Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001767 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001767
Unique NameTCONS_00001767
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1670

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001767 ID=TCONS_00001767|Name=TCONS_00001767|organism=Clytia hemisphaerica|type=transcript|length=1670bp
CCCAGTTCTCGAATGAATAGATGATCTATTGGATTTTGGAACCCCAGCAA
TGCTGTTTTTATTCGTAGGGGTTGCAAAGTCTATAGATTATTGGTAGATT
AATTGTATCAAGAAAATAGACCACAGAGAGGTTATTGAAGTAAAAATAAT
GCAGAGCCTTACATCTCTGACATAAAGCTCAACATCGTCTATTTCCTTAT
ATGGACTATGGACCAAGGCATCACTCTCATCTGTAAGGTCCATGGAAATT
ATGCGGATTACTGCAATAAAGATGGGTGTCTGTTTATATCGATTCACCAT
ATTACATTACAATTCTGCTCAAGGAAGAAAATGTGGGGCAAGGCAgtaat
gaaaatctttttattttttggtgtGCTTGCCACAACCCAAGgatatggCT
TCTCACCATTTGAATCTCTATCTGACTACGAAAGTAATGCATTTGAAAAA
GATGaatatttagACATAATTGACGACCTCGATCACGATGCAGAAGCCAA
CTTCTATGATGCAAGCCCTGTTGAAAGATATCGAATCCAAGATCCATTTG
AAGATTATTTTGATGTATTCAAGAGAGCATCGAaATGCAAAGACATATTT
TCAAACTGTGCACAGTTGACAAAATATTGCAAGAAAAAAGGAAAGCAATT
CAAACAGATCAGAGCTGGGTGTAGATTATCCTGTGGATTTTGCAAGGCAC
CAAAAGCCCCAGCTTATGTGAGCGCGAGACCAAAGATATCATcgtctgaa
aaagaaaagatcaaAAGAACATGTTTGAATTCTCATAACGCCAAGCGCCG
CCTTCACCAAAAGACACCTCCTATGGTATGGAGTCAAAAATTGGCTGATC
GTGCACAAACCTTTGCTGAATNCACCTCTTATGGTATGGAGTCAAAAATT
GGCCGATCGTTCACAAACCTTTGCTGAATATCTGAGTGCCAACAACAAGT
TTGAACATGATTCGTTCAGGAGGAATGGATTCTCCAGCAGTATTGGAGAG
AATATTTACAAATCATCTTCTAGTAGCAGAATATCAGAAAATGCAGTCAC
AGCTTGGTACAACGAAATCAAGAATTACAGTTTTGGAACAGGCGGCACCA
AGGGCGGCGCAATTGGGCATTTTACACAAGTAGTGTGGGACAGATCTACC
ATCTTAGGATGTGGTGTAGTGAAGTCTTCAAGAGGAACCTGGGTAGTAGC
CAGATATGAGCCTGCCGGTAATTTCAGAGGTCAATACAAGGAACATGTCC
ATCGATTGAAAAACAGCGGCGATGCTTTtcttgaagatgaagaagaaatg
gTTTTGTAAAgattgagagaaaaaaaatcttacNCTTtctttgaagatga
agaagaaatgaTTTTGTAAAGActgtgagaaaaaaaatcttaaacaaGCC
TATGATTGAGGAAACATATAGAACAATGAGCTTTAGCAGTAACTATTTAA
GCGTATGGTATACTTcgtactgaaaatattaaggATTTAGTTTGTTAGCA
GTAAAAATCTTaggatgaaaaaataaaatttaaaatttcgaataaaagtt
acaatatttttttttcttttattttgactgaataaatatatttttgaaaa
tctttcacaTTTGTGACGTTCTAAGatgtaagattttttatatGAAACCA
AGTTCCTTGATGAAAATGGG
Run BLAST on NCBI

protein sequence of TCONS_00001767-protein

>TCONS_00001767-protein ID=TCONS_00001767-protein|Name=TCONS_00001767-protein|organism=Clytia hemisphaerica|type=polypeptide|length=239bp
MDQGITLICKVHGNYADYCNKDGCLFISIHHITLQFCSRKKMWGKAVMKI
FLFFGVLATTQGYGFSPFESLSDYESNAFEKDEYLDIIDDLDHDAEANFY
DASPVERYRIQDPFEDYFDVFKRASKCKDIFSNCAQLTKYCKKKGKQFKQ
IRAGCRLSCGFCKAPKAPAYVSARPKISSSEKEKIKRTCLNSHNAKRRLH
QKTPPMVWSQKLADRAQTFAEXTSYGMESKIGRSFTNLC
Run BLAST on NCBI

transcript from alignment at sc0000012:160968..183255+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001767 ID=TCONS_00001767|Name=TCONS_00001767|organism=Clytia hemisphaerica|type=transcript|length=22288bp|location=Sequence derived from alignment at sc0000012:160968..183255+ (Clytia hemisphaerica)
CCCAGTTCTCGAATGAATAGATGATCTATTGGATTTTGGAACCCCAGCAA TGCTGTTTTTATTCGTAGGGGTTGCAAAGTCTATAGATTATTGGTAGATT AATTGTATCAAGAAAATAGACCACAGAGAGGTTATTGAAGTAAAAATAAT GCAGAGCCTTACATCTCTGACATAAAGCTCAACATCGTCTATTTCCTTAT ATGGACTATGGACCAAGGCATCACTCTCATCTGTAAGGTCCATGGAAATT ATGCGGATTACTGCAATAAAGATGGGTGTCTGTTTATATCGATTCACCAT ATTACATTACAATTCTGCTCAAGGAAGAAAATGTGGGGCAAGGCAgtaat gaaaatctttttattttttggtgtGCTTGCCACAACCCAAGGTAACTTTG TTCTTTCTTGAAtagaatctttaaaaattttgagtaAGAGTGACATCATT TGCTtatcagtggcggcctggcagggggtgcagggtgtgcagtgtgCAGA GCTTTTttaagggggcgccaaaattttttcgatNacagggtgtgcagtgc accacccagaaagatctgagaggggcgccaaaagagcttttttAGGGGGG Gcgccaaaaattttttgatgtttaattgggcaatttggcgccctttggca cgtttatagcgccttctatgagtacaatgttattttttttcgcctGTGGC CCCTTATTTTACCCTCTTGCATCCTTTCTCTcttgatttttatcaaaact tctatcaatattgaatcagaagtagagaagtgttgtgtttccaccagggg ttaaatcacctccaaaatgagagattgccaaaatgatcaaaacttgttga ttcTCGCTGTGGTGTTGTGGTCTTATACTGACTAACTTTATccgttttag aagatctttcaagctgtttgacctttcttacaccaatttTTTTTGCCCGC GGTGCCACAATTACAAGGAACCCTTCCTCCCGACTTctgaatttttgggg cctctttcaggCATTGATCTTTAATAGAGAGTAAAGTGAGACCAGCGGCG CGAAAGTTTAAAGATTACCtggtaatttttctgataatagttttagaaag caaaaatatagactaaatcgacttaccaggtataaaatttccatttcaaa gattaggggcgttactttcaaacagtcactgctcttacagtttaatattt tcacttaatgatggagggcgctaaataaggacaaaaatactaggggcgcc aatttcatagtttgcaccaccaagaaatttaagccaggccgctactatAC AATAGCCTTCGTCGTGGTTTTCTTAACTGTATGAtagttttgaaaatatc aatGTAAAACCTTATTTTACAATCATAAAACATATTTATtcaggaagaaa agacacttttttattctgctaatGGTAGTTTCATGCTACTTTGGTGACAA ACTTCAGACAGCAAAAAAATCTTTATACACTTTCAATTCATTTCACAGCC TTTATTTTCCGTTTATGAACCTTATATATGTAAAATATGATACAAGTTCC TATAACATCGTtccaagaaagaaaaagaaagattctgggtaattaaaata taagatatTTAATCcaaataagtttgcgtttatcgacccagtacagtggc gtggtgggaaaatttctctggggttGCCAAGGCAAATATGGTGCCCCTCT CCatacgctcattatgaacacaaaaaagggagtgtgcgagcgaagcgagc cagaaaattttgagtttttgaggtgatgaggggcgccatttttgtttttt taNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNCCCCTGGCCCCCCCTGCCAACACGCCA CTgcccagtgatattcatattggaagtttatcgtggcttggatcacgaga aaCAAAAatccaaacgtaaatctcgtgattcAAGCCAcaataaacttcca atatgataTAAGAAACTTTTAGAATAAGAAAACAGCCAAGCCAAGCAACC AATAGCTAACCTGATACTGCCAATCAGGCAAGAGTTTTCTGGCTATATTA AACAATAAAATCTACCCTGTTGACTGGGCATTGAAATAAACCGATCATTT AGCAAGTATTTTGAACGGCAaataaagtaattgaaaagtgaaaagtatTT AACGCCGATAAGAATAAGAAGAAATAATTTGGTTTAATTCCTTTGAAAAC ATGGCATTTTATCAACATTGTTATCACAAGAAAATGAGTGCCATCACCAG TTACAGTTAGCCATGAAACCCAACTGACTGGCCAATGGAATAGTTTAACA GCGTCCATTGTGATTAAAGCCGAAGATGCATTTGCAGTGTGggttttatt ataagaataaactatacaTCTTCAATGAcccaaatattaagaacaagtta gcaACATATCAAAAGGTCTTTGTGGATTCTAAAACACCATATGTCTAAAG AATTTGCACAAAAATACGCACAAAAAGGTGTAATTAAgaccattttgaat atttttaggcttaaaactcaataatatatttttattttatgccTTGCAGA GCAGCACCGTTATACTGATTGTATAACGGCTCTGCCGCGCATGGCAACAC AAATTTTTCTATGATATGTGTGTTCACAGATGCTTGTGATTAGCACAGTT TTTGGAATAAGGATTGTAGAGCTAATTTTATGAGGTGACCTTAGAATATA GACTTGTAGATTAGTAGAGTTGTGGAAAGGAAATTTATATACAAGAAAAA ATCAGAGTGTAGAGATTGGTAAAAGGAACAGAGTTGGTGGATTGTGCCAG AAGAGTTTTGTAACAGATCAGGGTGTGgagattggtaagagaaacagGGG TGGTGGGTTGTGGCAGAACAGTTATGTAACAAAACAGAGTGTGGGAATTG GGAAGAGAAACAGGGGTGATGAGTTGTGGCATAAGAGTTATATAACAAAA CAGGGTGTGGAGATCGGTAAGAGAAATAGAGACAGTGGCTTCTTTTTCCG ACGAGTCGATAAGTATGACAGTGCAAGAAAAGAGATTTTGCCATAGCTGG CTGGTTGAAGGAAAGACTAGTGACAGCTACATGTATTGGCATCTAGATAT AGGAAAAGACCCTGGCCACATTAGTTTAGAAAACTAGCTCATATACATTT GATTCTATTTCTAATGACGTTATTCCCTTTCAAATGTTGGATGTGAGCTG AGTAAACGAATCCAACATGATCCAACAcgaaaaaaagaagtaaatgttgg acaaaatgtttgatggcgatcaaactcCCACCCAACatgattttttcttc ctttccgATTTTTGCATTCgagtaaacgattccaacattccgTCCAACAG AGAGAAAATGGCATGTTGGATAGAATAttggaatcgtttacctcgGCCTT TATGTACAGCAGCTGACCctgagaatgtagtaaaccccgagaatgtaggt ttctcattttttagcattgtagccctaacgatagttcaacttcataaaat aTGTTCACTGTTACATATTACTTATTATCTAagtacataaaattttaact tgaattaatttttttcaacgaaaatctgaattgaagttgattggatacta cccgAATTGAGGCACTTTTTAAATAGATCCTCTctaaatcaaaatctatt ggaattaagttatgatgatagggtattttcttacacctaatgaacaaaga aaatggggaaaatagttcgtcatttcaatatttattgttctaagctagat attttgacgaaaatgcttgacctaccgggtgcaccacaaaaaagtttctc tccttgaaactaattttctcgaaatctgaaagttttaaaagaaccattcc tatttcattggaaagaagaaagatagacttaaattttgatgggtcattta ttaaatttgattcattagatcaaaagttatgctcaattgaatagaaaagt tactttcagaaagtgctgaAAAACGCACtaaatagaatctcgattgaaCG ATACAGGTCAATATCTGATTTCGGTCTTTGCTTTTCACCGTAGgtactta aaaatcacttgcggttttaaagttttaagaTAATTCCCCTTTTGTGGCAA ATAATTCGGCATCTAAAACGTATCAGGACACTTtagttttatgacatttt ctcaGTATCTATTTATTCTATATACGAAAGTTATAgtgttaaaaaagaaa taaatattatTTCAATCTTTATATTATTAGTTCTTAAACGATAATGCACG TACAACTTCCATAAGAACTACAAAAATCTACTTTCATATACTGTTTAAAT ACTGctacaaaatctaaaaatgatgTTTATTATAATTTAGAAATGATACG TTTTCACAACGTAATCATTTTCTTTAAGTAACCATTTGTAATCCAATTCC AGAGACTCGATCAAAAGACGGCTCAAGGTTTTTGGATTCCCATAGCCGCT GTACCGACACAGCAATGTTTGTATCTGCATGCACCAGTAGTCCGGATACA TCTGTAAGTATCCCAACCACGTCGACAACAAACTCCGTCTTTACCGCAAA AACCTGTCGAACATTCCCCATCTTTCTTGTTACATTTCCACCAGCAATTT TTACCTGTATGAGAAAACAGAGTAAaacatataacgttagatgaacgttg aaagaacATTGGTTGGTTGGAATGGGAAAATGAATTCGAATTTCTGGTTC TAAATATTCTTTAAGTTATTAAGAGCTTTTTTAGAACCACTTTTTCAGGA ATAcatttgacgctctctaattcgatgttctaCTATTCCATAATTTAAAG TCACCGCCGAAAAGAAACTATTAAAAACGATACTCTTTTACTATTCAATA GGCTCCCtactttatgaaaataaaatttccctTGAAATTCAAGTTAGAGA GTGCCAACTGTATTATGCTAAATCTACACCGAAAGTTTCAAagacaaaaa gtcaaaatcttcTACAGGGCATCccgaaaaaaagttagtatcgAGTCGAA CCacttctacagggtgtcccgaaaaaagtatcgagacgtaccacttctat acagggtgtccctaattaaagtatcgagtcgaaacacaactatgagtaga aagttttatgtgcgtgttcacaaaattgtattttaagctctccctctttt NNaagaaagttcttgtgtgtgtttaactaaatttgctatttttatcaaag tttttctctgtgtcatattaattgtcacgagacatcttttatgaataact tttacaaaaaacaattctcaataactttaacgtcatgaaaattgtaaaga aagttaattcttttttatcataatgatgactgttgtaaaaacaattattg tggTGGTAtacattttcttacattttgttaaacacacgcaacaacctaCT ACTCAGAATCATATTCGAACACGtaactttttttcgggacaccctgtaca aagATTGGTGTAAATATGAACCAACCGCTATTTTGGACATCTCGTCTTTT AGTTGTACAACAATGCTTCCCATTGCACGGTGTGGCCATTCCTGCGCACC CAGCATCATTCCATCCTCTTCGACAACAACGCCCGTTCACGCCACAAAAT CCAGGACAGTAACCACCCTTTCTACCACACTTCGACCAGCAATTTGAGCc ttaaatataattttgttaTGAAAATACAGAACTGTAGTATAAAGATGCAG AATTTTGGCGCCTCATTTCTCATGCAAGTTAACGGGACCCTCTTTTGGAT AGCATATTGTTTTTGTTGCAGGTAACTTCAACGTTTTATAAAATTACTTT GTTCCAACACCAAATTCGACGTCTTGTATCCACTGGCTAGCTATTATATT CCCTGAGTTTAAATGAAGGGAATATCTAAATTTCTGCAAAATTCTTAAAA CTCCTAATAGTTTTAAGGTCAATGAAAAATTAATCTTACCTAGGTTCTTA ACAAGAGCTGGCTCAGTACAACAGTGCCTATTAACGCAGGGGAATGCAGC GTCTTGCCATCGACCCCATCCTTTTCGACTGCAAAGACCTTTTTTACCAC AGAAATAGGTAGGTTTTTTCCAACAATTTTGTCCTTGGTTTCTTAaatct aaaaagaaagaaaggtggtatattatttttattttgaaaacaatctGGGT TCTTGGTAAGGCACAAAGACAGGGGTAATAAgtttaaaaaaacatcaaaa gacaaagataaataTACAACGTTTGGAATTTCCTTCCTTTATCGTCAACA TGAGAAATATGagaaatctgattggctaaaaacgcatCCTCATTATCATC ACCTAGGTCGGAAACAAAGANTTACCACACTTCCACCAGCAATTTGAGCC TTAAATATAATTGTGTTATGAAACTACAGAACTGTAGTATAAAGATGCAG AATTTTAGCGCCTCATTTCTCATGCAAGTTAATGGGACCCTCTTTTGGAT AGCATATTGTTTTTGTTGCAGGTAACTTCAACGTTTTATAAAATTACTTT GTTCCAACCAAATTTGATGTCTTGTATCCACTGGCTAGCTATTATATTCC CTGAGTTTAAATGAAGGGATTATCTAAATTGCTGCAAAATTCTTAAAACT CCTAATAGTTTTAAGGTCAATGAAAAATTAATCTTACCTAGGTTCTTAAC AAGAGCTGGCTCAGTACAACAGTGCCTATTAACGCAGGGGAATGCAGCGT CTTGCCATCGACCCCATCCTTTTCGACTGCAAAGACCTTTTTTACCACAG AAATAGGTAGGTTTTTTCCAACAATTTTGTCCTTGGTTTCTTAaatctaa aaagaaagaaaggtggtatattatttttattttgaaaacaatctGGGTTC TTGGTAAGGCACAAAGACAGGGGTAATAAgtttaaaaaaacatcaaaaga caaagataaataTACAACGTTTGGAATTTCCTTCCTTTATCGTCAACATG AGAAATATGagaaatctgattggctaaaaacgcatCCTCATTATCATCAC CTAGGTCGGAAACAAAGAATAACCCTCAATCCACAGTTTGCGATCAGCCA TTGCAGTACTCAGTTCCTCAATCTCTATTCCTGTTTTTCGTTTCAAAAta cagggccggcgaatcaattttgaaagtggaggggccaaatagtaagtgtc taaggaggcgccaccatggttgggcctttcttagcaaaaaagtggggggg ggcatggccccCCGGCCCCCCAGTTTCGCCGGCCCTGAAATATCAAGAAG TGTGTGCTTTTTCGAGCGCCTAGGGCCAGCAGGACACCGAAGTAGGATTT CAGATACGATTTCATTTGGTGCACGGAAACATTGACCTGAGAAAGAGTCC ATGATAGATCTCGTGAAGGGTTGGGTGGTTGCGCCAATCAAGATTCTGTA TTCTTTGCAAAAGGTTTGTATAACAGCCATCAGGCTCTTCAGCATAGTTT TTGTCATAGTCCAAGTCTCTGAGCCATAAAGAAGAATGGGCTCGACAAGA CTTCtaaaagtttgaagtttgaGAGCGTTAAACAAATTAGAGTGCCCTAT CTTGTTTAACTTATTACAAGCTTTTCAAGCTAGACTAGATCAAAGATGGA TTGATCTTAACTTTTCGAAAACCacctaaaaacaacaaaaaagtcgACCA AAGCAAAGttttaagttgtatttttttactaaacaaatattctttgattt ctttcccatttatgacgttctaagattaaagaacctctgatataaaaatg aagatcacaGCATTAATCTAtaagaagttgattttattcttcttcttttt tcatcttcttttttccatttttttaaagatttttcttttttgcaaatATT CCACTCTGGATTATCTTTCAAACGAGCACAAAACTGttttctaattcgaa ttctatcaaaagttacagccttttttgtctcctcTGCAAactatattgag acagacttcaGTTTTAATCAGATTTTGGTAACTTCTCTCAATGTCGTCGT CTGCTTGAGATATAAAAACGCATATATAAATGCTGTATTCTATATTATTA TATACaagtaggcaaaaacagccattgaataattcctgatacaccatggc tattataccacggtagaatttttttttcttcaaattttgctttcaaagtt agattcttttaattaagaaaatcattaaaaaagaaaaacattcgaccGTT CtattatgggagtgttttatgtGAATCGTTTGACTATTTACAtaatttca gttttgtttttgcctctaggtatataataaaacatatattcgataggttt tcgttggctattggatttattaaccctcggtgatatatattcaactcggc ttcgcctcgttgaaCATTACATCGACctctagcccggggtccacttaaag ctttttgatagactggatggcgcgattaagtggcccagtagtatatggta atatgtttttgctttggcggactgtaaaacagtccgccagatttttgttg tttttggaaggtaaaaacagtatgaagcaatatttttatttgagaataag ggattgcataTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNCAGGGTCacctttttcgcaaatttcgagtcccacgtag ggtccatttttcgaacctcagcggagcacccccgtcggtcgacaagggta gtaccccccccgggatcTCAATAACCaatttttacctattgaatatctgc ttattgtACCGTACACATACAAGACCGCGTTcaaaaaggggtctggtaag cgagagatcatatttggatttatttttgtaTCTTATCCCGAAAGTTATTC TCaggaatgttttcttttttcctctCAATACTCAcaaaaattatttatat tttaatattttaatgaGCATTCGAATCATTTTCGAAGATgttaatgtttt gatgttgatttgtgaaaaaacaaaacaaagaagagAGAGAAGACAAATAA AATGGAGAGAGAAaagtttgttaatatttttcaagttgacgataaaccag ttatcacacttttactCGTACAATATAGGATAACTACTACTTATTTCATT GATAtttactagcaagtagctgtcgctatgaatgccccgcgaACGCATTC ATAATCGAGAATGAACGTTTGAAGGCCGCATTCCACCAGATCGTTTTATT GGAGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNcagggtcacttttttcgcaaatttcgagt cccacgtagggtccatttttcgaacctcagcggagcacccccgtcggtcg acaagggtagtaccccccgggcaagtagctgtcgctatgaatgccccgcg aACGCATTCATAATCGAGAATGAACGTTTGAAGGCCGCATTCCAACAGAT CGTTTTATTGGAGCGCCATCCAATAAGCGCACAGCTACAAATTTCTATTC GCTGTACCGAAAGATATATGGCtgtttatcaaaagttattgatttgattc ttatgaaGTAGGTGCTTATAAGACAAATAAAAATGCTCTCATTGTGCACT GTCCCtggtttactttataagaactatgCCAAAAGGTATAAAGCTGTtga tcaagagttattgatctgAATCTTATAAactagatgcttataagaacaat aaacaggctcatattgtgcactgtcccttgtttactttgtaagagctaat taccgaaaaatGTATGGCtctttatcaagagttattgatttgattctttt aaagtaggtgcttataagaaaaatcataagaaaaataaatatgttcatat tatgcgccgtcccttgtttactttgtaagaactaattcacgaagggtata tcaccgtctatcaagagttattgatttgatgcttataaagtagatgctta taagaaaaagaaaaatgctcatgttatgcgccatccattgtttacgTTGT AAGAACTAAAACGTGAGAATTAATACAAGTCgcaacaaaatagataaaat gaTAGGTGCGCGCGAGCATTCTTTAACCGcggcggcccgctcagaatcga aagaaacaacatcatgaacatgaacatgaatatttttctggcaaACAAGC CCACTGCGAGAatcaacaaaagcccctgcggggcaattaGATAATTTTGG CCAATGTTTAGGTTTGATACAAagtattttaaaaacaatttaggCAATAT AcactcctgtgtcacagacctggtgGGACCCCCAACTCATTGGAAGATTT GACCGAAATTTCGTCCCCCgtgggaaaaataccccaaaaatttcaacccc actgagAAATGGACTTTGTTTTCATCCCTATTTATTATTGAAcggaaaaa attgcactccaaaaccatcaccACTGGATCTTTTCACCTTAGAGCAATAG AATTACTATCctcattgaattcatttggattTCGATAGAACTTCTCATCC CCGCTACGGGAAAAAGTTTCATTGGAGCTGCGAGACAGGGTCATATATAT ACATCTCCTACAATAAAATACACTCAATCAAAAGTGATTTACACCGTGAT TTAAAAAGAATACCTGGAATACACGCTCCATTGTTGCAGGACTCGAATTT GATTTTCGGTCCTATGCATGATTTTCCGCCAAAAGCAGGCTTTGGGTTAT TGCAATTTCTTGTTGCTCGTCGGCGCCCTGGACCACATCTTCGATTACAT GCTCCGAAAGATGACCATGTACTCCATTTTCCATTAACCGGACACGCTCC ATTGTTGCAGGACTCGAATTTGATTTTCGGTCCTTCGCATGATTTTCCAC CAAAAGCAGGCTTTGGGTTATTACATTTTCTTGTGAATCGTCGGCGCCCT GGACCACATTTTCGATTACATGCTCCGACAGCGGACCATGTACTCCATTT TCCATCaactaaaattgattttaaaagattgtTAAGAATAGTTTAATTTG ATAAAGACAATATAGTCGCCAAACACTGAACTTTTAAGGGAACGGTTGGG CCAATTTTGACTTTATTGCAAAttctttcaaatcatttttaatttcaata aatctaaaattGTAGGGAATGTTCTTTATACTACTGAGTATCCCTTGCCA TGGCATAATGTCAAAATGATTCACCTGGTATAACTGAGTGAAAACAAAAC AGAGCGTTGTATGGTTCAAATCTCTTATTACTAATTGTGTCTTTTCAGTA AACTAAAACCTTTGATTTGTTATAATGTTATGGCGAATTAAATTCAAcaa gaacttttttttgggggggggggcccttTTTGGGAGTTTAATCAGAGAGC TTGTTTTCGCCTTGAAATAGCAAAATCTTATAGGTTTAAAAGTAAATCGA GATTGAATATTTTTCAGATCGTTTTTTCACCCATTCGTTTAGTTTGAGCT TTAGCGTGATGAACAGAAGACAAATCACAACCTGATCTCAGGCTAAATGC AATTTATACATACCTACTTTTGCATAAATATAAACAGAATCAGTGGTACC AATacaattttgacctttttcacAATGATGAAAGACTGTGTTGATACATT TCTCGTATGAAGTTTGACCAGGATAACGACTCCCGTGATCCGCAGCCTTA GTTTCAAAACATTCCTCGTAGTCGGTTAGAACTAGTGCTCCTTCTTTTGC TTTTGCTGCACAGTCACAAGCCAAACTGTAATTTATAATAATAACAAGAC TTTAAAAGGCTCATacataaatgcaaaaaaaataagatttaagGACAAAG CTAAGCCTGGCGATTATCGGAGCTAAAAGGCAGAATAGTGAAAATTGGCT GTAAAGAATCCCTTAACTCGCCGGAAGGTTTCATTTCAACCTGATCTTTT AAGCTATGActatttgaagaaaaagaaaatacctCTTTATTGATCCATCA CCATAGACTGGCTTTCTCATTATGAACTTGGTAGGGGCATTATCATTCTT TGTAAAACATCCAATACGGCTTAGTTTGGAACCATTACCACagtctgaaa aatatttgagatcatttcaactttaaaggagagaaaataattaaaaaaaa gttactATTTGGTAAATTTCCagtcaattatttttcaaactaactattga aaaacattttttaaggaGATATAGGTTGAATTTAGAGCTAATTTTAACAT ATTTCTAAGggttctaggaaaattgcccccgagaaaattgccccccggaa aactgcccccggaaaattgccccccggaaaattgccccctaggaaaactg CCCCCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNCaattttctcgggggcaattt tcctgacaCCATTTCTAAGTACCAGCAGCTCCACAGGTCAAGTTAAGATC CCCTACTAATGACCTTATTCAcataaattactcaaaaatttcctaacatg aaaaattatttcaaccATATAAAGTTCTGAAATCAAATTTGAGATTCCCT TCAAATCAACCCTTTAaatgccaatgtcgtatatatcagacatgggctgt AATGcacagtttgagttagaaatcatCATTGTTAGTCTAACTCGTatgaa ttggattgggcttcatggtgaagcaaaaaaaaaaatcaacaggGAGCCTT TCCAGCGatattttaagccaaaaagtcaaaaaaatgcaaagatttgacaa aaatccactcttttaagattttgaccgttttttgatcATNTAAAAAAAAT CAACAGGAgcctttccagcgagattttaagccaaaaagtcaaaaaaatgc aaagatttgacaaaaatccactcttttaagattttgaccgttttttgacc atttttggtcaacgagtgatccaagaaccaccaaatttggccctgtttta cttgattctgtNtcaacgagtgatccaagaaccacCAAATTTAGCCCtgt tttacttgattctgtcctccagcgaattaattTAAAGTTTTACCATTGGG CATCTTTCTATCATTTAGACAGGTCCGCGCAGCCCAccccgcccttccta aatcgggcggcctCAAAGGTGCCttaaagaaagaggagactccaAGCTAT CAAACGAGCTATGAacaagcttctaactccttctagatctcgagatataa gcctttaaagttttaactagtgattttctttaaaaaacttagaaaaaaat gaccatGGCATATAAAGgagggggggggtttgtaggggttcgaaataccg ttttcccgtcaaaatttttgctgaatcccggaatcccgaaaattggaaaa ataataacaccgtcacacNtttgctgaatcccggaatcccgaaaattgaa aaaataataacaccgtcacaccggcttgtacagggcgaaaatgtacctaa ataccgtcaccgtctgattttgaaataccgttttcccgtctcttttttcg tcaaatcccgtaataccgtactaaaaaagggccaatcccgccACACCgga aaagtacaaaccccccttaTAAAGGGTTAACAATCTTCCATATCATTTGG TTCCTTGATTTCTCTCCTCGCCCtgtgatttgaaaacatttaaaCTGATC CCTATGAAGGGGTTTTTATAATAAACAGCCTACCTAGAATGTCTGCAAAA CATCCCGATGCCAAATAAATTGCGATGAATAATTGCAACATCATGATGTA CTTGATTtctaaacaatagaaaatataGAATTCAGCCTCACTTTTTAATC TTCGGTTTGGGTTTAtcttatacgtttttttatgaacaaactttataaga acataaggctttgcggactgtaaaatacccaatttcttaggaaaatggac aaaaacacttggtgaaaataagaacatgtaaaAAAAGCTTGTACCTTCAT TATCTCAAGTCCTATGGAAATGTAGATATTATGAATAGAGCTCTCATTCA TTTCATCTCATTTTATCATAGAGCATCTCATTCAGAacttcagaaatttt caaaccaaaaatatctcaaaatgttTGACTAGCCTTACCTTTTTGCTTGT CAATCTTGCAATGATGAGAAATGTGCATTTTGCTAAATGCTATAACGAGA ATTTTTTTGATCGAACAAAGAGCCACAAGCTCTCAACGTTACAAGAACAT GGCAACCAGGGTGAAAGCATGCTCTATGGTTAAATTATGAAGCATGGTAA TGCGAGAGATCAAGTCTTGACGAATTTTCAGTTCGCCTTGATAATccaca tttttttattaaacatTGCACACgctgttttatttataagaacaatttta taacaaCACCAGCCTCAGTTTTAGCCCATCGGAACAATAGCTATATTGTT TGGAACattataaataaatttaaaaaaaatcttatcctcaaccaaaattt aatggtttttatttaaaagaaagcGTGGAAACTGATTATACATCTGTGTC AGTGATCCAGGTGATTTTGAACCTCGTTGCTCTAAtaaattgtaaaatat aaaGCGTTTATAGTATTTTACGAACTGTCGAGTTTTCATTAGGATGAGCA AACATTTTCCATGATCTTTAATGAAGGTCATACCAATCAGATcacaaatg agaaaaataaaaaaattcaatgaaaaactTTCCTAGCTGGGCCAGatgaa tttgataaaaaaattgaaaactagaaatgtaattttattcattaattgac gtttcggtgtcttctTTGCACCTAGCCTAgggatccatgctatgatttct tattctatatactgatggtgaaatatatagcatggtatagACTgggagtt tgaatttcccagatcctaataacggttgaaaacatagccaatcaaatttt gttattcttttgctggtcacactttcttagagaaagcgcaagttccgaaa tttggtttttattttagtaagtgaggacagcgctaaattcgaattttccA CCGTAAATTTTTTGAAGCAGAAATCTTCCCCTCACAGGTCATAtccgtcc tgtatacatcagattataaaaatacaggacgggtatcCTGTCTACTTTGC ATGCTTATACtcatcaatttttaatttacaagctttttcacattgacttg acacggatgtggagcaagattggtcagagaGAGGANcacaagctttttca cattgatttgacacggatgtggagcaagattggtcagagagaggaaaaaa acaacagttttttgcttattcagcacaatataacaatagggagccACCGT CCTGGTGCCTGATATGAAAAGGGAACGCTTATGTAAAAATCCACTACATC TTCGAGCCGCTTATCCCTATAGTATATTATCATCAAGCTGGACATAAAAA TCTTAATCAATAATTATTTACTGTAACTGATGAATACTTTATGtatcttt ccataggatatggCTTCTCACCATTTGAATCTCTATCTGACTACGAAAGT AATGCATTTGAAAAAGATGGTAAGATTGATATTTCAACGCATTGCTTTAT GAAACATGTAATTCGATTGATGGGAATCAAGGACAACCCTGGGTTGCTGG CAACCACCAACGGATTCGTGGTCCTTGTAGAGGCCCGGGGGGGggactcg attttgaaaacgaccgtacgttcggccaaaaatcaggtctctaaaatcag acccttacagtgcaggaaaaatttggctgaaaatcgacccttatagtgca attgttcgaatttttttgcccttttcagggcaaaattttttgaaatttct caaattttacctcaagaTTTggtattttctaaaattttacacccttacag tgcactttttcccacttgctcacaaatcaacccttacagtgcactttcca aaaaacctacccttaagggccgcacgtcaggtaggtcacttacctggagt gccccctCCGGGTGTAGAGGGAGCTTATACTACATGCACTTTTGTAGAGG ACTTAGACCAGGACACCCCTATCTTTGTGACGCAACTCGTCCCAAGCCTT TTTCTTTTGGAACCCTTATTctcatcaaaaaagaaattctagaTTTTAGG TTAGATTCTAGGTTTTAGATATAATTTTGCACCAGATTGGAATCCTAAAT TGAATCCTATCCTACACCCCTTTTTACAGACTCATTGGGACCCCTATCCC ATCGNTCCTAAATTGAATCCTACCCTACACCCCTTTTTACAGACTAATTG GGACCCCTATCCCAtcggaaaaattggccaaaatatccccagtggaaaat tatactttaatttttgtccccactgacagtaatcagataagcaaatcctc attacaaaatattgtgctattttctcCTTCCACACTggttataaaaagtt ataaaaaacaTCAGAATATCAATATTATCAATACCTACTCCATcaagttt tggtccgttattttcaaCCCACTAGCTGGTCTGTTATTTTCACccctact ggctgaaaaaaatcctaccgggtctgtgataaGGGAGTGTGACCCTACAG GGTATCTCAACGATATTTACACCTTTAAACTGTTTCAAAGATCTTTGTCA Gaccttgttttttttataaactttatgacttcttcataaaaaatacctta taattcttttaaagaatatttagACATAATTGACGACCTCGATCACGATG CAGAAGCCAACTTCTATGATGCAAGTATGTGAAGTATTTCCCTAGAATCA TATTGTAATGTGAGAGAAATTCCCTATTagtgaattttaaaaatcagaaa atgtttttttgccaCCGATATTTATTATGGTCCTGTTGTAGTTCACTTCG TGGAAATTCGTGTCCTTTTGTAGAAATCTTCGATTTTGTGGCCTGATCTG GCAAGATTCAAGGTTTTATGTTGTTTGATATATTATAGTTTTCCCCACAT TACAGGCCCTGTTGAAAGATATCGAATCCAAGATCCATTTGAAGATTATT TTGATGTATTCAAGAGAGCATCGAGTAAGGAATTTTACTTTACAATCTAT TTGGTGATTTGGTGAGTCTTTTAATAACGTTCATGCTCCAAACCGATAGT TTCCATGTAAAATCTCATTTATACCCAAATTATGGGAAGCTAACAGTGAT AATATCGAGATTTACAGTGGCTTAGAGATTGTTTAACCAGAAAATCCAGA ACTCGAATTTATTCCGACTTCGAACAATTCTTTGCCCCTCTTGAACAAAC ATTGTTCTTCGCCACATCGTGACTTAATAAAAAAAGGAGGGGAGGTCAGA GCAttcgaaaaatatttgttttgtgtttgttaacCTCTCAAAAAGGAGGT ACATTCTCCATAACGTTGAATTGACACTCCGAtacaatattttgaatatt ttttcagaATGCAAAGACATATTTTCAAACTGTGCACAGTTGACAAAATA TTGCAAGAAAAAAGGAAAGCAATTCAAACAGATCAGAGCTGGGTGTAGAT TATCCTGTGGATTTTGCAAGGCACCAAAAGCCCCAGGTATTTTATAGATC ACTATCACTTAAACATCTTAAAgatagaattcatgatattcgtggcgcaa tgttttatacggaagcgcCCAAAAAGAGACTGAGTATATGCTaccaattt tgaatttaaacaataaaactagtaGCCATATGGCCCGGGCTATTTTAGTT GCTTATTCGTCATTACCTCATGAATATCATGTATCAATAAGCtctcacaa aaataaaaatattatatatagcCCAAGTTTGAAAGTGGTTATTAACCACA TTATTTATTCTTTTTGAAATGATGGGGGGGGGAGGGCAACTAATCTTACC GACCGACAGGGGTGTACTGCTGAGATTCGAAAAACGggccctacgtggga ctcgtttttttcaaaaatgttggcaaaatttgcgaaaaacgTGACCCTGA GTGGGAccgaaattccaaaatttcacaaattacttttttctccaaatttc acaaaaaaggtGAGGGAAATCCTATGAGGgattgatttttctattttagt tttttttcgaCCAGAACTGGGACTCATGGAGGTGAAAAAGGTAGCCTGAC CAACGGTTCATCCCGTTCCCCTTTATACCTACAATTCTCATGTTCTGTTA CAGCTTATGTGAGCGCGAGACCAAAGATATCATcgtctgaaaaagaaaag atcaaAAGTAAGTGAATAAATGTTCTCTGTTTTCACGTGATATAGTCTTC GAAACCTTGTGATAAttcggcgtttgtgtaaaagcCGCATGGGCCACGTC ttttgaatgggaaataagtatGACTCCATATCCCATCCAAAAGCATTATC TTTAGCAACTTGGCGGCTTAAAActcattttctcaaaatgcataaaacta TTGCGGTCGTCTTTTAAAAGAATTGCTTCCAATTACTGTGTGTAAATTAT GTTTGTAATAACTATCccatttgaaaacgaggcctgcATTGACGTTGATT TATCGCGAGAAGTATGCGCGGTCAAAGTAACAAGTTAAGTATACAATCAC AAATAGAAAGTAAAtacaattttacaaaatattattttacatTGAAACAT ACAATACTGTATCTATATTACTATCCGATCCTTTGATACAGGAACATGTT TGAATTCTCATAACGCCAAGCGCCGCCTTCACCAAAAGACACCTCCTATG GTATGGAGTCAAAAATTGGCTGATCGTGCACAAACCTTTGCTGAATNCAC CTCTTATGGTATGGAGTCAAAAATTGGCCGATCGTTCACAAACCTTTGCT GAATATCTGAGTGCCAACAACAAGTTTGAACATGATTCGTTCAGGAGGAA TGGATTCTCCAGCAGTATTGGAGAGAATATTTACAAATCATCTTCTAGTA GCAGAATATCAGAAAATGCAGTCACAGCTTGGTATGtgcaagttttttca aatcatttcatcTGCTCCATAAATGCAGCCCTGTTTTAGTGAAGTCTATT AGGATAACAATCGACCAGATAAAATAGGAAATTTCACTTGCTCtgatttt aaaatctgaaatttctacctcaatttttaatttctacCAAGTGgcataaa aaattttgaaatatgccAACGTGTTTATAACAATGAGGGTAAGGGAAAGG TAGCGGTCAAAATCTTACATCGCAGTGATTTCAAAATACATTTCTTCTCG TCAATCAATCATCATAAAACCTTTCCATTAAATTTCTCGACCACAAATCA TGCACGTGATGTTTCAAATTCACAAACAACCACAAACAGTACTACCTCTC TAACTTGGTTACCTTCATTATCAGGTACAACGAAATCAAGAATTACAGTT TTGGAACAGGCGGCACCAAGGGCGGCGCAATTGGGCATTTTACACAAGTA GTGTGGGACAGATCTACCATCTTAGGATGTGGTGTAGTGAAGTCTTCAAG AGGAACCTGGGTAGTAGCCAGATATGAGCCTGCCGGTAATTTCAGAGGTC AATACAAGGAACATGTCCATCGATTGAAAAACAGCGGCGATGCTTTtctt gaagatgaagaagaaatggTTTTGTAAAgattgagagaaaaaaaatctta cNCTTtctttgaagatgaagaagaaatgaTTTTGTAAAGActgtgagaaa aaaaatcttaaacaaGCCTATGATTGAGGAAACATATAGAACAATGAGCT TTAGCAGTAACTATTTAAGCGTATGGTATACTTcgtactgaaaatattaa ggATTTAGTTTGTTAGCAGTAAAAATCTTaggatgaaaaaataaaattta aaatttcgaataaaagttacaatatttttttttcttttattttgactgaa taaatatatttttgaaaatctttcacaTTTGTGACGTTCTAAGatgtaag attttttatatGAAACCAAGTTCCTTGATGAAAATGGG

Coding sequence (CDS) from alignment at sc0000012:160968..183255+

>TCONS_00001767 ID=TCONS_00001767|Name=TCONS_00001767|organism=Clytia hemisphaerica|type=CDS|length=5040bp|location=Sequence derived from alignment at sc0000012:160968..183255+ (Clytia hemisphaerica)
ATGGACCAAGGCATCACTCTCATCTGTAAGGTCCATGGAAATTATGCGGA
TTACTGCAATAAAGATGGGTGTCTGTTTATATCGATTCACCATATTACAT
TACAATTCTGCTCAAGGAAGAAAATGTGGGGCAAGGCAgtaatgaaaatc
tttttattttttggtgtGCTTGCCACAACCCAAGgatatggCTTCTCACC
ATTTGAATCTCTATCTGACTACGAAAGTAATGCATTTGAAAAAGATGaat
atttagACATAATTGACGACCTCGATCACGATGCAGAAGCCAACTTCTAT
GATGCAAGCCCTGTTGAAAGATATCGAATCCAAGATCCATTTGAAGATTA
TTTTGATGTATTCAAGAGAGCATCGAaATGCAAAGACATATTTTCAAACT
GTGCACAGTTGACAAAATATTGCAAGAAAAAAGGAAAGCAATTCAAACAG
ATCAGAGCTGGGTGTAGATTATCCTGTGGATTTTGCAAGGCACCAAAAGC
CCCAGCTTATGTGAGCGCGAGACCAAAGATATCATcgtctgaaaaagaaa
agatcaaAAGAACATGTTTGAATTCTCATAACGCCAAGCGCCGCCTTCAC
CAAAAGACACCTCCTATGGTATGGAGTCAAAAATTGGCTGATCGTGCACA
AACCTTTGCTGAATNCACCTCTTATGGTATGGAGTCAAAAATTGGCCGAT
CGTTCACAAACCTTTGCTGAATGGACCAAGGCATCACTCTCATCTGTAAG
GTCCATGGAAATTATGCGGATTACTGCAATAAAGATGGGTGTCTGTTTAT
ATCGATTCACCATATTACATTACAATTCTGCTCAAGGAAGAAAATGTGGG
GCAAGGCAgtaatgaaaatctttttattttttggtgtGCTTGCCACAACC
CAAGgatatggCTTCTCACCATTTGAATCTCTATCTGACTACGAAAGTAA
TGCATTTGAAAAAGATGaatatttagACATAATTGACGACCTCGATCACG
ATGCAGAAGCCAACTTCTATGATGCAAGCCCTGTTGAAAGATATCGAATC
CAAGATCCATTTGAAGATTATTTTGATGTATTCAAGAGAGCATCGAaATG
CAAAGACATATTTTCAAACTGTGCACAGTTGACAAAATATTGCAAGAAAA
AAGGAAAGCAATTCAAACAGATCAGAGCTGGGTGTAGATTATCCTGTGGA
TTTTGCAAGGCACCAAAAGCCCCAGCTTATGTGAGCGCGAGACCAAAGAT
ATCATcgtctgaaaaagaaaagatcaaAAGAACATGTTTGAATTCTCATA
ACGCCAAGCGCCGCCTTCACCAAAAGACACCTCCTATGGTATGGAGTCAA
AAATTGGCTGATCGTGCACAAACCTTTGCTGAATNCACCTCTTATGGTAT
GGAGTCAAAAATTGGCCGATCGTTCACAAACCTTTGCTGAATGGACCAAG
GCATCACTCTCATCTGTAAGGTCCATGGAAATTATGCGGATTACTGCAAT
AAAGATGGGTGTCTGTTTATATCGATTCACCATATTACATTACAATTCTG
CTCAAGGAAGAAAATGTGGGGCAAGGCAgtaatgaaaatctttttatttt
ttggtgtGCTTGCCACAACCCAAGgatatggCTTCTCACCATTTGAATCT
CTATCTGACTACGAAAGTAATGCATTTGAAAAAGATGaatatttagACAT
AATTGACGACCTCGATCACGATGCAGAAGCCAACTTCTATGATGCAAGCC
CTGTTGAAAGATATCGAATCCAAGATCCATTTGAAGATTATTTTGATGTA
TTCAAGAGAGCATCGAaATGCAAAGACATATTTTCAAACTGTGCACAGTT
GACAAAATATTGCAAGAAAAAAGGAAAGCAATTCAAACAGATCAGAGCTG
GGTGTAGATTATCCTGTGGATTTTGCAAGGCACCAAAAGCCCCAGCTTAT
GTGAGCGCGAGACCAAAGATATCATcgtctgaaaaagaaaagatcaaAAG
AACATGTTTGAATTCTCATAACGCCAAGCGCCGCCTTCACCAAAAGACAC
CTCCTATGGTATGGAGTCAAAAATTGGCTGATCGTGCACAAACCTTTGCT
GAATNCACCTCTTATGGTATGGAGTCAAAAATTGGCCGATCGTTCACAAA
CCTTTGCTGAATGGACCAAGGCATCACTCTCATCTGTAAGGTCCATGGAA
ATTATGCGGATTACTGCAATAAAGATGGGTGTCTGTTTATATCGATTCAC
CATATTACATTACAATTCTGCTCAAGGAAGAAAATGTGGGGCAAGGCAgt
aatgaaaatctttttattttttggtgtGCTTGCCACAACCCAAGgatatg
gCTTCTCACCATTTGAATCTCTATCTGACTACGAAAGTAATGCATTTGAA
AAAGATGaatatttagACATAATTGACGACCTCGATCACGATGCAGAAGC
CAACTTCTATGATGCAAGCCCTGTTGAAAGATATCGAATCCAAGATCCAT
TTGAAGATTATTTTGATGTATTCAAGAGAGCATCGAaATGCAAAGACATA
TTTTCAAACTGTGCACAGTTGACAAAATATTGCAAGAAAAAAGGAAAGCA
ATTCAAACAGATCAGAGCTGGGTGTAGATTATCCTGTGGATTTTGCAAGG
CACCAAAAGCCCCAGCTTATGTGAGCGCGAGACCAAAGATATCATcgtct
gaaaaagaaaagatcaaAAGAACATGTTTGAATTCTCATAACGCCAAGCG
CCGCCTTCACCAAAAGACACCTCCTATGGTATGGAGTCAAAAATTGGCTG
ATCGTGCACAAACCTTTGCTGAATNCACCTCTTATGGTATGGAGTCAAAA
ATTGGCCGATCGTTCACAAACCTTTGCTGAATGGACCAAGGCATCACTCT
CATCTGTAAGGTCCATGGAAATTATGCGGATTACTGCAATAAAGATGGGT
GTCTGTTTATATCGATTCACCATATTACATTACAATTCTGCTCAAGGAAG
AAAATGTGGGGCAAGGCAgtaatgaaaatctttttattttttggtgtGCT
TGCCACAACCCAAGgatatggCTTCTCACCATTTGAATCTCTATCTGACT
ACGAAAGTAATGCATTTGAAAAAGATGaatatttagACATAATTGACGAC
CTCGATCACGATGCAGAAGCCAACTTCTATGATGCAAGCCCTGTTGAAAG
ATATCGAATCCAAGATCCATTTGAAGATTATTTTGATGTATTCAAGAGAG
CATCGAaATGCAAAGACATATTTTCAAACTGTGCACAGTTGACAAAATAT
TGCAAGAAAAAAGGAAAGCAATTCAAACAGATCAGAGCTGGGTGTAGATT
ATCCTGTGGATTTTGCAAGGCACCAAAAGCCCCAGCTTATGTGAGCGCGA
GACCAAAGATATCATcgtctgaaaaagaaaagatcaaAAGAACATGTTTG
AATTCTCATAACGCCAAGCGCCGCCTTCACCAAAAGACACCTCCTATGGT
ATGGAGTCAAAAATTGGCTGATCGTGCACAAACCTTTGCTGAATNCACCT
CTTATGGTATGGAGTCAAAAATTGGCCGATCGTTCACAAACCTTTGCTGA
ATGGACCAAGGCATCACTCTCATCTGTAAGGTCCATGGAAATTATGCGGA
TTACTGCAATAAAGATGGGTGTCTGTTTATATCGATTCACCATATTACAT
TACAATTCTGCTCAAGGAAGAAAATGTGGGGCAAGGCAgtaatgaaaatc
tttttattttttggtgtGCTTGCCACAACCCAAGgatatggCTTCTCACC
ATTTGAATCTCTATCTGACTACGAAAGTAATGCATTTGAAAAAGATGaat
atttagACATAATTGACGACCTCGATCACGATGCAGAAGCCAACTTCTAT
GATGCAAGCCCTGTTGAAAGATATCGAATCCAAGATCCATTTGAAGATTA
TTTTGATGTATTCAAGAGAGCATCGAaATGCAAAGACATATTTTCAAACT
GTGCACAGTTGACAAAATATTGCAAGAAAAAAGGAAAGCAATTCAAACAG
ATCAGAGCTGGGTGTAGATTATCCTGTGGATTTTGCAAGGCACCAAAAGC
CCCAGCTTATGTGAGCGCGAGACCAAAGATATCATcgtctgaaaaagaaa
agatcaaAAGAACATGTTTGAATTCTCATAACGCCAAGCGCCGCCTTCAC
CAAAAGACACCTCCTATGGTATGGAGTCAAAAATTGGCTGATCGTGCACA
AACCTTTGCTGAATNCACCTCTTATGGTATGGAGTCAAAAATTGGCCGAT
CGTTCACAAACCTTTGCTGAATGGACCAAGGCATCACTCTCATCTGTAAG
GTCCATGGAAATTATGCGGATTACTGCAATAAAGATGGGTGTCTGTTTAT
ATCGATTCACCATATTACATTACAATTCTGCTCAAGGAAGAAAATGTGGG
GCAAGGCAgtaatgaaaatctttttattttttggtgtGCTTGCCACAACC
CAAGgatatggCTTCTCACCATTTGAATCTCTATCTGACTACGAAAGTAA
TGCATTTGAAAAAGATGaatatttagACATAATTGACGACCTCGATCACG
ATGCAGAAGCCAACTTCTATGATGCAAGCCCTGTTGAAAGATATCGAATC
CAAGATCCATTTGAAGATTATTTTGATGTATTCAAGAGAGCATCGAaATG
CAAAGACATATTTTCAAACTGTGCACAGTTGACAAAATATTGCAAGAAAA
AAGGAAAGCAATTCAAACAGATCAGAGCTGGGTGTAGATTATCCTGTGGA
TTTTGCAAGGCACCAAAAGCCCCAGCTTATGTGAGCGCGAGACCAAAGAT
ATCATcgtctgaaaaagaaaagatcaaAAGAACATGTTTGAATTCTCATA
ACGCCAAGCGCCGCCTTCACCAAAAGACACCTCCTATGGTATGGAGTCAA
AAATTGGCTGATCGTGCACAAACCTTTGCTGAATNCACCTCTTATGGTAT
GGAGTCAAAAATTGGCCGATCGTTCACAAACCTTTGCTGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000948XLOC_000948Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001767-proteinTCONS_00001767-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001767-exon-sc0000012-1491911889:160968..161358TCONS_00001767-exon-sc0000012-1491911889:160968..161358Clytia hemisphaericaexon
TCONS_00001767-exon-sc0000012-1510915933:160968..161358TCONS_00001767-exon-sc0000012-1510915933:160968..161358Clytia hemisphaericaexon
TCONS_00001767-exon-sc0000012-1575043694:160968..161358TCONS_00001767-exon-sc0000012-1575043694:160968..161358Clytia hemisphaericaexon
TCONS_00001767-exon-sc0000012-1491911889:178774..178836TCONS_00001767-exon-sc0000012-1491911889:178774..178836Clytia hemisphaericaexon
TCONS_00001767-exon-sc0000012-1510915933:178774..178836TCONS_00001767-exon-sc0000012-1510915933:178774..178836Clytia hemisphaericaexon
TCONS_00001767-exon-sc0000012-1575043694:178774..178836TCONS_00001767-exon-sc0000012-1575043694:178774..178836Clytia hemisphaericaexon
TCONS_00001767-exon-sc0000012-1491911889:179982..180041TCONS_00001767-exon-sc0000012-1491911889:179982..180041Clytia hemisphaericaexon
TCONS_00001767-exon-sc0000012-1510915933:179982..180041TCONS_00001767-exon-sc0000012-1510915933:179982..180041Clytia hemisphaericaexon
TCONS_00001767-exon-sc0000012-1575043694:179982..180041TCONS_00001767-exon-sc0000012-1575043694:179982..180041Clytia hemisphaericaexon
TCONS_00001767-exon-sc0000012-1491911889:180273..180341TCONS_00001767-exon-sc0000012-1491911889:180273..180341Clytia hemisphaericaexon
TCONS_00001767-exon-sc0000012-1510915933:180273..180341TCONS_00001767-exon-sc0000012-1510915933:180273..180341Clytia hemisphaericaexon
TCONS_00001767-exon-sc0000012-1575043694:180273..180341TCONS_00001767-exon-sc0000012-1575043694:180273..180341Clytia hemisphaericaexon
TCONS_00001767-exon-sc0000012-1491911889:180725..180853TCONS_00001767-exon-sc0000012-1491911889:180725..180853Clytia hemisphaericaexon
TCONS_00001767-exon-sc0000012-1510915933:180725..180853TCONS_00001767-exon-sc0000012-1510915933:180725..180853Clytia hemisphaericaexon
TCONS_00001767-exon-sc0000012-1575043694:180725..180853TCONS_00001767-exon-sc0000012-1575043694:180725..180853Clytia hemisphaericaexon
TCONS_00001767-exon-sc0000012-1491911889:181471..181524TCONS_00001767-exon-sc0000012-1491911889:181471..181524Clytia hemisphaericaexon
TCONS_00001767-exon-sc0000012-1510915933:181471..181524TCONS_00001767-exon-sc0000012-1510915933:181471..181524Clytia hemisphaericaexon
TCONS_00001767-exon-sc0000012-1575043694:181471..181524TCONS_00001767-exon-sc0000012-1575043694:181471..181524Clytia hemisphaericaexon
TCONS_00001767-exon-sc0000012-1491911889:181959..182248TCONS_00001767-exon-sc0000012-1491911889:181959..182248Clytia hemisphaericaexon
TCONS_00001767-exon-sc0000012-1510915933:181959..182248TCONS_00001767-exon-sc0000012-1510915933:181959..182248Clytia hemisphaericaexon
TCONS_00001767-exon-sc0000012-1575043694:181959..182248TCONS_00001767-exon-sc0000012-1575043694:181959..182248Clytia hemisphaericaexon
TCONS_00001767-exon-sc0000012-1491911889:182642..183255TCONS_00001767-exon-sc0000012-1491911889:182642..183255Clytia hemisphaericaexon
TCONS_00001767-exon-sc0000012-1510915933:182642..183255TCONS_00001767-exon-sc0000012-1510915933:182642..183255Clytia hemisphaericaexon
TCONS_00001767-exon-sc0000012-1575043694:182642..183255TCONS_00001767-exon-sc0000012-1575043694:182642..183255Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000012supercontigsc0000012:160968..183255 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.0485664 0 0 0 0 0 0 0 0 0 0 0.241925 0 0 0 0 1.33285 0.674887 0 0 1.82189 2.29932 3.46076 2.8121 3.27523 3.06875 0 0 0 0
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR003582ShKT_dom
IPR014044CAP_domain
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00001767 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top