttcagactact ctaaatcgacaatatcatgaaAATTAAAGAGCacgcaaaatttggacaat atttgactatcaattttagaaaatccgtgcctaagttcagttaaaactgc ttgaaaaatggaaaaaattgtagtttcttgtcatttttttccaaactgag gcatgttcttaattttttgacaaatttcagcttcaatgttcttataaact gggtttaataaaaaaacgtgtacactaGAGCACAcaccaaaagtcaaaaa tattcTCATGTGATGAAGATGTTTGTATCGCAAAATgattttctctcatt ttttcttCGATCACATGTAATTCGATCTCAtgcaaacattgaaataaaag aaatgcAGGTGTTTTTCGCgattggataaaatctttagtgaaaacttttt cactCCCTATCGTGAAATAAAATAACGTGATAAACAGGTTTATTTCGCGA TAAACAGTGTTATTTATAGATGATCATTTCGCGATAGCTAAAAATAGCCT AGTGGACGGCAGGCTTAAAGAGAACACTTTTTTTCCGACGACGAGTGACG AAAAGAATTAGTATTTCAAAAAACAGCAgcatccggggggggggggggaa ttttttcaaaattttctcaaaaatgtcttaaaatttttgaaaaaatcccc cccccccccgggggggggggggattttttcaaaaattttaagacattttt gagaaaattttgaaaaatcccccccccccccgggggggggggggaatttc tcagaattttcgtcgaaattttctaaaatggctgaagcagaaaaacttga ataactttgattagaaaattagaaactCTGACTTCGTTCTAATCTAAATG AATGTGAAAATGTCTTACTGGCAATCAAATCATCTTCGTAACAGAAAGAT ACAAATTGAAGTTTTATGATCTGGGCTCCTCTCCTCAAGTGCTAAAGGAA ACCCGACAGCCTAACTGCCTTCATATCTAACAGTAACAGTGGATCGTCAA CAACTATTGGAAATCATCTAACCAGAAAGATGAACTCAAAGATGATCAAA TGATGAGCTTCAAAGACTTTAGGacacttttaaacttttgaggACGACCT GGCCTACAGTACCAAAAGACAGACGAGTTAAAGAACTAATATGttgtgaa tgttttgattatcatTTATTATGGCTGATCACTTTTCTACTTAGCTTTGG TGTTTGAAAAACTTGCAGATATATGAAActctaaaaaggctgatttaaTA AATGGTGGAATGATTAACCCAATCTTATTGAATTCATACTCTTGACATTC AATTAAGTTGATTGGAAacttgataatatttttggtattttgaatgACAT ATATACAAGATGTTGATTGACTATTTTAATATACATATATGTGTTAATAT CGATATTGAAATGAAGAAATAATAATCATGGTAGTAGACACTCAACTAGA GGGAATCTTGATATTTTACGATGGACTTGAATGACATTTTTacatacaaa cattttttaaactctaTTTCACTAAAACTACATCTACGATATAAAACTGT ACttttgggtacctaataagcttCCCCTCCCCcgctaataaataaattct cctATCTGGCTTATTCCGAACCCCCATTtatttaggtacccaagagtagt tagagccttttatggaccttattttattaaaagttttcaatttttctttt aaacaaagataCTATCCAgtgtttaagttttttttattctaaaaattttt gttaatcatattgttttgaaaagatagaaTCAATGTTTGGGTCAAAGACT gataattgaattgaaaaattaaagaatNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGCATTTCA CAATATTAAGAACTACCTCCAGAATTACctctcaaaattaatttcattat gatGACTGACTGATTAATTTAGAATATAGTTTGCTTCTGTTTGCTATcta taatttgttaaaattacCTGGCCAAAGAATTCATCTATATAAATTTGTTC AAGATCATCTACTGTAAGCAATAGTTTTTTAATTTGCCAGAAACCAGTCT TGCCAAATTAAAAATCTGGCAAACTGTTTAAAAGCAATATCCAAGCTTTC AATACTCTTTCCATTTTTAGCCAATTGAATGtacattatttttgtaaatc tcAGATTCTGTCCATGGGATGGCAGTTCGCTTATTTAGTCAATGACCCAT GCATAATCAATTGTATATTTTAGTCCACTTTCTACAAATGGCATACATCA CAATTTTACGGTTGGGGTaccaaatattttcatatatataCTAATGCAAT AACCCTCACAATTTCAGTTTGTAGCCTGCTGTGAGCTCTGTCTCTAGTGA CAGTGTGAACAATACATTAtccaaattttaagatattccaAATATTGTTA GTGTTAGTAGCACTACTCAATCTTTTCATCATCGCTGTTGATAATTCTAA TCTACCAAGTCTACCAGCCAAGCTACATATATCAAAATATCCAAAGTGCA AAGAATCCATCCAGTGACAAATTGATTTGGTGTTAtaataaaatagccag aaaattaaagttatgattcaaaaaacatcatcgcgacaaaatatttttca gcattaGGCAGTTGGGTGTTAGATGTATATATATTCTAATCACAATACAT CTTGTCTGTTGAAGATATCCTTGATTTGAAGTCGCCCATCTGTTTTTGAA AGGAGCAGGATATATACAGAATTTATGGttgattattttgatgttttttt atattatatatatattttacatctaaatgaattgaaaaaaaatcaaatga gtGATATTAAACCGAATACTTTTCATCTGAACAAACATAAAGCCAGGTAA ACTAACTGAAAACCTTAATTTCCAACAAAACACAGTCTGGCAGTTCANNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNCGGCAACTAACGTGCGGatcaaaggaaa tttatttttattgttcgaacaatgagataattttgcataattatgcGCTT AGACGTCTTGTTTTGGTTATAAGTCTTTGCCCTTACGTGTAGTTTGATTT GATATCTAATTTTGCTGAAGCCATCAGAAAATGAGCCTGAGCTGTCGACA CAAtttgcaaaacaaatcaaaatgagtgGGAGTCGAAACTATAAAGATCA TCAGTTTTTTACTGTCAGTAGTCCCTCAACACACCCTTAGAGTATATCAA CATATCATaagacccttgtagtgcactctatcaaaagtagacccttacaa tgcatttGAGGGTctcaaaaaacctaccctttaggacggcacatgccgtg ggtcggaccatatgagtgctcCATCCCGAGAGCAGCATGCTGTACTAATC ATCgacataatgtttttttttcactgttcatggAATAAGCCTGTTTGTCT GTTACGCATGCGTATTAAAAACGGCTTTTATCTAAAATAGATTTGCTATG GGAGGGGTTAGAGTTCACTATTTTcaaggaagaaactttcgcgagttcGC GATGTTTCGGCCAAATCACGGATATTGTATATTATCCCCTGTATTCCACA AAAAAATGCCGAAGGTTGCCATTCGCAATAGTCAATTCCCGCAAAATGTG TCAAATTTGTAACTGGCAAAAGTTCATTCCCGCGAATTACgtattttttt ggacctaccccggtggaggtcctataaattaacctgtgtttgttcgtccg ttcgtccgttcgttcgttcgttcgtctgttaccaacttttctcaggattg aatcataggaatcttttgatttttggtacaaaggtggaaaatggtagtgg ccaaaatgtgacggagcccgattttctaaaaaaaaattttttgggcaatt ttgggccaaaaaacggctaaaaaacgggttttttggacttgatgaaaaat tggatcattaattttttctgattttttgcatgaaagtagggtaccatcat aggtaaaagatggctcaaacagattttcgcaaaaaaaatttgttggcgca aaaaacgcatgtttatccataagaatcactattaataagcatacatcaat gttcttagtcaaattactcaattttgttatgagatggatgtttttttgct catgagggcttaccttaaaggaagaaattttggcgggaatttaatttggc ggatggccaaaaaagttttttcagagggaatttaatttggcggatggcca aaaaagttttttcagagggaatttaatttggcggatggacgaaaaaacta aatttagcgggaatttaatttggcggtcgcttaaaaaattaaccttaaga tggcgtcaaaacagcgaaaaaatagcaaaaacaccttaaaaaagagatca tattttcaaaatgtttaatttggcggaaatttaatttggcggatggcgga aaaaagaaattttggcgggaacttaatttggcggatttcagccaaatccg ccaaatccgccaaattttctttccgccaaaatttcttccttataaaccct cgaatgtgacggagctcgtttaaaaaaaaaaatttgaggtaaatttcagc tgaaaaacggctaaaaaaagggttttttgatggatcattgtttttttgga ctttttgcatgaaagtaggtaaaagatggctcaagcagatttttgtaata aaagaatctttcaGTTCAAAAAACGCATCCTtgtctataagaatcactat taataagcatacatcaatgttcttaaaattactggattttttgatgagat atgtttttttgctcacggagtcttgaatatgaaagaatattccaagagca tgaaattttggtttctaaacgtttttttataagaaacaaacgactaattt taatagatcgtcactatttgtgtNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNAGATAGGTGAACCCCCTGTAttatactctgtaccagagtgtatctc acgtttatcgcttcatgctctgtgtgcattgtctgtttgataaaagaatT CCCATTCGaaaacctctgcgatgaagtatgatttacagagagcaacactt ctctcatcgtctcccctctctcaccaacactccccATCGCAgaggtcggt ttgaaaaatctcaaatgagaaaagacaatgataaTAGACCCTCGAcggta atgaattttgaaatcagccgtagatactgggtttgtgtacagacaacctA TATTGTCGTATGTGTATTTATTGATATCTAGAAAGAGTATAATTGGTGGA AAAAAGTTATGAACATTAACACTTTAAGTGTCAATGTCTAGTATATTGGA CATGGCCTATATATGAGGGCGACTTCAAACACGAGcgtctaattccttct agatccggagatataagcctttaatgtttgaactagcgattttcttaaaa tacttagaaaaataggaccgtggcacttaaaggatTAATTAAAATTTGTC ATTTGTTTGATCCACTGaacctttttcttttatttgccTCTTTTGCGAAA GTTAATTCTACTTTCTTAAATTCTAAGCGTTCGAAAATGACAAGTTAATA tccggggttttttatacggactatgattCGACTCAACTAGCTTCGCTTCG TCGAATATCcatcaagctcgactgaatattttttgacaacCGTTCACTTG TCTTTCAACAAATAATAGTTTGGTACAAGCTATTCGAAAATGAGAGGCGA TCAGTGGCAGGGGGGGGGGGCAGGTGGGCCAGGCCCAAccagcggagccc ttttgagaaggggcgctAAGAAGGGGCGCTAAGAAGGGGCGCTAAGAAGG GGCGctaagaaggatttttcagacGGCCCTATGGAAAGATCAGCAATTGA AAAACCAAAACTGGCGCCCCTTATCAACTCaaatacaaaagaatttcgCA CACTCTTCTTTGTGTTTATGATTTAGTTTTTctatagtctagcaagctag acgactaattcatacatattagaaataaagcaaaaaagttaattttagtc gtctagaaacctttgtgcactaactccaaacaaaaaaaaagtgtcaatat cgcaattataattttttcccgctcaaaaaaaattcttgaaaataaaatgt gtgtggatttgtgcgttaaaaatgtttcatttgagttgatttNaataaaa tgtgtgtggatttgtgtgttaaaaatgtttcatttgagttgattttattt tgagagtttgttgttgcttaataaattgttttctcgctacgcaactttct gcgtagctaggcccggtatctataaggctggaacaccggattcttccagt cgtttatacaaactaaatcccgtatcattatttgtgtttattattagtat tacatgcattataaacgactccagtctagtttTTCtattacagtatgtgg cccccaaaacggcgatcaaatttgaagtttctctcaaatctagaggaaaa gagtttttacaaaaatttttgctgcatgaaaacctttaacatctctactt tatttcctggaagttctttttcaaaattttcaatttcaacaatatttttc aatcgcttaNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNTCTAAAAAGGGCGCCAAATTCTGC TTGGTCAAACCAGATGATGTTTCATTATTTTACCACGAGGGTCGTTTCGA ATGAACAGCAATACATTtgaataccgtattacttcgaataaacgccgccg gggcgtttatttaattttttcgattttaggaggggcgtttattcgagggg gcgttcaaaagaagggggcgtttattaaattattttagtctttgttttag ttctttattaGGATAATGGTGCAAAATTCCTTTGGTTTAAcgactaaaat tgcatcgaaaactgctctggttacaagaaatgactaaaatcttccttttc aaacccaatcagcactggtattgaagtattaaagtcaTAGGTTTCTAATA AACGCCTCTCCCctagaggggcgtttattcgaagtaatacggtaattaTA AACAACGGCTATTTAAAAACTGACCCCTACCTTGCGTTATTAATGTATTT CCTTTGATCCAATCAACAATATCAGCCTTTCCAAGTGTTATCAATGTTCT TTTGATATCCGGCCATGGTGTGTTCTTAATAAGTTCTTTTGTGTCTTGGC CATTATTTACCTGAAGTCCTAATCGCTGAAGAAAGTCGTCGCGTTGATCG CCGATACAGTCTGCTATATATGTGCAAACCTCTGGTAGGCAATAGTCACC TCGGTTTCCTGAAACAAGGAAAATGATACTAAACTTTATTAAAACATTAT CAGTTTTAACAATTGAATTCTCCTTCTAATTCGAGTAGCTTTTTTATTAT TTGCATTGtaagcatttttttttcaagatggcAACCTAtcgtcaaatgct cctagtctacttctctggactcagcgtcatcaaaaattattagaaagcaa agttcagccagaagtagactctagtctaacaAGGCAGCCGCCGTGGGTTA GAGCCAAAATGAGGACATTGCATTGCTTTAAATGTTTGTACTTCCACaac aaaatccataatggcacaCTCACTTGTTTACTCTCTAAAGGTTACAATTT CTGTGCGCTCGCTTTGACGATTGGGTTAAGTAATGTTATCTTTTAAAATG CAATGTCAGCGTAATTGAAAGTTTACCTGTGTGTGAGATCGTTCGCTTTT GTAGTTCCTTAACCCTCTCAACTTCAGCGCTTATCTTCTCTATCTGATTT AAGAGCTGTTGGTGGTTTCTATTACCAGTCTGATTATCTTCTCCCTGATG AAACTTGACATCTTCGATTTGGTCGGCTATTTCATCAATACGTTCAGCAA ATTGATCGTGGTTGTCGTTCACTTGCTGTTGAAGGTCCTGTTGATCATCA GCTATCTCATCAATACGTTCAGCAAGTTGGTCGTGGTTGTCGTTCACTTG CTGTTGAAGGTCCTGTTGATCATCAGCTATCTCATCAATACGTTCAGCAA GTTGTTCGTGGTTGTCGCTCACTTGCTGTTGAAGGTCTTGTTGATCATCA GTCATCTCATAAATACGTTCAGCGAGTTGATCGTGGTTGTCGTTCACTTG CTGTTGAAGGTCCTGTTGATCATCAGCTATCTCATCAATACGTTCAGCGA GTTGATCGTGGTTGTCGTTCACTTGCTGTTGAAGGTCCTGTTGATCATCA GCTATCTCATCAATACGTTCAGCGAGTTGATCGTGGTTGTCGTTCACTTG CTGTTGAAGGGCCTGTTGATCATCAGCTATTTCATTAATACGTTCAGCAA ATTGATCGTGGTTGTCGTTCACTTGCTGTTGAAGGTCTTGTTGATCATCA GTCATCTCATCAATACGTTCAGCAAGTTGGTCGTGGTTTTCGTTCACTTG CTGTTGAAGGTCTTGTTGATCATCAGTCATCTCATCAATACGTTCAGCAA GTTTTTCGTGGTTGTCGTTCACTTGATGTTGAAGGTCTTGTTGATCATCG GCTATTTCATCAATTTGATCAGCTAAATCATCGAAAGTATCGTCAGCATA TTTACGAAGACGTTGAACCAAGTGCAATTGATTGTCCTGGTCAAGTTTCA AATTAGCCATCAAACTATGCAATGACTTCAGTACTACGTCATGCTTCGGA TCAAGTGGAATACTCTTGAGAAAGTTTGTGTTGTATGTTGTGTAACCTAA TCCTTGTATAATGGAACATCCTAGTTGCCATCGTTGGTTAAAATGAATTA GGTCAATTTTCTTTGCTGCTGCATGGTTTAGGAAATTTCTCCATTCAAGT GCCCTGACAACAAAATCTGCGAGTCGTTTATCGTTCGGTCTTGGCTGCCC ACGCCATCCCCTGGTTGGAGCCTGAAGTGTGGTGAAATCCTCAATGAGGA TCTTGATTAACGTAATGTCAAACTTTTCTGAGAAGGTTTGATTTCCATTT GGTGGTAACAGAAGGTCAACTTGTTTTGgctttaaaacatttttcctaAC CAGTCTGTTTATGATTGGCTGCTTGTTCAATATTGCCTGGTAAAGAAGAG TGGGATTCTCTGGTAACCCTTGGTACGTCGGATCTTTTGATTTGTTGTGA AGTACAAACAGGAGGGACTCCCTAAGTGGCTCATGTTCAAAAGTGGCCAA ACGGATCCAATATTCTAATTCTTCAGTTGCATCTTTGACCGATTTATACG TGGACATGTCACGGCTTACCCATcactaaaataaaacaaaaatgtgATGA ACCAATTTTAAGTCCGAGTTTTCTTATTCTCAATCTTTCTTTTCATGCTG CGATTGGTATTTGGAGGTGAtttgaatctttttcttttgaacgaatgctg aggtggagcgccacatcTACTCTCAGCTCCAAATTATTTACTGTAGTACT ACAGTATAGATTAGAGTATTTCAGCTACTCATTCGGCGACCGGAGATCGA ACAAACATCACTTTGATTGCTAGGCAAATGCTCTAACGACCGGGCTACCC TTCCCGACTTAACGTATGATTAAGTTATAAAATGACACCGATACGAGGTT CAGGAACGTATTAGAAATCACCAAAAAAGCCCAACCCTAAGAAAGACGGA AAAACTCaatatttcagtctcaaaaaCCTTTTCAATCATCACGGGaatta aatatattttgattgaaCAGAGTTTTAATAGAATAGTATTTTAAGCCCAG TTCAGATattgagttttgaggatttcactttatataaaaattggACAGGA GTTTCTTTGGAATTTGGGTCCGATGGCCCCTACCACATCCTAACTCTAAC ACTCTTTCCGAACATTCTGTCTTTGTTGAGATTAAAAGGTTAATTTCGGC CTACAAATAGTATCTAAATAGATGTTTAAACAAAATGTTCGCGAAAAagg tactttaggcgtacataTAAACtatcgcgagcagaaactttcgcgctttt tgcgaattttagcacttttcgcgaaagtaaatgtttttgaaaattcttga aaaggcAACCAacgaaaaattcttaaaaagttgGACAGGAGTTTCTTTTG AATTTGGGTCCGATGGCCCTACCACATCCTAACTCTAACACTCTTTCCGA ACACTGTTTTTGTTTAATTGAGATTAAAAGGTTAATTTCGGCCTACAAAT AGTATCTAAATAGAtgtttaaacaaaaattttcgcgaaaaaggcaaACAT TGCCTAAGTTTGTATACCTAAAGTTTCATTTCTCGATTCTATTGCATAGA GAattgttataaatttttattgctCACCATAATTTTTTATGTATCACATT TTGATTAACACCGGTCATATCTGCTCCATACTTTGTGAGGGTTTACGTCC TGGATTTAATGGTCCCAAATTCTGTATGAGAAGTAAAAGATATTTtgttc attattttaaaaagacATTGTTATTCAAAACCTAATAGGGCaaattttcc aaagattttGCTCGAGAAAACTAGCCTGAAAACTAGCCCTTACACCCACG GTATCACTTACTGTGAACAAATTGAAGGGGTAATCAgatgacacccctgt ctcagtgccccggtggaaccttttccctcagtgaggatgaaaatttctat cgaaatcccaatgcggatggaaaatctattgtttccagctcaaaaattcc agtggggatggttttggagtccaattttttccattcaattttcaatgggg atagaaccatagggcaatttcccagtggagtagaaaatgtagggtatttt taCCACCGGGGAcggttttttggcctatttttccaccggggcggggggtc caccgggtctgtgacacatgatgatggtttgagattttttacCTGAAGAA ACGCCAAGTATTTTTGTCTAATTACATTCTAAAGTCGAGATATCACAATT TAAAATATCTGAAAATGGGTTCTCACACGgcggttcttacgttgaaattc tattgttttttactaaaagtcaaaaacttgtaacttaatTATCTCATCTT TAggaaatatttaggcaattgAGGTTTTGTTCAGGACAATAGAAAGATTG CACATGCCAAATATCCCAAACCacctgattatccctttaagtgaaaaatt cattaaaaatccATACAGGGCAGAGATATAGAAAACGAAAAcaaagtact ttaggcgtacataTAAACtatcgcgagcagaaactttcgcgctTTTTGCG AATTCTAGCACTTTTCGCGAATTCTAGcacttttcgcgaaagtaaatgtt tttgaaaattcttgaaaaggcAACCAacgaaaaattcttaaaaagtagaa aatctgtaaaacttctaatttgaaataaaatgcaaattaaattgagaaaa aaaatattttttttcgaccttgcgaaagtttctgctcgagAAAGTTTGTA AGCCTAGACATATGTACTATGGCCTAAAGGAATGCAAAATCTAAATCATG ATGAATCCAAACATCATACAACAGGAAACAGAAACCTTAATCGTTAGCAT TGAATCTTACTATTTCTAACAAACTCAACACTTTAATACTATATTTTGGA AAGCCCATCTcgcgaatttgacaaaaaagttattttcgtgagcataaact ttcgcgaatcaagacataacaagtgatacttttatggacctacctggtta tgcattttaacacatatataattgatatctacgtgagcgtgaccattaaa acaatcattcagaacactaatagtgacgatctattaaaattagtcgtttg ttacttataaaaaaccgtttagaaaccaaaatttcatgctctataaatat tctttcatattcaagactttgtgagcaaaaaaaaacatccatctcatcaa aatattgagtaatttggctaagaacattgatgtatgcttattaatagtga ttcttatagataaaaatgcattttttgagctgaaaaattcgttctataca aaaatctgcttgacccatcttttacctactttcattcaaaaaaaatagaa aaaattaatgatccaattttttaaagtccaaaaaacccgttttttagccg ttttttggcccaaatttgcccaaaaacatttttttcgaaaattgggctcc gtcacattcgagggtttatagttacgcatctttgtgcaaaatataataaa gaATGAAACAGGCAATCTCGAGAAAGGCTAATACCtaataattgataatg tgcttataaaaaatatcgaatttggccagtttttctacaaaaacaaaCCA AGCAACCAAAggttcatgtctaaacacatatattctttaaaaggaagccc tcatgagcaaaaaaaacatctatctcataaaaaaaattagtaacCTGACT AAGAaaattgatgtatgcttattaatattgattcttatagataaacatgc gttttttaagccaacaaaatttctttgcaaaaatctgcttgagccatctt tcacctatgatggtaccctactttcatacaaaaaaatcagaaaaaagtaa tgatccaatttttcacaaagtccaaaaaacctgttttttagccgtttttt ggcccaaatttgcctaaaagtttttttttctcgaaaatcgggctccgtcg cattcgagggtttatagttatgcatctttgtgcaaaaaatcataaagaat gaaagcaCCAACCTCGacaaaagctaatacctaagtaattgataatgcgc ttataaaaaaatatcgaatttggccagtttttctataaaaacacgccaag cagcctaaatttcatgtctaaacatacctattcttcaaaagtaagccctc atgagcaaaaaatacatctatctcataaaaataattgagtaatttgacta agaacattgatgtatgcttattaatagtgattcttatagataaacatgcg ttttttgagccaaaaatttttttttgcaaatttctgcttgagccatcttt tacctatgatggtaccttactttcatacaaaaaatcagaaaaaattaatg atccaatttttcacaaagtccaaaaaacccgttttttagccgtttttttg gcccaaatttgcctaaaaactttttttttcgaaaatcaggctccgtcaca ttcgagggtttatagttatgcatcgttgtgcaaaaaatcagaaaaaacta atgagccaatctcgagaaaagctggaaacgaacgaacgaacgaacgaacg aacgaacgaacgaacgaacgaacgaacgaacgaacgaacgaacgaacgaa cgaacgaacgaacatacaaacggttaatttataggacctccaccggggta ggtccaaaaatgaaagttttcaCACGACATGACTTAGagggaaaaattat ttttgaatcgGATTGAAACTTTCGTCAATTGCCTAATGAGGCTTTAACaa gctaaaaagtgccataaatataaatttttgatttaaaagtttttcagaat ttttggcgagcataaactttcgcaaaacaaggtaaaattcgcgaaaatcg cgaaagtttgtacactTTAAATTACTAACAGAATTATTGCGACATGAAAT GTTGCTCAATCAAAAATTACCAGCAATCTTTATCAGGTGTACAGTTGTgt caaaacaaaaaccaacaaatttttatataatatgtTTGTATATTTAATAA ACTTTctactcgcgaaagtttgtacgcctaaagtatgaGCATATCAAACT AAAATAgaattcaagttttttttaagaggaaaatttgaaaatagtgTGAA AATCTTTGTCACAAAGTAGTCCGGAGAAGTTTTTCGTTTGGGAAACCTTC GTTCGTCACCTTTCGCCGACTAACCTTTTTACCTTTAAAATAGGACATAG TTGATTTGGCTAACTTTGGATTACTAACATATCGATAACAGAGTTTCATC ATTTTGTCacttccaaaaacttttaaaaattaagaaaaattacaTACCTT TTTATTGCAAAGCTATTTGTCTCTTTATCCACTCCAATTTGTTTCATTAG AACCAAAAACGATAGTACATCTCATAACTCGTACTAAAATACCAATACTA ACATAAATTTGTTTTTGCATGCAAAACATAATATCCCCTCTAATGGTGTT TTATTTACTCTACTGCACATAACAATAGTTGTCAATCAATATTATTACTA AAGATAAACAATTTGTTATAGTGGGAAATAACCTTTGACGTTCAGCGGGA ATTTTCTGGACCATTGGGACTTAACTTGTTTGTTTTGAGATTTATTTTGA ACAAGGTGCAAACGCTTGTAATCCGTTGGATATAAAATATCGGATGGTTA GTAAAAGGTTAAGGGGGGTTCAGCAAGGGGAACCCTAGACAGGAGAACCC TCCTGTATTtatataatctgatgtatacaggacgggtatgacctgtgcct caaaaaattttcagtggaAAATTCGAGTTTAGCGCTGttctcacttacta aaataaaaaccaaatttcggaagttgcgctttctctaagaaagtgtgacc aaaaaagaatcacaaaatttgattggctatgtttccaaccgttattagga tctgggaaattcaaactcttagcccataccatgctattcatttcgccatc agtatatagaataagaaatcatagcatggatctccaggctagggGAACCC GAATCCGCCATGCCGTTTTTTCCTTACATTCCGTCGAACCGCCTAAATGA GAATCAAAATTCCACCACCGAAAATTTcttcgaaattcaaaatttttgtc aaaagagCCCGaaactttgaatatttttatacatgtaatattttgaattt attgaatattttttgtcaattccTAAGTAACCGTTTttccAGACTAAAAC ATCCCAATTTTTTGTCTCCACCTTGACCTGATTTCCAAAATTCCGTAACC CTATTTTGTTCACAATCATGGTTTCACTCGTGAAATTAGGATTTAGTAGA TTTCATGTTATTACATGGAAATGCCTGGAAGGGACTCCCaacattttcat tcatttacTAAATGAATGAAAATACCAAATAAAAGTGCATACCATCTATT TCCTTATTTCAGCTGTACTAAAAGGGAATGAAGATGAGAAGATCACCATA AGAAGTCCTGAAGATGTATGCGCCTACCTCTcctttttaattatatttta attATATGTTCATTTTTTCACCTATCAATGTAGGTACAGTTATCTTATCA ACTATTAGTCGATAGCTAAGGATGCAAATTTGATAACAGAGTAAGTTTGG TTcttttttaacataaaaatgaGTGTTTTAGACGAAAGTTTAGGGTTAAT TTTGAAACAGTTAAAGAGTTAATTTAGGcgaggaacttattttggcgagg tagcaattttttaatttcggcGAAAACTAATTTTGGTAAATATCAgtgaa attcgcgaaattcgccaaaattagtttccttaTAATGTACCAGTAAACAA GTTCTTGTAATTGTTCTTTCTTATTTTATCATTTCATCAGTTTCCAGAAG CGATCCAGACAGTAGCTTTGTACGAACCAATGATCACTGGCACTCTCATC TTCCCTGAACAGtatttggggaaaatcatcacACTTTGTGAAGTATGTAA ACCGTTGTTTTCTAACTTCAGACGGAGGATTGGGCTCCACTTTTGCACGG GGAGGATTCGTCCCCTTTTCAAttattacccctggacatttcacCCCGGA AAAAGATTTATTTGACATTGCCATTATATACTTTAAGTGTTTCTCAATAC CCGTGGgaaatactttaatcgtagaaattttagcctatattagCGAGCct ggaaaatcttgattttttttggatttattttagcgaatcacgatttcaaa aaatttcgcgtggataaattttagcgaatactcgtattacattattgatt gNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNTACATTATTgattgaattcgttttctagcatttctttgcact gaaacccttcctattgataaaaatgtatcaaggcaatataaccaaaaatt tcgcgtggatagattttagcgatctggcgattcggcgtgttttagcgaga tttattctAGCGAAAacagggaaaactcgctaaaacgctaaaattagtct cgccaaaatttctacgattaaagtatgcCCTCCAAAAAAACCAAGCCTTT CAAAGGACTCATTCAGCTACCGTTATCCCGAGAACAACATTTCTATTCAG TGCCAAGTACGAGACGTCGTGCAAAATAATAGTGCATTTTTCCGTCCCAA GTGGGCTAAGTACAGAAAATCAAGTATATTTTGTATCCTTATTTTTCCAG CAAAAGCGAGGCGTTCAACTAAACATTACTTATATTGATGACACTCGAAT CATGATGAAATACAAACTGCCTCTCAATGAAGTCGTTGTAgacttctttg ataaactgaagTCTATATCTTCAGGATACGCAAGGTTTGTCAAgtataaa atctatttttttaagaaaggcACAGTTTAGGATCCCAAATTTACATCATT CATTAAGGaaaactctttcttttttaatgtgTACTTTGCAGTATTTCAAA TGTATATTTCTTAAACGTTTGCCTGTCATGATAAACTTTCCAACCACATC GCATTCTTCCTTAGTTTTGATTACGAAGAGAGTGGGTTTGAAGAGACCAA CATCGAAAAGGTTTGTGGaaagaaatttatttaattCATGTAACAAGGGT GGACAGAGTTTAATTTTGTGTACAACCTTTTTCTACTATATATACTAGAA CACCAATGCGTCACTAACATGGTGGGCCTTCCCACCGgaaaattttgcta aaattccGCCCTCCGGGTTCGAAAAATACCCTAtataatttcagccccac tggaaaattgactttgttttcttcctatattgaaattcaatagggaaaaa atgcactctaaaaccattcccttttgattttttgacctaggagcaatata atttctatccccattgtgATTTCGATAGATATAttcatccccactgtggg aagaagttccaacggggctgtgaggcagagGTTTACTAGAATAGATTACA GACAtacaaatgcaaaaaaaaattccaaactttcaaaaaaactgtaTAAA TGGAATTTCCCAATGAACCCTACTTCACCATGAAGCCGTTCTTTCGAAGT CGTGTATGTATTGACGTGATAATTAATGGCACTCATGTCATGTGATTTAT ATACCAGATCAAATTACTTTTCAGATGGAGATTTTATTAAATGGAAAGTC AATAGATGCACTGAGTACTATTGTCCATCGCTCAAAAGTACGAGAGCTTG GGAAAAGTTATTGCTTTAAACTAAAGAACACTATACCAAGACAATTATTC GAAGTGGTCATACAAGCTTCAGTCCGAAACAAAGTGATTGCTCGTGATGT GGTCAAGCCTGTACGCAAAGATGTTACTGCGAAATGTGTAAGACACTTGT TTTCATGAACAAATTATTGGGTATAATCTGACCAGTTTCGTAAATCCCTT TAGAATGGGAcctttacaaaaatataacGATGTACGTAATCAAAACGACT GGAAAAGTTCCGTGTTAATAAAAGCCCCCTTAATTCTAACCAGCCGTGTT GTCGAAACATAACAGTCTTCGTGTTAATTTCCTTCTGCTCGGTCTTGCGT TATTAAGGGCAGTTTAATAATTGCCTACTTATATACGTGTAGTATAAGGT ATATCTCTGGAACTGTGTTCAATGTACATTAAGTGGATCTTTTTCAccta tttctttcatttttttgggCTTCTAACTAAATCTCGCGAAAATGGCGAAG ATTgatccacgcgaaatttaattcacTTAGCACAATGCTATCATGAATAG GGTTTTCTTTAGGATTTTACTTGATGATATTTCGCCAAACCTTTCCATGA TAGCAAGTTGAAAATTATGATAGTATGCACTAATTTCATTATTTTGCTCG ATTATTTTTTAGTATGGAGGTGACCTCACTCGAAAACGAAAATTGTTGGA TCGCCAGAAAGAAGGGAAAAAACGGATGAAAAAGTTCGGCAAAGTTGAAG TACCCCATGAAGTTTTCTTGTCTTTATTGCAACGGTGAAAGAATTTGGAG TTGAATGGATATTTTCAAAAGTGACAGAAAAGTGATCCCAAGTactcaaa aacaagaaaatatgcTTCCATGTTTATACGTGAGACAACATGGAAAACaa acttgaaattcaattttcgaATTTTAGCTACTGTATCTTTACCTTACAGA GAACTTATTTTAGCACATTTGCTGCTCACCGACATCATTTCCGccaactt taatttttttcctctGAAAAACTTGTTTGCTTGGTCGAAACTGTAGAAAA GCTCGAAATGGACATATTTTACCAATTTACTGGGTGTTTTACTCGTTAAA GTTGGGATATGATAATTATTATATGCaacaaacacccctgtctcggtgAC CCGTCGGGAATCTTTTAGCCAGCtgggatgaaatattttatttttatttt tacagtttGAAAATTCGATGTGATGTTCTCAAAGTTTTAATGCATAATTC AGAATTGG

Coding sequence (CDS) from alignment at sc0000012:1049367..1095674+

>TCONS_00001861 ID=TCONS_00001861|Name=TCONS_00001861|organism=Clytia hemisphaerica|type=CDS|length=40131bp|location=Sequence derived from alignment at sc0000012:1049367..1095674+ (Clytia hemisphaerica)
ATGTTATTACGAAAGAAAAATTCGCTAAGaaatttctatcaacaattccA
AATAAGTTTTCAACGGCATTACTGCAAGAATGTAGCATTGCCATTGCATA
ATTATCTAGATGAACAAATTCGTAATTTTTGTATCATTGCTCATGTTGAC
CATGGTAAAAGTACTTTAGCGGATCGTCTTTTGGAAGTAACAGGCACAAT
TCAAAAAGATGCAAAAAACAAGCAAGTTCTTGATAAACTTCAAGTGGAGA
GAGAACGTGGCATAACAGTCAAAGCACAAACCTCATCAATGTTCTACAAA
GCtaacaatcaaaagacttttctATACAATCTTATTGACACGCCAggtCA
TGTAGATTTTAGTTATGAAGTATCAAGGTCATTAGCAGCATGTCAAGGAG
CATTGTTGGTTGTTGACGCAGCACAGGGTGTTCAAGCTCAAACCGTAGCA
AATTTTTACGGTGCTTTAGACGCTGGTTTGACCATACTCCCAGTTGTCAA
CAAGATCGATTTGGCATCAGCAGACGTTGAAAGTTGTGTCAAACAGCTGG
AAAGTGTTTTTGACTTTGCACGAGATGAAATACAATTGGTTTCAGCCAAG
GAAGGCATTGGAATTGACAAACTACTCGAAGCTGTTCACACAATTATACC
ATCACCAATTGTTGAAATGAATCAAGATGTCTCATTATTACTGTTCGATT
CATGGTTTGACAAATACCGTGGTGTCGTGTGCCTAATGGCTGTCAAACAT
GGACAATTAAATGTTGGTGATAAGTTACAATCTCATTTCACGAAAGAATC
ATATGACGTCATTGAGATGGGAATCTTACACCCGGATGAAGTTCCGGTAG
ACACATTatacGCAGGTCAAGCCGGCTATGTTGTCCTCGGGATAAGAGAC
GTGAAAAAGGCTATACTTGGAGACATTTATCATAAATATGGCAGCAATAT
TGATGAAGCAGTGTCTGAAAGATATACCTTCAAACAACCCACGCCAATGG
TATTTGCAGGTGCTTTCCCATCCGATCAAAGTGTGTATGAGAACATGAAA
AAATCCATACAAAAATTAACCCTAAACGATGCAAGTGTAACTGTTCATCC
TGATAGCAGTGCAGCTCTTGGTCAAGGTTGGCGTTTGGGATTCTTGGGAT
TACTTCACATGGatgttttcaagcaaagattagCTCAGGAATATGACACA
GATGTGATAATGACAACACCAAATGTCCCTTATCAAGCTGTACTAAAAGG
GAATGAAGATGAGAAGATCACCATAAGAAGTCCTGAAGATTTTCCAGAAG
CGATCCAGACAGTAGCTTTGTACGAACCAATGATCACTGGCACTCTCATC
TTCCCTGAACAGtatttggggaaaatcatcacACTTTGTGAACAAAAGCG
AGGCGTTCAACTAAACATTACTTATATTGATGACACTCGAATCATGATGA
AATACAAACTGCCTCTCAATGAAGTCGTTGTAgacttctttgataaactg
aagTCTATATCTTCAGGATACGCAAGTTTTGATTACGAAGAGAGTGGGTT
TGAAGAGACCAACATCGAAAAGATGGAGATTTTATTAAATGGAAAGTCAA
TAGATGCACTGAGTACTATTGTCCATCGCTCAAAAGTACGAGAGCTTGGG
AAAAGTTATTGCTTTAAACTAAAGAACACTATACCAAGACAATTATTCGA
AGTGGTCATACAAGCTTCAGTCCGAAACAAAGTGATTGCTCGTGATGTGG
TCAAGCCTGTACGCAAAGATGTTACTGCGAAATGTTATGGAGGTGACCTC
ACTCGAAAACGAAAATTGTTGGATCGCCAGAAAGAAGGGAAAAAACGGAT
GAAAAAGTTCGGCAAAGTTGAAGTACCCCATGAAGTTTTCTTGTCTTTAT
TGCAACGGTGAATGTTATTACGAAAGAAAAATTCGCTAAGaaatttctat
caacaattccAAATAAGTTTTCAACGGCATTACTGCAAGAATGTAGCATT
GCCATTGCATAATTATCTAGATGAACAAATTCGTAATTTTTGTATCATTG
CTCATGTTGACCATGGTAAAAGTACTTTAGCGGATCGTCTTTTGGAAGTA
ACAGGCACAATTCAAAAAGATGCAAAAAACAAGCAAGTTCTTGATAAACT
TCAAGTGGAGAGAGAACGTGGCATAACAGTCAAAGCACAAACCTCATCAA
TGTTCTACAAAGCtaacaatcaaaagacttttctATACAATCTTATTGAC
ACGCCAggtCATGTAGATTTTAGTTATGAAGTATCAAGGTCATTAGCAGC
ATGTCAAGGAGCATTGTTGGTTGTTGACGCAGCACAGGGTGTTCAAGCTC
AAACCGTAGCAAATTTTTACGGTGCTTTAGACGCTGGTTTGACCATACTC
CCAGTTGTCAACAAGATCGATTTGGCATCAGCAGACGTTGAAAGTTGTGT
CAAACAGCTGGAAAGTGTTTTTGACTTTGCACGAGATGAAATACAATTGG
TTTCAGCCAAGGAAGGCATTGGAATTGACAAACTACTCGAAGCTGTTCAC
ACAATTATACCATCACCAATTGTTGAAATGAATCAAGATGTCTCATTATT
ACTGTTCGATTCATGGTTTGACAAATACCGTGGTGTCGTGTGCCTAATGG
CTGTCAAACATGGACAATTAAATGTTGGTGATAAGTTACAATCTCATTTC
ACGAAAGAATCATATGACGTCATTGAGATGGGAATCTTACACCCGGATGA
AGTTCCGGTAGACACATTatacGCAGGTCAAGCCGGCTATGTTGTCCTCG
GGATAAGAGACGTGAAAAAGGCTATACTTGGAGACATTTATCATAAATAT
GGCAGCAATATTGATGAAGCAGTGTCTGAAAGATATACCTTCAAACAACC
CACGCCAATGGTATTTGCAGGTGCTTTCCCATCCGATCAAAGTGTGTATG
AGAACATGAAAAAATCCATACAAAAATTAACCCTAAACGATGCAAGTGTA
ACTGTTCATCCTGATAGCAGTGCAGCTCTTGGTCAAGGTTGGCGTTTGGG
ATTCTTGGGATTACTTCACATGGatgttttcaagcaaagattagCTCAGG
AATATGACACAGATGTGATAATGACAACACCAAATGTCCCTTATCAAGCT
GTACTAAAAGGGAATGAAGATGAGAAGATCACCATAAGAAGTCCTGAAGA
TTTTCCAGAAGCGATCCAGACAGTAGCTTTGTACGAACCAATGATCACTG
GCACTCTCATCTTCCCTGAACAGtatttggggaaaatcatcacACTTTGT
GAACAAAAGCGAGGCGTTCAACTAAACATTACTTATATTGATGACACTCG
AATCATGATGAAATACAAACTGCCTCTCAATGAAGTCGTTGTAgacttct
ttgataaactgaagTCTATATCTTCAGGATACGCAAGTTTTGATTACGAA
GAGAGTGGGTTTGAAGAGACCAACATCGAAAAGATGGAGATTTTATTAAA
TGGAAAGTCAATAGATGCACTGAGTACTATTGTCCATCGCTCAAAAGTAC
GAGAGCTTGGGAAAAGTTATTGCTTTAAACTAAAGAACACTATACCAAGA
CAATTATTCGAAGTGGTCATACAAGCTTCAGTCCGAAACAAAGTGATTGC
TCGTGATGTGGTCAAGCCTGTACGCAAAGATGTTACTGCGAAATGTTATG
GAGGTGACCTCACTCGAAAACGAAAATTGTTGGATCGCCAGAAAGAAGGG
AAAAAACGGATGAAAAAGTTCGGCAAAGTTGAAGTACCCCATGAAGTTTT
CTTGTCTTTATTGCAACGGTGAATGTTATTACGAAAGAAAAATTCGCTAA
GaaatttctatcaacaattccAAATAAGTTTTCAACGGCATTACTGCAAG
AATGTAGCATTGCCATTGCATAATTATCTAGATGAACAAATTCGTAATTT
TTGTATCATTGCTCATGTTGACCATGGTAAAAGTACTTTAGCGGATCGTC
TTTTGGAAGTAACAGGCACAATTCAAAAAGATGCAAAAAACAAGCAAGTT
CTTGATAAACTTCAAGTGGAGAGAGAACGTGGCATAACAGTCAAAGCACA
AACCTCATCAATGTTCTACAAAGCtaacaatcaaaagacttttctATACA
ATCTTATTGACACGCCAggtCATGTAGATTTTAGTTATGAAGTATCAAGG
TCATTAGCAGCATGTCAAGGAGCATTGTTGGTTGTTGACGCAGCACAGGG
TGTTCAAGCTCAAACCGTAGCAAATTTTTACGGTGCTTTAGACGCTGGTT
TGACCATACTCCCAGTTGTCAACAAGATCGATTTGGCATCAGCAGACGTT
GAAAGTTGTGTCAAACAGCTGGAAAGTGTTTTTGACTTTGCACGAGATGA
AATACAATTGGTTTCAGCCAAGGAAGGCATTGGAATTGACAAACTACTCG
AAGCTGTTCACACAATTATACCATCACCAATTGTTGAAATGAATCAAGAT
GTCTCATTATTACTGTTCGATTCATGGTTTGACAAATACCGTGGTGTCGT
GTGCCTAATGGCTGTCAAACATGGACAATTAAATGTTGGTGATAAGTTAC
AATCTCATTTCACGAAAGAATCATATGACGTCATTGAGATGGGAATCTTA
CACCCGGATGAAGTTCCGGTAGACACATTatacGCAGGTCAAGCCGGCTA
TGTTGTCCTCGGGATAAGAGACGTGAAAAAGGCTATACTTGGAGACATTT
ATCATAAATATGGCAGCAATATTGATGAAGCAGTGTCTGAAAGATATACC
TTCAAACAACCCACGCCAATGGTATTTGCAGGTGCTTTCCCATCCGATCA
AAGTGTGTATGAGAACATGAAAAAATCCATACAAAAATTAACCCTAAACG
ATGCAAGTGTAACTGTTCATCCTGATAGCAGTGCAGCTCTTGGTCAAGGT
TGGCGTTTGGGATTCTTGGGATTACTTCACATGGatgttttcaagcaaag
attagCTCAGGAATATGACACAGATGTGATAATGACAACACCAAATGTCC
CTTATCAAGCTGTACTAAAAGGGAATGAAGATGAGAAGATCACCATAAGA
AGTCCTGAAGATTTTCCAGAAGCGATCCAGACAGTAGCTTTGTACGAACC
AATGATCACTGGCACTCTCATCTTCCCTGAACAGtatttggggaaaatca
tcacACTTTGTGAACAAAAGCGAGGCGTTCAACTAAACATTACTTATATT
GATGACACTCGAATCATGATGAAATACAAACTGCCTCTCAATGAAGTCGT
TGTAgacttctttgataaactgaagTCTATATCTTCAGGATACGCAAGTT
TTGATTACGAAGAGAGTGGGTTTGAAGAGACCAACATCGAAAAGATGGAG
ATTTTATTAAATGGAAAGTCAATAGATGCACTGAGTACTATTGTCCATCG
CTCAAAAGTACGAGAGCTTGGGAAAAGTTATTGCTTTAAACTAAAGAACA
CTATACCAAGACAATTATTCGAAGTGGTCATACAAGCTTCAGTCCGAAAC
AAAGTGATTGCTCGTGATGTGGTCAAGCCTGTACGCAAAGATGTTACTGC
GAAATGTTATGGAGGTGACCTCACTCGAAAACGAAAATTGTTGGATCGCC
AGAAAGAAGGGAAAAAACGGATGAAAAAGTTCGGCAAAGTTGAAGTACCC
CATGAAGTTTTCTTGTCTTTATTGCAACGGTGAATGTTATTACGAAAGAA
AAATTCGCTAAGaaatttctatcaacaattccAAATAAGTTTTCAACGGC
ATTACTGCAAGAATGTAGCATTGCCATTGCATAATTATCTAGATGAACAA
ATTCGTAATTTTTGTATCATTGCTCATGTTGACCATGGTAAAAGTACTTT
AGCGGATCGTCTTTTGGAAGTAACAGGCACAATTCAAAAAGATGCAAAAA
ACAAGCAAGTTCTTGATAAACTTCAAGTGGAGAGAGAACGTGGCATAACA
GTCAAAGCACAAACCTCATCAATGTTCTACAAAGCtaacaatcaaaagac
ttttctATACAATCTTATTGACACGCCAggtCATGTAGATTTTAGTTATG
AAGTATCAAGGTCATTAGCAGCATGTCAAGGAGCATTGTTGGTTGTTGAC
GCAGCACAGGGTGTTCAAGCTCAAACCGTAGCAAATTTTTACGGTGCTTT
AGACGCTGGTTTGACCATACTCCCAGTTGTCAACAAGATCGATTTGGCAT
CAGCAGACGTTGAAAGTTGTGTCAAACAGCTGGAAAGTGTTTTTGACTTT
GCACGAGATGAAATACAATTGGTTTCAGCCAAGGAAGGCATTGGAATTGA
CAAACTACTCGAAGCTGTTCACACAATTATACCATCACCAATTGTTGAAA
TGAATCAAGATGTCTCATTATTACTGTTCGATTCATGGTTTGACAAATAC
CGTGGTGTCGTGTGCCTAATGGCTGTCAAACATGGACAATTAAATGTTGG
TGATAAGTTACAATCTCATTTCACGAAAGAATCATATGACGTCATTGAGA
TGGGAATCTTACACCCGGATGAAGTTCCGGTAGACACATTatacGCAGGT
CAAGCCGGCTATGTTGTCCTCGGGATAAGAGACGTGAAAAAGGCTATACT
TGGAGACATTTATCATAAATATGGCAGCAATATTGATGAAGCAGTGTCTG
AAAGATATACCTTCAAACAACCCACGCCAATGGTATTTGCAGGTGCTTTC
CCATCCGATCAAAGTGTGTATGAGAACATGAAAAAATCCATACAAAAATT
AACCCTAAACGATGCAAGTGTAACTGTTCATCCTGATAGCAGTGCAGCTC
TTGGTCAAGGTTGGCGTTTGGGATTCTTGGGATTACTTCACATGGatgtt
ttcaagcaaagattagCTCAGGAATATGACACAGATGTGATAATGACAAC
ACCAAATGTCCCTTATCAAGCTGTACTAAAAGGGAATGAAGATGAGAAGA
TCACCATAAGAAGTCCTGAAGATTTTCCAGAAGCGATCCAGACAGTAGCT
TTGTACGAACCAATGATCACTGGCACTCTCATCTTCCCTGAACAGtattt
ggggaaaatcatcacACTTTGTGAACAAAAGCGAGGCGTTCAACTAAACA
TTACTTATATTGATGACACTCGAATCATGATGAAATACAAACTGCCTCTC
AATGAAGTCGTTGTAgacttctttgataaactgaagTCTATATCTTCAGG
ATACGCAAGTTTTGATTACGAAGAGAGTGGGTTTGAAGAGACCAACATCG
AAAAGATGGAGATTTTATTAAATGGAAAGTCAATAGATGCACTGAGTACT
ATTGTCCATCGCTCAAAAGTACGAGAGCTTGGGAAAAGTTATTGCTTTAA
ACTAAAGAACACTATACCAAGACAATTATTCGAAGTGGTCATACAAGCTT
CAGTCCGAAACAAAGTGATTGCTCGTGATGTGGTCAAGCCTGTACGCAAA
GATGTTACTGCGAAATGTTATGGAGGTGACCTCACTCGAAAACGAAAATT
GTTGGATCGCCAGAAAGAAGGGAAAAAACGGATGAAAAAGTTCGGCAAAG
TTGAAGTACCCCATGAAGTTTTCTTGTCTTTATTGCAACGGTGAATGTTA
TTACGAAAGAAAAATTCGCTAAGaaatttctatcaacaattccAAATAAG
TTTTCAACGGCATTACTGCAAGAATGTAGCATTGCCATTGCATAATTATC
TAGATGAACAAATTCGTAATTTTTGTATCATTGCTCATGTTGACCATGGT
AAAAGTACTTTAGCGGATCGTCTTTTGGAAGTAACAGGCACAATTCAAAA
AGATGCAAAAAACAAGCAAGTTCTTGATAAACTTCAAGTGGAGAGAGAAC
GTGGCATAACAGTCAAAGCACAAACCTCATCAATGTTCTACAAAGCtaac
aatcaaaagacttttctATACAATCTTATTGACACGCCAggtCATGTAGA
TTTTAGTTATGAAGTATCAAGGTCATTAGCAGCATGTCAAGGAGCATTGT
TGGTTGTTGACGCAGCACAGGGTGTTCAAGCTCAAACCGTAGCAAATTTT
TACGGTGCTTTAGACGCTGGTTTGACCATACTCCCAGTTGTCAACAAGAT
CGATTTGGCATCAGCAGACGTTGAAAGTTGTGTCAAACAGCTGGAAAGTG
TTTTTGACTTTGCACGAGATGAAATACAATTGGTTTCAGCCAAGGAAGGC
ATTGGAATTGACAAACTACTCGAAGCTGTTCACACAATTATACCATCACC
AATTGTTGAAATGAATCAAGATGTCTCATTATTACTGTTCGATTCATGGT
TTGACAAATACCGTGGTGTCGTGTGCCTAATGGCTGTCAAACATGGACAA
TTAAATGTTGGTGATAAGTTACAATCTCATTTCACGAAAGAATCATATGA
CGTCATTGAGATGGGAATCTTACACCCGGATGAAGTTCCGGTAGACACAT
TatacGCAGGTCAAGCCGGCTATGTTGTCCTCGGGATAAGAGACGTGAAA
AAGGCTATACTTGGAGACATTTATCATAAATATGGCAGCAATATTGATGA
AGCAGTGTCTGAAAGATATACCTTCAAACAACCCACGCCAATGGTATTTG
CAGGTGCTTTCCCATCCGATCAAAGTGTGTATGAGAACATGAAAAAATCC
ATACAAAAATTAACCCTAAACGATGCAAGTGTAACTGTTCATCCTGATAG
CAGTGCAGCTCTTGGTCAAGGTTGGCGTTTGGGATTCTTGGGATTACTTC
ACATGGatgttttcaagcaaagattagCTCAGGAATATGACACAGATGTG
ATAATGACAACACCAAATGTCCCTTATCAAGCTGTACTAAAAGGGAATGA
AGATGAGAAGATCACCATAAGAAGTCCTGAAGATTTTCCAGAAGCGATCC
AGACAGTAGCTTTGTACGAACCAATGATCACTGGCACTCTCATCTTCCCT
GAACAGtatttggggaaaatcatcacACTTTGTGAACAAAAGCGAGGCGT
TCAACTAAACATTACTTATATTGATGACACTCGAATCATGATGAAATACA
AACTGCCTCTCAATGAAGTCGTTGTAgacttctttgataaactgaagTCT
ATATCTTCAGGATACGCAAGTTTTGATTACGAAGAGAGTGGGTTTGAAGA
GACCAACATCGAAAAGATGGAGATTTTATTAAATGGAAAGTCAATAGATG
CACTGAGTACTATTGTCCATCGCTCAAAAGTACGAGAGCTTGGGAAAAGT
TATTGCTTTAAACTAAAGAACACTATACCAAGACAATTATTCGAAGTGGT
CATACAAGCTTCAGTCCGAAACAAAGTGATTGCTCGTGATGTGGTCAAGC
CTGTACGCAAAGATGTTACTGCGAAATGTTATGGAGGTGACCTCACTCGA
AAACGAAAATTGTTGGATCGCCAGAAAGAAGGGAAAAAACGGATGAAAAA
GTTCGGCAAAGTTGAAGTACCCCATGAAGTTTTCTTGTCTTTATTGCAAC
GGTGAATGTTATTACGAAAGAAAAATTCGCTAAGaaatttctatcaacaa
ttccAAATAAGTTTTCAACGGCATTACTGCAAGAATGTAGCATTGCCATT
GCATAATTATCTAGATGAACAAATTCGTAATTTTTGTATCATTGCTCATG
TTGACCATGGTAAAAGTACTTTAGCGGATCGTCTTTTGGAAGTAACAGGC
ACAATTCAAAAAGATGCAAAAAACAAGCAAGTTCTTGATAAACTTCAAGT
GGAGAGAGAACGTGGCATAACAGTCAAAGCACAAACCTCATCAATGTTCT
ACAAAGCtaacaatcaaaagacttttctATACAATCTTATTGACACGCCA
ggtCATGTAGATTTTAGTTATGAAGTATCAAGGTCATTAGCAGCATGTCA
AGGAGCATTGTTGGTTGTTGACGCAGCACAGGGTGTTCAAGCTCAAACCG
TAGCAAATTTTTACGGTGCTTTAGACGCTGGTTTGACCATACTCCCAGTT
GTCAACAAGATCGATTTGGCATCAGCAGACGTTGAAAGTTGTGTCAAACA
GCTGGAAAGTGTTTTTGACTTTGCACGAGATGAAATACAATTGGTTTCAG
CCAAGGAAGGCATTGGAATTGACAAACTACTCGAAGCTGTTCACACAATT
ATACCATCACCAATTGTTGAAATGAATCAAGATGTCTCATTATTACTGTT
CGATTCATGGTTTGACAAATACCGTGGTGTCGTGTGCCTAATGGCTGTCA
AACATGGACAATTAAATGTTGGTGATAAGTTACAATCTCATTTCACGAAA
GAATCATATGACGTCATTGAGATGGGAATCTTACACCCGGATGAAGTTCC
GGTAGACACATTatacGCAGGTCAAGCCGGCTATGTTGTCCTCGGGATAA
GAGACGTGAAAAAGGCTATACTTGGAGACATTTATCATAAATATGGCAGC
AATATTGATGAAGCAGTGTCTGAAAGATATACCTTCAAACAACCCACGCC
AATGGTATTTGCAGGTGCTTTCCCATCCGATCAAAGTGTGTATGAGAACA
TGAAAAAATCCATACAAAAATTAACCCTAAACGATGCAAGTGTAACTGTT
CATCCTGATAGCAGTGCAGCTCTTGGTCAAGGTTGGCGTTTGGGATTCTT
GGGATTACTTCACATGGatgttttcaagcaaagattagCTCAGGAATATG
ACACAGATGTGATAATGACAACACCAAATGTCCCTTATCAAGCTGTACTA
AAAGGGAATGAAGATGAGAAGATCACCATAAGAAGTCCTGAAGATTTTCC
AGAAGCGATCCAGACAGTAGCTTTGTACGAACCAATGATCACTGGCACTC
TCATCTTCCCTGAACAGtatttggggaaaatcatcacACTTTGTGAACAA
AAGCGAGGCGTTCAACTAAACATTACTTATATTGATGACACTCGAATCAT
GATGAAATACAAACTGCCTCTCAATGAAGTCGTTGTAgacttctttgata
aactgaagTCTATATCTTCAGGATACGCAAGTTTTGATTACGAAGAGAGT
GGGTTTGAAGAGACCAACATCGAAAAGATGGAGATTTTATTAAATGGAAA
GTCAATAGATGCACTGAGTACTATTGTCCATCGCTCAAAAGTACGAGAGC
TTGGGAAAAGTTATTGCTTTAAACTAAAGAACACTATACCAAGACAATTA
TTCGAAGTGGTCATACAAGCTTCAGTCCGAAACAAAGTGATTGCTCGTGA
TGTGGTCAAGCCTGTACGCAAAGATGTTACTGCGAAATGTTATGGAGGTG
ACCTCACTCGAAAACGAAAATTGTTGGATCGCCAGAAAGAAGGGAAAAAA
CGGATGAAAAAGTTCGGCAAAGTTGAAGTACCCCATGAAGTTTTCTTGTC
TTTATTGCAACGGTGAATGTTATTACGAAAGAAAAATTCGCTAAGaaatt
tctatcaacaattccAAATAAGTTTTCAACGGCATTACTGCAAGAATGTA
GCATTGCCATTGCATAATTATCTAGATGAACAAATTCGTAATTTTTGTAT
CATTGCTCATGTTGACCATGGTAAAAGTACTTTAGCGGATCGTCTTTTGG
AAGTAACAGGCACAATTCAAAAAGATGCAAAAAACAAGCAAGTTCTTGAT
AAACTTCAAGTGGAGAGAGAACGTGGCATAACAGTCAAAGCACAAACCTC
ATCAATGTTCTACAAAGCtaacaatcaaaagacttttctATACAATCTTA
TTGACACGCCAggtCATGTAGATTTTAGTTATGAAGTATCAAGGTCATTA
GCAGCATGTCAAGGAGCATTGTTGGTTGTTGACGCAGCACAGGGTGTTCA
AGCTCAAACCGTAGCAAATTTTTACGGTGCTTTAGACGCTGGTTTGACCA
TACTCCCAGTTGTCAACAAGATCGATTTGGCATCAGCAGACGTTGAAAGT
TGTGTCAAACAGCTGGAAAGTGTTTTTGACTTTGCACGAGATGAAATACA
ATTGGTTTCAGCCAAGGAAGGCATTGGAATTGACAAACTACTCGAAGCTG
TTCACACAATTATACCATCACCAATTGTTGAAATGAATCAAGATGTCTCA
TTATTACTGTTCGATTCATGGTTTGACAAATACCGTGGTGTCGTGTGCCT
AATGGCTGTCAAACATGGACAATTAAATGTTGGTGATAAGTTACAATCTC
ATTTCACGAAAGAATCATATGACGTCATTGAGATGGGAATCTTACACCCG
GATGAAGTTCCGGTAGACACATTatacGCAGGTCAAGCCGGCTATGTTGT
CCTCGGGATAAGAGACGTGAAAAAGGCTATACTTGGAGACATTTATCATA
AATATGGCAGCAATATTGATGAAGCAGTGTCTGAAAGATATACCTTCAAA
CAACCCACGCCAATGGTATTTGCAGGTGCTTTCCCATCCGATCAAAGTGT
GTATGAGAACATGAAAAAATCCATACAAAAATTAACCCTAAACGATGCAA
GTGTAACTGTTCATCCTGATAGCAGTGCAGCTCTTGGTCAAGGTTGGCGT
TTGGGATTCTTGGGATTACTTCACATGGatgttttcaagcaaagattagC
TCAGGAATATGACACAGATGTGATAATGACAACACCAAATGTCCCTTATC
AAGCTGTACTAAAAGGGAATGAAGATGAGAAGATCACCATAAGAAGTCCT
GAAGATTTTCCAGAAGCGATCCAGACAGTAGCTTTGTACGAACCAATGAT
CACTGGCACTCTCATCTTCCCTGAACAGtatttggggaaaatcatcacAC
TTTGTGAACAAAAGCGAGGCGTTCAACTAAACATTACTTATATTGATGAC
ACTCGAATCATGATGAAATACAAACTGCCTCTCAATGAAGTCGTTGTAga
cttctttgataaactgaagTCTATATCTTCAGGATACGCAAGTTTTGATT
ACGAAGAGAGTGGGTTTGAAGAGACCAACATCGAAAAGATGGAGATTTTA
TTAAATGGAAAGTCAATAGATGCACTGAGTACTATTGTCCATCGCTCAAA
AGTACGAGAGCTTGGGAAAAGTTATTGCTTTAAACTAAAGAACACTATAC
CAAGACAATTATTCGAAGTGGTCATACAAGCTTCAGTCCGAAACAAAGTG
ATTGCTCGTGATGTGGTCAAGCCTGTACGCAAAGATGTTACTGCGAAATG
TTATGGAGGTGACCTCACTCGAAAACGAAAATTGTTGGATCGCCAGAAAG
AAGGGAAAAAACGGATGAAAAAGTTCGGCAAAGTTGAAGTACCCCATGAA
GTTTTCTTGTCTTTATTGCAACGGTGAATGTTATTACGAAAGAAAAATTC
GCTAAGaaatttctatcaacaattccAAATAAGTTTTCAACGGCATTACT
GCAAGAATGTAGCATTGCCATTGCATAATTATCTAGATGAACAAATTCGT
AATTTTTGTATCATTGCTCATGTTGACCATGGTAAAAGTACTTTAGCGGA
TCGTCTTTTGGAAGTAACAGGCACAATTCAAAAAGATGCAAAAAACAAGC
AAGTTCTTGATAAACTTCAAGTGGAGAGAGAACGTGGCATAACAGTCAAA
GCACAAACCTCATCAATGTTCTACAAAGCtaacaatcaaaagacttttct
ATACAATCTTATTGACACGCCAggtCATGTAGATTTTAGTTATGAAGTAT
CAAGGTCATTAGCAGCATGTCAAGGAGCATTGTTGGTTGTTGACGCAGCA
CAGGGTGTTCAAGCTCAAACCGTAGCAAATTTTTACGGTGCTTTAGACGC
TGGTTTGACCATACTCCCAGTTGTCAACAAGATCGATTTGGCATCAGCAG
ACGTTGAAAGTTGTGTCAAACAGCTGGAAAGTGTTTTTGACTTTGCACGA
GATGAAATACAATTGGTTTCAGCCAAGGAAGGCATTGGAATTGACAAACT
ACTCGAAGCTGTTCACACAATTATACCATCACCAATTGTTGAAATGAATC
AAGATGTCTCATTATTACTGTTCGATTCATGGTTTGACAAATACCGTGGT
GTCGTGTGCCTAATGGCTGTCAAACATGGACAATTAAATGTTGGTGATAA
GTTACAATCTCATTTCACGAAAGAATCATATGACGTCATTGAGATGGGAA
TCTTACACCCGGATGAAGTTCCGGTAGACACATTatacGCAGGTCAAGCC
GGCTATGTTGTCCTCGGGATAAGAGACGTGAAAAAGGCTATACTTGGAGA
CATTTATCATAAATATGGCAGCAATATTGATGAAGCAGTGTCTGAAAGAT
ATACCTTCAAACAACCCACGCCAATGGTATTTGCAGGTGCTTTCCCATCC
GATCAAAGTGTGTATGAGAACATGAAAAAATCCATACAAAAATTAACCCT
AAACGATGCAAGTGTAACTGTTCATCCTGATAGCAGTGCAGCTCTTGGTC
AAGGTTGGCGTTTGGGATTCTTGGGATTACTTCACATGGatgttttcaag
caaagattagCTCAGGAATATGACACAGATGTGATAATGACAACACCAAA
TGTCCCTTATCAAGCTGTACTAAAAGGGAATGAAGATGAGAAGATCACCA
TAAGAAGTCCTGAAGATTTTCCAGAAGCGATCCAGACAGTAGCTTTGTAC
GAACCAATGATCACTGGCACTCTCATCTTCCCTGAACAGtatttggggaa
aatcatcacACTTTGTGAACAAAAGCGAGGCGTTCAACTAAACATTACTT
ATATTGATGACACTCGAATCATGATGAAATACAAACTGCCTCTCAATGAA
GTCGTTGTAgacttctttgataaactgaagTCTATATCTTCAGGATACGC
AAGTTTTGATTACGAAGAGAGTGGGTTTGAAGAGACCAACATCGAAAAGA
TGGAGATTTTATTAAATGGAAAGTCAATAGATGCACTGAGTACTATTGTC
CATCGCTCAAAAGTACGAGAGCTTGGGAAAAGTTATTGCTTTAAACTAAA
GAACACTATACCAAGACAATTATTCGAAGTGGTCATACAAGCTTCAGTCC
GAAACAAAGTGATTGCTCGTGATGTGGTCAAGCCTGTACGCAAAGATGTT
ACTGCGAAATGTTATGGAGGTGACCTCACTCGAAAACGAAAATTGTTGGA
TCGCCAGAAAGAAGGGAAAAAACGGATGAAAAAGTTCGGCAAAGTTGAAG
TACCCCATGAAGTTTTCTTGTCTTTATTGCAACGGTGAATGTTATTACGA
AAGAAAAATTCGCTAAGaaatttctatcaacaattccAAATAAGTTTTCA
ACGGCATTACTGCAAGAATGTAGCATTGCCATTGCATAATTATCTAGATG
AACAAATTCGTAATTTTTGTATCATTGCTCATGTTGACCATGGTAAAAGT
ACTTTAGCGGATCGTCTTTTGGAAGTAACAGGCACAATTCAAAAAGATGC
AAAAAACAAGCAAGTTCTTGATAAACTTCAAGTGGAGAGAGAACGTGGCA
TAACAGTCAAAGCACAAACCTCATCAATGTTCTACAAAGCtaacaatcaa
aagacttttctATACAATCTTATTGACACGCCAggtCATGTAGATTTTAG
TTATGAAGTATCAAGGTCATTAGCAGCATGTCAAGGAGCATTGTTGGTTG
TTGACGCAGCACAGGGTGTTCAAGCTCAAACCGTAGCAAATTTTTACGGT
GCTTTAGACGCTGGTTTGACCATACTCCCAGTTGTCAACAAGATCGATTT
GGCATCAGCAGACGTTGAAAGTTGTGTCAAACAGCTGGAAAGTGTTTTTG
ACTTTGCACGAGATGAAATACAATTGGTTTCAGCCAAGGAAGGCATTGGA
ATTGACAAACTACTCGAAGCTGTTCACACAATTATACCATCACCAATTGT
TGAAATGAATCAAGATGTCTCATTATTACTGTTCGATTCATGGTTTGACA
AATACCGTGGTGTCGTGTGCCTAATGGCTGTCAAACATGGACAATTAAAT
GTTGGTGATAAGTTACAATCTCATTTCACGAAAGAATCATATGACGTCAT
TGAGATGGGAATCTTACACCCGGATGAAGTTCCGGTAGACACATTatacG
CAGGTCAAGCCGGCTATGTTGTCCTCGGGATAAGAGACGTGAAAAAGGCT
ATACTTGGAGACATTTATCATAAATATGGCAGCAATATTGATGAAGCAGT
GTCTGAAAGATATACCTTCAAACAACCCACGCCAATGGTATTTGCAGGTG
CTTTCCCATCCGATCAAAGTGTGTATGAGAACATGAAAAAATCCATACAA
AAATTAACCCTAAACGATGCAAGTGTAACTGTTCATCCTGATAGCAGTGC
AGCTCTTGGTCAAGGTTGGCGTTTGGGATTCTTGGGATTACTTCACATGG
atgttttcaagcaaagattagCTCAGGAATATGACACAGATGTGATAATG
ACAACACCAAATGTCCCTTATCAAGCTGTACTAAAAGGGAATGAAGATGA
GAAGATCACCATAAGAAGTCCTGAAGATTTTCCAGAAGCGATCCAGACAG
TAGCTTTGTACGAACCAATGATCACTGGCACTCTCATCTTCCCTGAACAG
tatttggggaaaatcatcacACTTTGTGAACAAAAGCGAGGCGTTCAACT
AAACATTACTTATATTGATGACACTCGAATCATGATGAAATACAAACTGC
CTCTCAATGAAGTCGTTGTAgacttctttgataaactgaagTCTATATCT
TCAGGATACGCAAGTTTTGATTACGAAGAGAGTGGGTTTGAAGAGACCAA
CATCGAAAAGATGGAGATTTTATTAAATGGAAAGTCAATAGATGCACTGA
GTACTATTGTCCATCGCTCAAAAGTACGAGAGCTTGGGAAAAGTTATTGC
TTTAAACTAAAGAACACTATACCAAGACAATTATTCGAAGTGGTCATACA
AGCTTCAGTCCGAAACAAAGTGATTGCTCGTGATGTGGTCAAGCCTGTAC
GCAAAGATGTTACTGCGAAATGTTATGGAGGTGACCTCACTCGAAAACGA
AAATTGTTGGATCGCCAGAAAGAAGGGAAAAAACGGATGAAAAAGTTCGG
CAAAGTTGAAGTACCCCATGAAGTTTTCTTGTCTTTATTGCAACGGTGAA
TGTTATTACGAAAGAAAAATTCGCTAAGaaatttctatcaacaattccAA
ATAAGTTTTCAACGGCATTACTGCAAGAATGTAGCATTGCCATTGCATAA
TTATCTAGATGAACAAATTCGTAATTTTTGTATCATTGCTCATGTTGACC
ATGGTAAAAGTACTTTAGCGGATCGTCTTTTGGAAGTAACAGGCACAATT
CAAAAAGATGCAAAAAACAAGCAAGTTCTTGATAAACTTCAAGTGGAGAG
AGAACGTGGCATAACAGTCAAAGCACAAACCTCATCAATGTTCTACAAAG
CtaacaatcaaaagacttttctATACAATCTTATTGACACGCCAggtCAT
GTAGATTTTAGTTATGAAGTATCAAGGTCATTAGCAGCATGTCAAGGAGC
ATTGTTGGTTGTTGACGCAGCACAGGGTGTTCAAGCTCAAACCGTAGCAA
ATTTTTACGGTGCTTTAGACGCTGGTTTGACCATACTCCCAGTTGTCAAC
AAGATCGATTTGGCATCAGCAGACGTTGAAAGTTGTGTCAAACAGCTGGA
AAGTGTTTTTGACTTTGCACGAGATGAAATACAATTGGTTTCAGCCAAGG
AAGGCATTGGAATTGACAAACTACTCGAAGCTGTTCACACAATTATACCA
TCACCAATTGTTGAAATGAATCAAGATGTCTCATTATTACTGTTCGATTC
ATGGTTTGACAAATACCGTGGTGTCGTGTGCCTAATGGCTGTCAAACATG
GACAATTAAATGTTGGTGATAAGTTACAATCTCATTTCACGAAAGAATCA
TATGACGTCATTGAGATGGGAATCTTACACCCGGATGAAGTTCCGGTAGA
CACATTatacGCAGGTCAAGCCGGCTATGTTGTCCTCGGGATAAGAGACG
TGAAAAAGGCTATACTTGGAGACATTTATCATAAATATGGCAGCAATATT
GATGAAGCAGTGTCTGAAAGATATACCTTCAAACAACCCACGCCAATGGT
ATTTGCAGGTGCTTTCCCATCCGATCAAAGTGTGTATGAGAACATGAAAA
AATCCATACAAAAATTAACCCTAAACGATGCAAGTGTAACTGTTCATCCT
GATAGCAGTGCAGCTCTTGGTCAAGGTTGGCGTTTGGGATTCTTGGGATT
ACTTCACATGGatgttttcaagcaaagattagCTCAGGAATATGACACAG
ATGTGATAATGACAACACCAAATGTCCCTTATCAAGCTGTACTAAAAGGG
AATGAAGATGAGAAGATCACCATAAGAAGTCCTGAAGATTTTCCAGAAGC
GATCCAGACAGTAGCTTTGTACGAACCAATGATCACTGGCACTCTCATCT
TCCCTGAACAGtatttggggaaaatcatcacACTTTGTGAACAAAAGCGA
GGCGTTCAACTAAACATTACTTATATTGATGACACTCGAATCATGATGAA
ATACAAACTGCCTCTCAATGAAGTCGTTGTAgacttctttgataaactga
agTCTATATCTTCAGGATACGCAAGTTTTGATTACGAAGAGAGTGGGTTT
GAAGAGACCAACATCGAAAAGATGGAGATTTTATTAAATGGAAAGTCAAT
AGATGCACTGAGTACTATTGTCCATCGCTCAAAAGTACGAGAGCTTGGGA
AAAGTTATTGCTTTAAACTAAAGAACACTATACCAAGACAATTATTCGAA
GTGGTCATACAAGCTTCAGTCCGAAACAAAGTGATTGCTCGTGATGTGGT
CAAGCCTGTACGCAAAGATGTTACTGCGAAATGTTATGGAGGTGACCTCA
CTCGAAAACGAAAATTGTTGGATCGCCAGAAAGAAGGGAAAAAACGGATG
AAAAAGTTCGGCAAAGTTGAAGTACCCCATGAAGTTTTCTTGTCTTTATT
GCAACGGTGAATGTTATTACGAAAGAAAAATTCGCTAAGaaatttctatc
aacaattccAAATAAGTTTTCAACGGCATTACTGCAAGAATGTAGCATTG
CCATTGCATAATTATCTAGATGAACAAATTCGTAATTTTTGTATCATTGC
TCATGTTGACCATGGTAAAAGTACTTTAGCGGATCGTCTTTTGGAAGTAA
CAGGCACAATTCAAAAAGATGCAAAAAACAAGCAAGTTCTTGATAAACTT
CAAGTGGAGAGAGAACGTGGCATAACAGTCAAAGCACAAACCTCATCAAT
GTTCTACAAAGCtaacaatcaaaagacttttctATACAATCTTATTGACA
CGCCAggtCATGTAGATTTTAGTTATGAAGTATCAAGGTCATTAGCAGCA
TGTCAAGGAGCATTGTTGGTTGTTGACGCAGCACAGGGTGTTCAAGCTCA
AACCGTAGCAAATTTTTACGGTGCTTTAGACGCTGGTTTGACCATACTCC
CAGTTGTCAACAAGATCGATTTGGCATCAGCAGACGTTGAAAGTTGTGTC
AAACAGCTGGAAAGTGTTTTTGACTTTGCACGAGATGAAATACAATTGGT
TTCAGCCAAGGAAGGCATTGGAATTGACAAACTACTCGAAGCTGTTCACA
CAATTATACCATCACCAATTGTTGAAATGAATCAAGATGTCTCATTATTA
CTGTTCGATTCATGGTTTGACAAATACCGTGGTGTCGTGTGCCTAATGGC
TGTCAAACATGGACAATTAAATGTTGGTGATAAGTTACAATCTCATTTCA
CGAAAGAATCATATGACGTCATTGAGATGGGAATCTTACACCCGGATGAA
GTTCCGGTAGACACATTatacGCAGGTCAAGCCGGCTATGTTGTCCTCGG
GATAAGAGACGTGAAAAAGGCTATACTTGGAGACATTTATCATAAATATG
GCAGCAATATTGATGAAGCAGTGTCTGAAAGATATACCTTCAAACAACCC
ACGCCAATGGTATTTGCAGGTGCTTTCCCATCCGATCAAAGTGTGTATGA
GAACATGAAAAAATCCATACAAAAATTAACCCTAAACGATGCAAGTGTAA
CTGTTCATCCTGATAGCAGTGCAGCTCTTGGTCAAGGTTGGCGTTTGGGA
TTCTTGGGATTACTTCACATGGatgttttcaagcaaagattagCTCAGGA
ATATGACACAGATGTGATAATGACAACACCAAATGTCCCTTATCAAGCTG
TACTAAAAGGGAATGAAGATGAGAAGATCACCATAAGAAGTCCTGAAGAT
TTTCCAGAAGCGATCCAGACAGTAGCTTTGTACGAACCAATGATCACTGG
CACTCTCATCTTCCCTGAACAGtatttggggaaaatcatcacACTTTGTG
AACAAAAGCGAGGCGTTCAACTAAACATTACTTATATTGATGACACTCGA
ATCATGATGAAATACAAACTGCCTCTCAATGAAGTCGTTGTAgacttctt
tgataaactgaagTCTATATCTTCAGGATACGCAAGTTTTGATTACGAAG
AGAGTGGGTTTGAAGAGACCAACATCGAAAAGATGGAGATTTTATTAAAT
GGAAAGTCAATAGATGCACTGAGTACTATTGTCCATCGCTCAAAAGTACG
AGAGCTTGGGAAAAGTTATTGCTTTAAACTAAAGAACACTATACCAAGAC
AATTATTCGAAGTGGTCATACAAGCTTCAGTCCGAAACAAAGTGATTGCT
CGTGATGTGGTCAAGCCTGTACGCAAAGATGTTACTGCGAAATGTTATGG
AGGTGACCTCACTCGAAAACGAAAATTGTTGGATCGCCAGAAAGAAGGGA
AAAAACGGATGAAAAAGTTCGGCAAAGTTGAAGTACCCCATGAAGTTTTC
TTGTCTTTATTGCAACGGTGAATGTTATTACGAAAGAAAAATTCGCTAAG
aaatttctatcaacaattccAAATAAGTTTTCAACGGCATTACTGCAAGA
ATGTAGCATTGCCATTGCATAATTATCTAGATGAACAAATTCGTAATTTT
TGTATCATTGCTCATGTTGACCATGGTAAAAGTACTTTAGCGGATCGTCT
TTTGGAAGTAACAGGCACAATTCAAAAAGATGCAAAAAACAAGCAAGTTC
TTGATAAACTTCAAGTGGAGAGAGAACGTGGCATAACAGTCAAAGCACAA
ACCTCATCAATGTTCTACAAAGCtaacaatcaaaagacttttctATACAA
TCTTATTGACACGCCAggtCATGTAGATTTTAGTTATGAAGTATCAAGGT
CATTAGCAGCATGTCAAGGAGCATTGTTGGTTGTTGACGCAGCACAGGGT
GTTCAAGCTCAAACCGTAGCAAATTTTTACGGTGCTTTAGACGCTGGTTT
GACCATACTCCCAGTTGTCAACAAGATCGATTTGGCATCAGCAGACGTTG
AAAGTTGTGTCAAACAGCTGGAAAGTGTTTTTGACTTTGCACGAGATGAA
ATACAATTGGTTTCAGCCAAGGAAGGCATTGGAATTGACAAACTACTCGA
AGCTGTTCACACAATTATACCATCACCAATTGTTGAAATGAATCAAGATG
TCTCATTATTACTGTTCGATTCATGGTTTGACAAATACCGTGGTGTCGTG
TGCCTAATGGCTGTCAAACATGGACAATTAAATGTTGGTGATAAGTTACA
ATCTCATTTCACGAAAGAATCATATGACGTCATTGAGATGGGAATCTTAC
ACCCGGATGAAGTTCCGGTAGACACATTatacGCAGGTCAAGCCGGCTAT
GTTGTCCTCGGGATAAGAGACGTGAAAAAGGCTATACTTGGAGACATTTA
TCATAAATATGGCAGCAATATTGATGAAGCAGTGTCTGAAAGATATACCT
TCAAACAACCCACGCCAATGGTATTTGCAGGTGCTTTCCCATCCGATCAA
AGTGTGTATGAGAACATGAAAAAATCCATACAAAAATTAACCCTAAACGA
TGCAAGTGTAACTGTTCATCCTGATAGCAGTGCAGCTCTTGGTCAAGGTT
GGCGTTTGGGATTCTTGGGATTACTTCACATGGatgttttcaagcaaaga
ttagCTCAGGAATATGACACAGATGTGATAATGACAACACCAAATGTCCC
TTATCAAGCTGTACTAAAAGGGAATGAAGATGAGAAGATCACCATAAGAA
GTCCTGAAGATTTTCCAGAAGCGATCCAGACAGTAGCTTTGTACGAACCA
ATGATCACTGGCACTCTCATCTTCCCTGAACAGtatttggggaaaatcat
cacACTTTGTGAACAAAAGCGAGGCGTTCAACTAAACATTACTTATATTG
ATGACACTCGAATCATGATGAAATACAAACTGCCTCTCAATGAAGTCGTT
GTAgacttctttgataaactgaagTCTATATCTTCAGGATACGCAAGTTT
TGATTACGAAGAGAGTGGGTTTGAAGAGACCAACATCGAAAAGATGGAGA
TTTTATTAAATGGAAAGTCAATAGATGCACTGAGTACTATTGTCCATCGC
TCAAAAGTACGAGAGCTTGGGAAAAGTTATTGCTTTAAACTAAAGAACAC
TATACCAAGACAATTATTCGAAGTGGTCATACAAGCTTCAGTCCGAAACA
AAGTGATTGCTCGTGATGTGGTCAAGCCTGTACGCAAAGATGTTACTGCG
AAATGTTATGGAGGTGACCTCACTCGAAAACGAAAATTGTTGGATCGCCA
GAAAGAAGGGAAAAAACGGATGAAAAAGTTCGGCAAAGTTGAAGTACCCC
ATGAAGTTTTCTTGTCTTTATTGCAACGGTGAATGTTATTACGAAAGAAA
AATTCGCTAAGaaatttctatcaacaattccAAATAAGTTTTCAACGGCA
TTACTGCAAGAATGTAGCATTGCCATTGCATAATTATCTAGATGAACAAA
TTCGTAATTTTTGTATCATTGCTCATGTTGACCATGGTAAAAGTACTTTA
GCGGATCGTCTTTTGGAAGTAACAGGCACAATTCAAAAAGATGCAAAAAA
CAAGCAAGTTCTTGATAAACTTCAAGTGGAGAGAGAACGTGGCATAACAG
TCAAAGCACAAACCTCATCAATGTTCTACAAAGCtaacaatcaaaagact
tttctATACAATCTTATTGACACGCCAggtCATGTAGATTTTAGTTATGA
AGTATCAAGGTCATTAGCAGCATGTCAAGGAGCATTGTTGGTTGTTGACG
CAGCACAGGGTGTTCAAGCTCAAACCGTAGCAAATTTTTACGGTGCTTTA
GACGCTGGTTTGACCATACTCCCAGTTGTCAACAAGATCGATTTGGCATC
AGCAGACGTTGAAAGTTGTGTCAAACAGCTGGAAAGTGTTTTTGACTTTG
CACGAGATGAAATACAATTGGTTTCAGCCAAGGAAGGCATTGGAATTGAC
AAACTACTCGAAGCTGTTCACACAATTATACCATCACCAATTGTTGAAAT
GAATCAAGATGTCTCATTATTACTGTTCGATTCATGGTTTGACAAATACC
GTGGTGTCGTGTGCCTAATGGCTGTCAAACATGGACAATTAAATGTTGGT
GATAAGTTACAATCTCATTTCACGAAAGAATCATATGACGTCATTGAGAT
GGGAATCTTACACCCGGATGAAGTTCCGGTAGACACATTatacGCAGGTC
AAGCCGGCTATGTTGTCCTCGGGATAAGAGACGTGAAAAAGGCTATACTT
GGAGACATTTATCATAAATATGGCAGCAATATTGATGAAGCAGTGTCTGA
AAGATATACCTTCAAACAACCCACGCCAATGGTATTTGCAGGTGCTTTCC
CATCCGATCAAAGTGTGTATGAGAACATGAAAAAATCCATACAAAAATTA
ACCCTAAACGATGCAAGTGTAACTGTTCATCCTGATAGCAGTGCAGCTCT
TGGTCAAGGTTGGCGTTTGGGATTCTTGGGATTACTTCACATGGatgttt
tcaagcaaagattagCTCAGGAATATGACACAGATGTGATAATGACAACA
CCAAATGTCCCTTATCAAGCTGTACTAAAAGGGAATGAAGATGAGAAGAT
CACCATAAGAAGTCCTGAAGATTTTCCAGAAGCGATCCAGACAGTAGCTT
TGTACGAACCAATGATCACTGGCACTCTCATCTTCCCTGAACAGtatttg
gggaaaatcatcacACTTTGTGAACAAAAGCGAGGCGTTCAACTAAACAT
TACTTATATTGATGACACTCGAATCATGATGAAATACAAACTGCCTCTCA
ATGAAGTCGTTGTAgacttctttgataaactgaagTCTATATCTTCAGGA
TACGCAAGTTTTGATTACGAAGAGAGTGGGTTTGAAGAGACCAACATCGA
AAAGATGGAGATTTTATTAAATGGAAAGTCAATAGATGCACTGAGTACTA
TTGTCCATCGCTCAAAAGTACGAGAGCTTGGGAAAAGTTATTGCTTTAAA
CTAAAGAACACTATACCAAGACAATTATTCGAAGTGGTCATACAAGCTTC
AGTCCGAAACAAAGTGATTGCTCGTGATGTGGTCAAGCCTGTACGCAAAG
ATGTTACTGCGAAATGTTATGGAGGTGACCTCACTCGAAAACGAAAATTG
TTGGATCGCCAGAAAGAAGGGAAAAAACGGATGAAAAAGTTCGGCAAAGT
TGAAGTACCCCATGAAGTTTTCTTGTCTTTATTGCAACGGTGAATGTTAT
TACGAAAGAAAAATTCGCTAAGaaatttctatcaacaattccAAATAAGT
TTTCAACGGCATTACTGCAAGAATGTAGCATTGCCATTGCATAATTATCT
AGATGAACAAATTCGTAATTTTTGTATCATTGCTCATGTTGACCATGGTA
AAAGTACTTTAGCGGATCGTCTTTTGGAAGTAACAGGCACAATTCAAAAA
GATGCAAAAAACAAGCAAGTTCTTGATAAACTTCAAGTGGAGAGAGAACG
TGGCATAACAGTCAAAGCACAAACCTCATCAATGTTCTACAAAGCtaaca
atcaaaagacttttctATACAATCTTATTGACACGCCAggtCATGTAGAT
TTTAGTTATGAAGTATCAAGGTCATTAGCAGCATGTCAAGGAGCATTGTT
GGTTGTTGACGCAGCACAGGGTGTTCAAGCTCAAACCGTAGCAAATTTTT
ACGGTGCTTTAGACGCTGGTTTGACCATACTCCCAGTTGTCAACAAGATC
GATTTGGCATCAGCAGACGTTGAAAGTTGTGTCAAACAGCTGGAAAGTGT
TTTTGACTTTGCACGAGATGAAATACAATTGGTTTCAGCCAAGGAAGGCA
TTGGAATTGACAAACTACTCGAAGCTGTTCACACAATTATACCATCACCA
ATTGTTGAAATGAATCAAGATGTCTCATTATTACTGTTCGATTCATGGTT
TGACAAATACCGTGGTGTCGTGTGCCTAATGGCTGTCAAACATGGACAAT
TAAATGTTGGTGATAAGTTACAATCTCATTTCACGAAAGAATCATATGAC
GTCATTGAGATGGGAATCTTACACCCGGATGAAGTTCCGGTAGACACATT
atacGCAGGTCAAGCCGGCTATGTTGTCCTCGGGATAAGAGACGTGAAAA
AGGCTATACTTGGAGACATTTATCATAAATATGGCAGCAATATTGATGAA
GCAGTGTCTGAAAGATATACCTTCAAACAACCCACGCCAATGGTATTTGC
AGGTGCTTTCCCATCCGATCAAAGTGTGTATGAGAACATGAAAAAATCCA
TACAAAAATTAACCCTAAACGATGCAAGTGTAACTGTTCATCCTGATAGC
AGTGCAGCTCTTGGTCAAGGTTGGCGTTTGGGATTCTTGGGATTACTTCA
CATGGatgttttcaagcaaagattagCTCAGGAATATGACACAGATGTGA
TAATGACAACACCAAATGTCCCTTATCAAGCTGTACTAAAAGGGAATGAA
GATGAGAAGATCACCATAAGAAGTCCTGAAGATTTTCCAGAAGCGATCCA
GACAGTAGCTTTGTACGAACCAATGATCACTGGCACTCTCATCTTCCCTG
AACAGtatttggggaaaatcatcacACTTTGTGAACAAAAGCGAGGCGTT
CAACTAAACATTACTTATATTGATGACACTCGAATCATGATGAAATACAA
ACTGCCTCTCAATGAAGTCGTTGTAgacttctttgataaactgaagTCTA
TATCTTCAGGATACGCAAGTTTTGATTACGAAGAGAGTGGGTTTGAAGAG
ACCAACATCGAAAAGATGGAGATTTTATTAAATGGAAAGTCAATAGATGC
ACTGAGTACTATTGTCCATCGCTCAAAAGTACGAGAGCTTGGGAAAAGTT
ATTGCTTTAAACTAAAGAACACTATACCAAGACAATTATTCGAAGTGGTC
ATACAAGCTTCAGTCCGAAACAAAGTGATTGCTCGTGATGTGGTCAAGCC
TGTACGCAAAGATGTTACTGCGAAATGTTATGGAGGTGACCTCACTCGAA
AACGAAAATTGTTGGATCGCCAGAAAGAAGGGAAAAAACGGATGAAAAAG
TTCGGCAAAGTTGAAGTACCCCATGAAGTTTTCTTGTCTTTATTGCAACG
GTGAATGTTATTACGAAAGAAAAATTCGCTAAGaaatttctatcaacaat
tccAAATAAGTTTTCAACGGCATTACTGCAAGAATGTAGCATTGCCATTG
CATAATTATCTAGATGAACAAATTCGTAATTTTTGTATCATTGCTCATGT
TGACCATGGTAAAAGTACTTTAGCGGATCGTCTTTTGGAAGTAACAGGCA
CAATTCAAAAAGATGCAAAAAACAAGCAAGTTCTTGATAAACTTCAAGTG
GAGAGAGAACGTGGCATAACAGTCAAAGCACAAACCTCATCAATGTTCTA
CAAAGCtaacaatcaaaagacttttctATACAATCTTATTGACACGCCAg
gtCATGTAGATTTTAGTTATGAAGTATCAAGGTCATTAGCAGCATGTCAA
GGAGCATTGTTGGTTGTTGACGCAGCACAGGGTGTTCAAGCTCAAACCGT
AGCAAATTTTTACGGTGCTTTAGACGCTGGTTTGACCATACTCCCAGTTG
TCAACAAGATCGATTTGGCATCAGCAGACGTTGAAAGTTGTGTCAAACAG
CTGGAAAGTGTTTTTGACTTTGCACGAGATGAAATACAATTGGTTTCAGC
CAAGGAAGGCATTGGAATTGACAAACTACTCGAAGCTGTTCACACAATTA
TACCATCACCAATTGTTGAAATGAATCAAGATGTCTCATTATTACTGTTC
GATTCATGGTTTGACAAATACCGTGGTGTCGTGTGCCTAATGGCTGTCAA
ACATGGACAATTAAATGTTGGTGATAAGTTACAATCTCATTTCACGAAAG
AATCATATGACGTCATTGAGATGGGAATCTTACACCCGGATGAAGTTCCG
GTAGACACATTatacGCAGGTCAAGCCGGCTATGTTGTCCTCGGGATAAG
AGACGTGAAAAAGGCTATACTTGGAGACATTTATCATAAATATGGCAGCA
ATATTGATGAAGCAGTGTCTGAAAGATATACCTTCAAACAACCCACGCCA
ATGGTATTTGCAGGTGCTTTCCCATCCGATCAAAGTGTGTATGAGAACAT
GAAAAAATCCATACAAAAATTAACCCTAAACGATGCAAGTGTAACTGTTC
ATCCTGATAGCAGTGCAGCTCTTGGTCAAGGTTGGCGTTTGGGATTCTTG
GGATTACTTCACATGGatgttttcaagcaaagattagCTCAGGAATATGA
CACAGATGTGATAATGACAACACCAAATGTCCCTTATCAAGCTGTACTAA
AAGGGAATGAAGATGAGAAGATCACCATAAGAAGTCCTGAAGATTTTCCA
GAAGCGATCCAGACAGTAGCTTTGTACGAACCAATGATCACTGGCACTCT
CATCTTCCCTGAACAGtatttggggaaaatcatcacACTTTGTGAACAAA
AGCGAGGCGTTCAACTAAACATTACTTATATTGATGACACTCGAATCATG
ATGAAATACAAACTGCCTCTCAATGAAGTCGTTGTAgacttctttgataa
actgaagTCTATATCTTCAGGATACGCAAGTTTTGATTACGAAGAGAGTG
GGTTTGAAGAGACCAACATCGAAAAGATGGAGATTTTATTAAATGGAAAG
TCAATAGATGCACTGAGTACTATTGTCCATCGCTCAAAAGTACGAGAGCT
TGGGAAAAGTTATTGCTTTAAACTAAAGAACACTATACCAAGACAATTAT
TCGAAGTGGTCATACAAGCTTCAGTCCGAAACAAAGTGATTGCTCGTGAT
GTGGTCAAGCCTGTACGCAAAGATGTTACTGCGAAATGTTATGGAGGTGA
CCTCACTCGAAAACGAAAATTGTTGGATCGCCAGAAAGAAGGGAAAAAAC
GGATGAAAAAGTTCGGCAAAGTTGAAGTACCCCATGAAGTTTTCTTGTCT
TTATTGCAACGGTGAATGTTATTACGAAAGAAAAATTCGCTAAGaaattt
ctatcaacaattccAAATAAGTTTTCAACGGCATTACTGCAAGAATGTAG
CATTGCCATTGCATAATTATCTAGATGAACAAATTCGTAATTTTTGTATC
ATTGCTCATGTTGACCATGGTAAAAGTACTTTAGCGGATCGTCTTTTGGA
AGTAACAGGCACAATTCAAAAAGATGCAAAAAACAAGCAAGTTCTTGATA
AACTTCAAGTGGAGAGAGAACGTGGCATAACAGTCAAAGCACAAACCTCA
TCAATGTTCTACAAAGCtaacaatcaaaagacttttctATACAATCTTAT
TGACACGCCAggtCATGTAGATTTTAGTTATGAAGTATCAAGGTCATTAG
CAGCATGTCAAGGAGCATTGTTGGTTGTTGACGCAGCACAGGGTGTTCAA
GCTCAAACCGTAGCAAATTTTTACGGTGCTTTAGACGCTGGTTTGACCAT
ACTCCCAGTTGTCAACAAGATCGATTTGGCATCAGCAGACGTTGAAAGTT
GTGTCAAACAGCTGGAAAGTGTTTTTGACTTTGCACGAGATGAAATACAA
TTGGTTTCAGCCAAGGAAGGCATTGGAATTGACAAACTACTCGAAGCTGT
TCACACAATTATACCATCACCAATTGTTGAAATGAATCAAGATGTCTCAT
TATTACTGTTCGATTCATGGTTTGACAAATACCGTGGTGTCGTGTGCCTA
ATGGCTGTCAAACATGGACAATTAAATGTTGGTGATAAGTTACAATCTCA
TTTCACGAAAGAATCATATGACGTCATTGAGATGGGAATCTTACACCCGG
ATGAAGTTCCGGTAGACACATTatacGCAGGTCAAGCCGGCTATGTTGTC
CTCGGGATAAGAGACGTGAAAAAGGCTATACTTGGAGACATTTATCATAA
ATATGGCAGCAATATTGATGAAGCAGTGTCTGAAAGATATACCTTCAAAC
AACCCACGCCAATGGTATTTGCAGGTGCTTTCCCATCCGATCAAAGTGTG
TATGAGAACATGAAAAAATCCATACAAAAATTAACCCTAAACGATGCAAG
TGTAACTGTTCATCCTGATAGCAGTGCAGCTCTTGGTCAAGGTTGGCGTT
TGGGATTCTTGGGATTACTTCACATGGatgttttcaagcaaagattagCT
CAGGAATATGACACAGATGTGATAATGACAACACCAAATGTCCCTTATCA
AGCTGTACTAAAAGGGAATGAAGATGAGAAGATCACCATAAGAAGTCCTG
AAGATTTTCCAGAAGCGATCCAGACAGTAGCTTTGTACGAACCAATGATC
ACTGGCACTCTCATCTTCCCTGAACAGtatttggggaaaatcatcacACT
TTGTGAACAAAAGCGAGGCGTTCAACTAAACATTACTTATATTGATGACA
CTCGAATCATGATGAAATACAAACTGCCTCTCAATGAAGTCGTTGTAgac
ttctttgataaactgaagTCTATATCTTCAGGATACGCAAGTTTTGATTA
CGAAGAGAGTGGGTTTGAAGAGACCAACATCGAAAAGATGGAGATTTTAT
TAAATGGAAAGTCAATAGATGCACTGAGTACTATTGTCCATCGCTCAAAA
GTACGAGAGCTTGGGAAAAGTTATTGCTTTAAACTAAAGAACACTATACC
AAGACAATTATTCGAAGTGGTCATACAAGCTTCAGTCCGAAACAAAGTGA
TTGCTCGTGATGTGGTCAAGCCTGTACGCAAAGATGTTACTGCGAAATGT
TATGGAGGTGACCTCACTCGAAAACGAAAATTGTTGGATCGCCAGAAAGA
AGGGAAAAAACGGATGAAAAAGTTCGGCAAAGTTGAAGTACCCCATGAAG
TTTTCTTGTCTTTATTGCAACGGTGAATGTTATTACGAAAGAAAAATTCG
CTAAGaaatttctatcaacaattccAAATAAGTTTTCAACGGCATTACTG
CAAGAATGTAGCATTGCCATTGCATAATTATCTAGATGAACAAATTCGTA
ATTTTTGTATCATTGCTCATGTTGACCATGGTAAAAGTACTTTAGCGGAT
CGTCTTTTGGAAGTAACAGGCACAATTCAAAAAGATGCAAAAAACAAGCA
AGTTCTTGATAAACTTCAAGTGGAGAGAGAACGTGGCATAACAGTCAAAG
CACAAACCTCATCAATGTTCTACAAAGCtaacaatcaaaagacttttctA
TACAATCTTATTGACACGCCAggtCATGTAGATTTTAGTTATGAAGTATC
AAGGTCATTAGCAGCATGTCAAGGAGCATTGTTGGTTGTTGACGCAGCAC
AGGGTGTTCAAGCTCAAACCGTAGCAAATTTTTACGGTGCTTTAGACGCT
GGTTTGACCATACTCCCAGTTGTCAACAAGATCGATTTGGCATCAGCAGA
CGTTGAAAGTTGTGTCAAACAGCTGGAAAGTGTTTTTGACTTTGCACGAG
ATGAAATACAATTGGTTTCAGCCAAGGAAGGCATTGGAATTGACAAACTA
CTCGAAGCTGTTCACACAATTATACCATCACCAATTGTTGAAATGAATCA
AGATGTCTCATTATTACTGTTCGATTCATGGTTTGACAAATACCGTGGTG
TCGTGTGCCTAATGGCTGTCAAACATGGACAATTAAATGTTGGTGATAAG
TTACAATCTCATTTCACGAAAGAATCATATGACGTCATTGAGATGGGAAT
CTTACACCCGGATGAAGTTCCGGTAGACACATTatacGCAGGTCAAGCCG
GCTATGTTGTCCTCGGGATAAGAGACGTGAAAAAGGCTATACTTGGAGAC
ATTTATCATAAATATGGCAGCAATATTGATGAAGCAGTGTCTGAAAGATA
TACCTTCAAACAACCCACGCCAATGGTATTTGCAGGTGCTTTCCCATCCG
ATCAAAGTGTGTATGAGAACATGAAAAAATCCATACAAAAATTAACCCTA
AACGATGCAAGTGTAACTGTTCATCCTGATAGCAGTGCAGCTCTTGGTCA
AGGTTGGCGTTTGGGATTCTTGGGATTACTTCACATGGatgttttcaagc
aaagattagCTCAGGAATATGACACAGATGTGATAATGACAACACCAAAT
GTCCCTTATCAAGCTGTACTAAAAGGGAATGAAGATGAGAAGATCACCAT
AAGAAGTCCTGAAGATTTTCCAGAAGCGATCCAGACAGTAGCTTTGTACG
AACCAATGATCACTGGCACTCTCATCTTCCCTGAACAGtatttggggaaa
atcatcacACTTTGTGAACAAAAGCGAGGCGTTCAACTAAACATTACTTA
TATTGATGACACTCGAATCATGATGAAATACAAACTGCCTCTCAATGAAG
TCGTTGTAgacttctttgataaactgaagTCTATATCTTCAGGATACGCA
AGTTTTGATTACGAAGAGAGTGGGTTTGAAGAGACCAACATCGAAAAGAT
GGAGATTTTATTAAATGGAAAGTCAATAGATGCACTGAGTACTATTGTCC
ATCGCTCAAAAGTACGAGAGCTTGGGAAAAGTTATTGCTTTAAACTAAAG
AACACTATACCAAGACAATTATTCGAAGTGGTCATACAAGCTTCAGTCCG
AAACAAAGTGATTGCTCGTGATGTGGTCAAGCCTGTACGCAAAGATGTTA
CTGCGAAATGTTATGGAGGTGACCTCACTCGAAAACGAAAATTGTTGGAT
CGCCAGAAAGAAGGGAAAAAACGGATGAAAAAGTTCGGCAAAGTTGAAGT
ACCCCATGAAGTTTTCTTGTCTTTATTGCAACGGTGAATGTTATTACGAA
AGAAAAATTCGCTAAGaaatttctatcaacaattccAAATAAGTTTTCAA
CGGCATTACTGCAAGAATGTAGCATTGCCATTGCATAATTATCTAGATGA
ACAAATTCGTAATTTTTGTATCATTGCTCATGTTGACCATGGTAAAAGTA
CTTTAGCGGATCGTCTTTTGGAAGTAACAGGCACAATTCAAAAAGATGCA
AAAAACAAGCAAGTTCTTGATAAACTTCAAGTGGAGAGAGAACGTGGCAT
AACAGTCAAAGCACAAACCTCATCAATGTTCTACAAAGCtaacaatcaaa
agacttttctATACAATCTTATTGACACGCCAggtCATGTAGATTTTAGT
TATGAAGTATCAAGGTCATTAGCAGCATGTCAAGGAGCATTGTTGGTTGT
TGACGCAGCACAGGGTGTTCAAGCTCAAACCGTAGCAAATTTTTACGGTG
CTTTAGACGCTGGTTTGACCATACTCCCAGTTGTCAACAAGATCGATTTG
GCATCAGCAGACGTTGAAAGTTGTGTCAAACAGCTGGAAAGTGTTTTTGA
CTTTGCACGAGATGAAATACAATTGGTTTCAGCCAAGGAAGGCATTGGAA
TTGACAAACTACTCGAAGCTGTTCACACAATTATACCATCACCAATTGTT
GAAATGAATCAAGATGTCTCATTATTACTGTTCGATTCATGGTTTGACAA
ATACCGTGGTGTCGTGTGCCTAATGGCTGTCAAACATGGACAATTAAATG
TTGGTGATAAGTTACAATCTCATTTCACGAAAGAATCATATGACGTCATT
GAGATGGGAATCTTACACCCGGATGAAGTTCCGGTAGACACATTatacGC
AGGTCAAGCCGGCTATGTTGTCCTCGGGATAAGAGACGTGAAAAAGGCTA
TACTTGGAGACATTTATCATAAATATGGCAGCAATATTGATGAAGCAGTG
TCTGAAAGATATACCTTCAAACAACCCACGCCAATGGTATTTGCAGGTGC
TTTCCCATCCGATCAAAGTGTGTATGAGAACATGAAAAAATCCATACAAA
AATTAACCCTAAACGATGCAAGTGTAACTGTTCATCCTGATAGCAGTGCA
GCTCTTGGTCAAGGTTGGCGTTTGGGATTCTTGGGATTACTTCACATGGa
tgttttcaagcaaagattagCTCAGGAATATGACACAGATGTGATAATGA
CAACACCAAATGTCCCTTATCAAGCTGTACTAAAAGGGAATGAAGATGAG
AAGATCACCATAAGAAGTCCTGAAGATTTTCCAGAAGCGATCCAGACAGT
AGCTTTGTACGAACCAATGATCACTGGCACTCTCATCTTCCCTGAACAGt
atttggggaaaatcatcacACTTTGTGAACAAAAGCGAGGCGTTCAACTA
AACATTACTTATATTGATGACACTCGAATCATGATGAAATACAAACTGCC
TCTCAATGAAGTCGTTGTAgacttctttgataaactgaagTCTATATCTT
CAGGATACGCAAGTTTTGATTACGAAGAGAGTGGGTTTGAAGAGACCAAC
ATCGAAAAGATGGAGATTTTATTAAATGGAAAGTCAATAGATGCACTGAG
TACTATTGTCCATCGCTCAAAAGTACGAGAGCTTGGGAAAAGTTATTGCT
TTAAACTAAAGAACACTATACCAAGACAATTATTCGAAGTGGTCATACAA
GCTTCAGTCCGAAACAAAGTGATTGCTCGTGATGTGGTCAAGCCTGTACG
CAAAGATGTTACTGCGAAATGTTATGGAGGTGACCTCACTCGAAAACGAA
AATTGTTGGATCGCCAGAAAGAAGGGAAAAAACGGATGAAAAAGTTCGGC
AAAGTTGAAGTACCCCATGAAGTTTTCTTGTCTTTATTGCAACGGTGAAT
GTTATTACGAAAGAAAAATTCGCTAAGaaatttctatcaacaattccAAA
TAAGTTTTCAACGGCATTACTGCAAGAATGTAGCATTGCCATTGCATAAT
TATCTAGATGAACAAATTCGTAATTTTTGTATCATTGCTCATGTTGACCA
TGGTAAAAGTACTTTAGCGGATCGTCTTTTGGAAGTAACAGGCACAATTC
AAAAAGATGCAAAAAACAAGCAAGTTCTTGATAAACTTCAAGTGGAGAGA
GAACGTGGCATAACAGTCAAAGCACAAACCTCATCAATGTTCTACAAAGC
taacaatcaaaagacttttctATACAATCTTATTGACACGCCAggtCATG
TAGATTTTAGTTATGAAGTATCAAGGTCATTAGCAGCATGTCAAGGAGCA
TTGTTGGTTGTTGACGCAGCACAGGGTGTTCAAGCTCAAACCGTAGCAAA
TTTTTACGGTGCTTTAGACGCTGGTTTGACCATACTCCCAGTTGTCAACA
AGATCGATTTGGCATCAGCAGACGTTGAAAGTTGTGTCAAACAGCTGGAA
AGTGTTTTTGACTTTGCACGAGATGAAATACAATTGGTTTCAGCCAAGGA
AGGCATTGGAATTGACAAACTACTCGAAGCTGTTCACACAATTATACCAT
CACCAATTGTTGAAATGAATCAAGATGTCTCATTATTACTGTTCGATTCA
TGGTTTGACAAATACCGTGGTGTCGTGTGCCTAATGGCTGTCAAACATGG
ACAATTAAATGTTGGTGATAAGTTACAATCTCATTTCACGAAAGAATCAT
ATGACGTCATTGAGATGGGAATCTTACACCCGGATGAAGTTCCGGTAGAC
ACATTatacGCAGGTCAAGCCGGCTATGTTGTCCTCGGGATAAGAGACGT
GAAAAAGGCTATACTTGGAGACATTTATCATAAATATGGCAGCAATATTG
ATGAAGCAGTGTCTGAAAGATATACCTTCAAACAACCCACGCCAATGGTA
TTTGCAGGTGCTTTCCCATCCGATCAAAGTGTGTATGAGAACATGAAAAA
ATCCATACAAAAATTAACCCTAAACGATGCAAGTGTAACTGTTCATCCTG
ATAGCAGTGCAGCTCTTGGTCAAGGTTGGCGTTTGGGATTCTTGGGATTA
CTTCACATGGatgttttcaagcaaagattagCTCAGGAATATGACACAGA
TGTGATAATGACAACACCAAATGTCCCTTATCAAGCTGTACTAAAAGGGA
ATGAAGATGAGAAGATCACCATAAGAAGTCCTGAAGATTTTCCAGAAGCG
ATCCAGACAGTAGCTTTGTACGAACCAATGATCACTGGCACTCTCATCTT
CCCTGAACAGtatttggggaaaatcatcacACTTTGTGAACAAAAGCGAG
GCGTTCAACTAAACATTACTTATATTGATGACACTCGAATCATGATGAAA
TACAAACTGCCTCTCAATGAAGTCGTTGTAgacttctttgataaactgaa
gTCTATATCTTCAGGATACGCAAGTTTTGATTACGAAGAGAGTGGGTTTG
AAGAGACCAACATCGAAAAGATGGAGATTTTATTAAATGGAAAGTCAATA
GATGCACTGAGTACTATTGTCCATCGCTCAAAAGTACGAGAGCTTGGGAA
AAGTTATTGCTTTAAACTAAAGAACACTATACCAAGACAATTATTCGAAG
TGGTCATACAAGCTTCAGTCCGAAACAAAGTGATTGCTCGTGATGTGGTC
AAGCCTGTACGCAAAGATGTTACTGCGAAATGTTATGGAGGTGACCTCAC
TCGAAAACGAAAATTGTTGGATCGCCAGAAAGAAGGGAAAAAACGGATGA
AAAAGTTCGGCAAAGTTGAAGTACCCCATGAAGTTTTCTTGTCTTTATTG
CAACGGTGAATGTTATTACGAAAGAAAAATTCGCTAAGaaatttctatca
acaattccAAATAAGTTTTCAACGGCATTACTGCAAGAATGTAGCATTGC
CATTGCATAATTATCTAGATGAACAAATTCGTAATTTTTGTATCATTGCT
CATGTTGACCATGGTAAAAGTACTTTAGCGGATCGTCTTTTGGAAGTAAC
AGGCACAATTCAAAAAGATGCAAAAAACAAGCAAGTTCTTGATAAACTTC
AAGTGGAGAGAGAACGTGGCATAACAGTCAAAGCACAAACCTCATCAATG
TTCTACAAAGCtaacaatcaaaagacttttctATACAATCTTATTGACAC
GCCAggtCATGTAGATTTTAGTTATGAAGTATCAAGGTCATTAGCAGCAT
GTCAAGGAGCATTGTTGGTTGTTGACGCAGCACAGGGTGTTCAAGCTCAA
ACCGTAGCAAATTTTTACGGTGCTTTAGACGCTGGTTTGACCATACTCCC
AGTTGTCAACAAGATCGATTTGGCATCAGCAGACGTTGAAAGTTGTGTCA
AACAGCTGGAAAGTGTTTTTGACTTTGCACGAGATGAAATACAATTGGTT
TCAGCCAAGGAAGGCATTGGAATTGACAAACTACTCGAAGCTGTTCACAC
AATTATACCATCACCAATTGTTGAAATGAATCAAGATGTCTCATTATTAC
TGTTCGATTCATGGTTTGACAAATACCGTGGTGTCGTGTGCCTAATGGCT
GTCAAACATGGACAATTAAATGTTGGTGATAAGTTACAATCTCATTTCAC
GAAAGAATCATATGACGTCATTGAGATGGGAATCTTACACCCGGATGAAG
TTCCGGTAGACACATTatacGCAGGTCAAGCCGGCTATGTTGTCCTCGGG
ATAAGAGACGTGAAAAAGGCTATACTTGGAGACATTTATCATAAATATGG
CAGCAATATTGATGAAGCAGTGTCTGAAAGATATACCTTCAAACAACCCA
CGCCAATGGTATTTGCAGGTGCTTTCCCATCCGATCAAAGTGTGTATGAG
AACATGAAAAAATCCATACAAAAATTAACCCTAAACGATGCAAGTGTAAC
TGTTCATCCTGATAGCAGTGCAGCTCTTGGTCAAGGTTGGCGTTTGGGAT
TCTTGGGATTACTTCACATGGatgttttcaagcaaagattagCTCAGGAA
TATGACACAGATGTGATAATGACAACACCAAATGTCCCTTATCAAGCTGT
ACTAAAAGGGAATGAAGATGAGAAGATCACCATAAGAAGTCCTGAAGATT
TTCCAGAAGCGATCCAGACAGTAGCTTTGTACGAACCAATGATCACTGGC
ACTCTCATCTTCCCTGAACAGtatttggggaaaatcatcacACTTTGTGA
ACAAAAGCGAGGCGTTCAACTAAACATTACTTATATTGATGACACTCGAA
TCATGATGAAATACAAACTGCCTCTCAATGAAGTCGTTGTAgacttcttt
gataaactgaagTCTATATCTTCAGGATACGCAAGTTTTGATTACGAAGA
GAGTGGGTTTGAAGAGACCAACATCGAAAAGATGGAGATTTTATTAAATG
GAAAGTCAATAGATGCACTGAGTACTATTGTCCATCGCTCAAAAGTACGA
GAGCTTGGGAAAAGTTATTGCTTTAAACTAAAGAACACTATACCAAGACA
ATTATTCGAAGTGGTCATACAAGCTTCAGTCCGAAACAAAGTGATTGCTC
GTGATGTGGTCAAGCCTGTACGCAAAGATGTTACTGCGAAATGTTATGGA
GGTGACCTCACTCGAAAACGAAAATTGTTGGATCGCCAGAAAGAAGGGAA
AAAACGGATGAAAAAGTTCGGCAAAGTTGAAGTACCCCATGAAGTTTTCT
TGTCTTTATTGCAACGGTGAATGTTATTACGAAAGAAAAATTCGCTAAGa
aatttctatcaacaattccAAATAAGTTTTCAACGGCATTACTGCAAGAA
TGTAGCATTGCCATTGCATAATTATCTAGATGAACAAATTCGTAATTTTT
GTATCATTGCTCATGTTGACCATGGTAAAAGTACTTTAGCGGATCGTCTT
TTGGAAGTAACAGGCACAATTCAAAAAGATGCAAAAAACAAGCAAGTTCT
TGATAAACTTCAAGTGGAGAGAGAACGTGGCATAACAGTCAAAGCACAAA
CCTCATCAATGTTCTACAAAGCtaacaatcaaaagacttttctATACAAT
CTTATTGACACGCCAggtCATGTAGATTTTAGTTATGAAGTATCAAGGTC
ATTAGCAGCATGTCAAGGAGCATTGTTGGTTGTTGACGCAGCACAGGGTG
TTCAAGCTCAAACCGTAGCAAATTTTTACGGTGCTTTAGACGCTGGTTTG
ACCATACTCCCAGTTGTCAACAAGATCGATTTGGCATCAGCAGACGTTGA
AAGTTGTGTCAAACAGCTGGAAAGTGTTTTTGACTTTGCACGAGATGAAA
TACAATTGGTTTCAGCCAAGGAAGGCATTGGAATTGACAAACTACTCGAA
GCTGTTCACACAATTATACCATCACCAATTGTTGAAATGAATCAAGATGT
CTCATTATTACTGTTCGATTCATGGTTTGACAAATACCGTGGTGTCGTGT
GCCTAATGGCTGTCAAACATGGACAATTAAATGTTGGTGATAAGTTACAA
TCTCATTTCACGAAAGAATCATATGACGTCATTGAGATGGGAATCTTACA
CCCGGATGAAGTTCCGGTAGACACATTatacGCAGGTCAAGCCGGCTATG
TTGTCCTCGGGATAAGAGACGTGAAAAAGGCTATACTTGGAGACATTTAT
CATAAATATGGCAGCAATATTGATGAAGCAGTGTCTGAAAGATATACCTT
CAAACAACCCACGCCAATGGTATTTGCAGGTGCTTTCCCATCCGATCAAA
GTGTGTATGAGAACATGAAAAAATCCATACAAAAATTAACCCTAAACGAT
GCAAGTGTAACTGTTCATCCTGATAGCAGTGCAGCTCTTGGTCAAGGTTG
GCGTTTGGGATTCTTGGGATTACTTCACATGGatgttttcaagcaaagat
tagCTCAGGAATATGACACAGATGTGATAATGACAACACCAAATGTCCCT
TATCAAGCTGTACTAAAAGGGAATGAAGATGAGAAGATCACCATAAGAAG
TCCTGAAGATTTTCCAGAAGCGATCCAGACAGTAGCTTTGTACGAACCAA
TGATCACTGGCACTCTCATCTTCCCTGAACAGtatttggggaaaatcatc
acACTTTGTGAACAAAAGCGAGGCGTTCAACTAAACATTACTTATATTGA
TGACACTCGAATCATGATGAAATACAAACTGCCTCTCAATGAAGTCGTTG
TAgacttctttgataaactgaagTCTATATCTTCAGGATACGCAAGTTTT
GATTACGAAGAGAGTGGGTTTGAAGAGACCAACATCGAAAAGATGGAGAT
TTTATTAAATGGAAAGTCAATAGATGCACTGAGTACTATTGTCCATCGCT
CAAAAGTACGAGAGCTTGGGAAAAGTTATTGCTTTAAACTAAAGAACACT
ATACCAAGACAATTATTCGAAGTGGTCATACAAGCTTCAGTCCGAAACAA
AGTGATTGCTCGTGATGTGGTCAAGCCTGTACGCAAAGATGTTACTGCGA
AATGTTATGGAGGTGACCTCACTCGAAAACGAAAATTGTTGGATCGCCAG
AAAGAAGGGAAAAAACGGATGAAAAAGTTCGGCAAAGTTGAAGTACCCCA
TGAAGTTTTCTTGTCTTTATTGCAACGGTGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000982XLOC_000982Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001861-exon-sc0000012-1491911889:1049367..1049447TCONS_00001861-exon-sc0000012-1491911889:1049367..1049447Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1510915933:1049367..1049447TCONS_00001861-exon-sc0000012-1510915933:1049367..1049447Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1575043694:1049367..1049447TCONS_00001861-exon-sc0000012-1575043694:1049367..1049447Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1491911889:1050145..1050193TCONS_00001861-exon-sc0000012-1491911889:1050145..1050193Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1510915933:1050145..1050193TCONS_00001861-exon-sc0000012-1510915933:1050145..1050193Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1575043694:1050145..1050193TCONS_00001861-exon-sc0000012-1575043694:1050145..1050193Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1491911889:1050447..1050561TCONS_00001861-exon-sc0000012-1491911889:1050447..1050561Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1510915933:1050447..1050561TCONS_00001861-exon-sc0000012-1510915933:1050447..1050561Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1575043694:1050447..1050561TCONS_00001861-exon-sc0000012-1575043694:1050447..1050561Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1491911889:1050868..1050953TCONS_00001861-exon-sc0000012-1491911889:1050868..1050953Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1510915933:1050868..1050953TCONS_00001861-exon-sc0000012-1510915933:1050868..1050953Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1575043694:1050868..1050953TCONS_00001861-exon-sc0000012-1575043694:1050868..1050953Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1491911889:1051260..1051325TCONS_00001861-exon-sc0000012-1491911889:1051260..1051325Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1510915933:1051260..1051325TCONS_00001861-exon-sc0000012-1510915933:1051260..1051325Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1575043694:1051260..1051325TCONS_00001861-exon-sc0000012-1575043694:1051260..1051325Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1491911889:1051513..1051593TCONS_00001861-exon-sc0000012-1491911889:1051513..1051593Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1510915933:1051513..1051593TCONS_00001861-exon-sc0000012-1510915933:1051513..1051593Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1575043694:1051513..1051593TCONS_00001861-exon-sc0000012-1575043694:1051513..1051593Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1491911889:1052207..1052284TCONS_00001861-exon-sc0000012-1491911889:1052207..1052284Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1510915933:1052207..1052284TCONS_00001861-exon-sc0000012-1510915933:1052207..1052284Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1575043694:1052207..1052284TCONS_00001861-exon-sc0000012-1575043694:1052207..1052284Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1491911889:1052491..1052574TCONS_00001861-exon-sc0000012-1491911889:1052491..1052574Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1510915933:1052491..1052574TCONS_00001861-exon-sc0000012-1510915933:1052491..1052574Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1575043694:1052491..1052574TCONS_00001861-exon-sc0000012-1575043694:1052491..1052574Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1491911889:1052855..1052919TCONS_00001861-exon-sc0000012-1491911889:1052855..1052919Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1510915933:1052855..1052919TCONS_00001861-exon-sc0000012-1510915933:1052855..1052919Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1575043694:1052855..1052919TCONS_00001861-exon-sc0000012-1575043694:1052855..1052919Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1491911889:1053200..1053312TCONS_00001861-exon-sc0000012-1491911889:1053200..1053312Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1510915933:1053200..1053312TCONS_00001861-exon-sc0000012-1510915933:1053200..1053312Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1575043694:1053200..1053312TCONS_00001861-exon-sc0000012-1575043694:1053200..1053312Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1491911889:1054149..1054239TCONS_00001861-exon-sc0000012-1491911889:1054149..1054239Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1510915933:1054149..1054239TCONS_00001861-exon-sc0000012-1510915933:1054149..1054239Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1575043694:1054149..1054239TCONS_00001861-exon-sc0000012-1575043694:1054149..1054239Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1491911889:1055203..1055344TCONS_00001861-exon-sc0000012-1491911889:1055203..1055344Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1510915933:1055203..1055344TCONS_00001861-exon-sc0000012-1510915933:1055203..1055344Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1575043694:1055203..1055344TCONS_00001861-exon-sc0000012-1575043694:1055203..1055344Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1491911889:1056863..1056972TCONS_00001861-exon-sc0000012-1491911889:1056863..1056972Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1510915933:1056863..1056972TCONS_00001861-exon-sc0000012-1510915933:1056863..1056972Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1575043694:1056863..1056972TCONS_00001861-exon-sc0000012-1575043694:1056863..1056972Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1491911889:1057183..1057261TCONS_00001861-exon-sc0000012-1491911889:1057183..1057261Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1510915933:1057183..1057261TCONS_00001861-exon-sc0000012-1510915933:1057183..1057261Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1575043694:1057183..1057261TCONS_00001861-exon-sc0000012-1575043694:1057183..1057261Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1491911889:1057982..1058030TCONS_00001861-exon-sc0000012-1491911889:1057982..1058030Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1510915933:1057982..1058030TCONS_00001861-exon-sc0000012-1510915933:1057982..1058030Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1575043694:1057982..1058030TCONS_00001861-exon-sc0000012-1575043694:1057982..1058030Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1491911889:1092079..1092131TCONS_00001861-exon-sc0000012-1491911889:1092079..1092131Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1510915933:1092079..1092131TCONS_00001861-exon-sc0000012-1510915933:1092079..1092131Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1575043694:1092079..1092131TCONS_00001861-exon-sc0000012-1575043694:1092079..1092131Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1491911889:1092507..1092608TCONS_00001861-exon-sc0000012-1491911889:1092507..1092608Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1510915933:1092507..1092608TCONS_00001861-exon-sc0000012-1510915933:1092507..1092608Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1575043694:1092507..1092608TCONS_00001861-exon-sc0000012-1575043694:1092507..1092608Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1491911889:1093417..1093550TCONS_00001861-exon-sc0000012-1491911889:1093417..1093550Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1510915933:1093417..1093550TCONS_00001861-exon-sc0000012-1510915933:1093417..1093550Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1575043694:1093417..1093550TCONS_00001861-exon-sc0000012-1575043694:1093417..1093550Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1491911889:1093731..1093776TCONS_00001861-exon-sc0000012-1491911889:1093731..1093776Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1510915933:1093731..1093776TCONS_00001861-exon-sc0000012-1510915933:1093731..1093776Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1575043694:1093731..1093776TCONS_00001861-exon-sc0000012-1575043694:1093731..1093776Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1491911889:1094341..1094553TCONS_00001861-exon-sc0000012-1491911889:1094341..1094553Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1510915933:1094341..1094553TCONS_00001861-exon-sc0000012-1510915933:1094341..1094553Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1575043694:1094341..1094553TCONS_00001861-exon-sc0000012-1575043694:1094341..1094553Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1491911889:1095079..1095674TCONS_00001861-exon-sc0000012-1491911889:1095079..1095674Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1510915933:1095079..1095674TCONS_00001861-exon-sc0000012-1510915933:1095079..1095674Clytia hemisphaericaexon
TCONS_00001861-exon-sc0000012-1575043694:1095079..1095674TCONS_00001861-exon-sc0000012-1575043694:1095079..1095674Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001861-proteinTCONS_00001861-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000012supercontigsc0000012:1049367..1095674 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
4.91675 4.23054 4.69374 4.05813 2.08016 1.23283 7.93256 6.96222 7.79906 6.13838 9.37662 8.02581 6.41172 5.99277 7.22608 6.46224 10.5664 8.6048 6.14896 5.57652 16.7781 16.6403 11.2749 13.1649 4.24382 8.22167 13.4837 10.8632 12.6265 7.63142
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000795TF_GTP-bd_dom
IPR005225Small_GTP-bd_dom
IPR000640EFG_V
IPR006297EF-4
IPR013842LepA_GTP-bd_C
IPR031157G_TR_CS
IPR027417P-loop_NTPase
IPR009022EFG_III-V
IPR009000Transl_B-barrel
Vocabulary: Molecular Function
TermDefinition
GO:0003924GTPase activity
GO:0005525GTP binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0003924 GTPase activity
molecular_function GO:0005525 GTP binding
Blast
BLAST of TCONS_00001861 vs. Swiss-Prot (Human)
Match: GUF1 (Translation factor GUF1, mitochondrial OS=Homo sapiens GN=GUF1 PE=1 SV=1)

HSP 1 Score: 680.248 bits (1754), Expect = 0.000e+0
Identity = 343/614 (55.86%), Postives = 453/614 (73.78%), Query Frame = 2
Query:  140 LPLHNYLDEQIRNFCIIAHVDHGKSTLADRLLEVTGTIQKDAKNKQVLDKLQVERERGITVKAQTSSMFYKANNQKTFLYNLIDTPGHVDFSYEVSRSLAACQGALLVVDAAQGVQAQTVANFYGALDAGLTILPVVNKIDLASADVESCVKQLESVFDFARDEIQLVSAKEGIGIDKLLEAVHTIIPSPIVEMNQDVSLLLFDSWFDKYRGVVCLMAVKHGQLNVGDKLQSHFTKESYDVIEMGILHPDEVPVDTLYAGQAGYVVLGIRDVKKAILGDIY--HKYGSNIDEAVSERYTFKQPTPMVFAGAFPSDQSVYENMKKSIQKLTLNDASVTVHPDSSAALGQGWRLGFLGLLHMDVFKQRLAQEYDTDVIMTTPNVPYQAVL------KGNEDEKITIRSPEDFPEAIQTVALYEPMITGTLIFPEQYLGKIITLCEQKRGVQLNITYIDDTRIMMKYKLPLNEVVVDFFDKLKSISSGYASFDYEESGFEETNIEKMEILLNGKSIDALSTIVHRSKVRELGKSYCFKLKNTIPRQLFEVVIQASVRNKVIARDVVKPVRKDVTAKCYGGDLTRKRKLLDRQXXXXXXXXXXXXXXXPHEVFLSLLQ 1957
            L +  +  E IRNF I+AHVDHGKSTLADRLLE+TGTI K   NKQVLDKLQVERERGITVKAQT+S+FY     K +L NLIDTPGHVDFSYEVSRSL+ACQG LLVVDA +G+QAQTVANF+ A +A L+++PV+NKIDL +AD E    Q+E VFD   DE   +SAK G  ++ +L+A+   IP P V     +  L+FDS FD+YRGV+  +A+  G ++ GDK+ S  T+++Y+V E+G+L+P+E P   LYAGQ GY++ G++DV +A +GD    HK      + V     FK   PMVFAG +P DQS Y N+K +I+KLTLND+SVTVH DSS ALG GWRLGFLGLLHM+VF QRL QEY+  VI+TTP VPY+AVL      K + +++ITI +P  FP+  +     EP++ GT+I P++Y GKI+ LCE +R VQ N+ +ID  R+M+KY  PLNE+VVDF+D LKS+SSGYASFDYE++G++   + KM+ILLNG +++ L T+VH+ K   +GK+ C +LK+++PRQLFE+ IQA++ +K+IAR+ VK  RK+V AKCYGGD+TRK KLL RQ EGKK+++K G VEVP + F+ +L+
Sbjct:   58 LDMSRFPVENIRNFSIVAHVDHGKSTLADRLLELTGTIDKTKNNKQVLDKLQVERERGITVKAQTASLFYNCEG-KQYLLNLIDTPGHVDFSYEVSRSLSACQGVLLVVDANEGIQAQTVANFFLAFEAQLSVIPVINKIDLKNADPERVENQIEKVFDIPSDECIKISAKLGTNVESVLQAIIERIPPPKVHRKNPLRALVFDSTFDQYRGVIANVALFDGVVSKGDKIVSAHTQKTYEVNEVGVLNPNEQPTHKLYAGQVGYLIAGMKDVTEAQIGDTLCLHK------QPVEPLPGFKSAKPMVFAGMYPLDQSEYNNLKSAIEKLTLNDSSVTVHRDSSLALGAGWRLGFLGLLHMEVFNQRLEQEYNASVILTTPTVPYKAVLSSSKLIKEHREKEITIINPAQFPDKSKVTEYLEPVVLGTIITPDEYTGKIMMLCEARRAVQKNMIFIDQNRVMLKYLFPLNEIVVDFYDSLKSLSSGYASFDYEDAGYQTAELVKMDILLNGNTVEELVTVVHKDKAHSIGKAICERLKDSLPRQLFEIAIQAAIGSKIIARETVKAYRKNVLAKCYGGDITRKMKLLKRQAEGKKKLRKIGNVEVPKDAFIKVLK 664          
The following BLAST results are available for this feature:
BLAST of TCONS_00001861 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
GUF10.000e+055.86Translation factor GUF1, mitochondrial OS=Homo sap... [more]
back to top