Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001654 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001654
Unique NameTCONS_00001654
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1798

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001654 ID=TCONS_00001654|Name=TCONS_00001654|organism=Clytia hemisphaerica|type=transcript|length=1798bp
ATTGTGctgttttatatttattttcgaaacGTTTATATTTCGACCTTCTT
TTCATTATCAGACACAGCCATTTCTAGAAGAACGAGAGAAAAGCATAGCA
GCATATAAGCAGCACTCGATTTTTCAACATGGCTTTGGTTACAACAGCAA
tcagacatttaaaaaaattaaacaatgtTCTACAAAGAAGGAACCAATCT
ATTCTATCAATGAAACCTGGCCAGTTTGTTGATTACATGAAATCAAACAA
TTTGAAACGATGCTCAGTGACCTATGATGATACAAGCATGAGCTCTCAAA
CTAGCTCACCAAAATTTAACGAGCTGAAGGAATTTTGCTCTGTTGAAAAC
AACAAAGATTATCAAAAACACGAGGGGCTCTTCCTTGAAATTGGATCTCG
GAGTGGAGCCCTTCTTGGTGCATTTGTTTGGCGAACCAATCGTGGTCAAG
CATGTGGTGGTGTCAGATTATGGGAGTATGATACAATGAAAGATTATCTA
TTTGATGGTTTACGGTTATCACAAGGAATGGGTTTAAAATCTGCTCTTGC
TGGTTTATGGGCTGGTGGCGGTAAAGGTGTTATTGCATCTCCAGGAAAGG
ATAAAGCAAATGATCCAGATTTCCGCAGAAACATCTTCCTTGATTATGGA
GACTTTTTAACATCCTTAAATGGTGCTTATATAGGGGCTGAGGATGCAGG
TGTTGTTGTCTCGGACATGGATACCATTTTTGAGCGCACCCGATTTATGA
CATGCATATCAGAAGCAAAAGGGGGCTCTGGAAACCCTTCCATTGCAACT
GGAAAAGGTATTGTCTGTGCTATGGAGGCAACTCTAGATTTTCTTGGACA
AGGAACATTGGAAGGGAAATCTGTTGTTTCTCAAGGCTCTGGAAATGTAG
CAAGAGTGATCTTTGATACCCTCCTTGATAAAGATATTGGTCAAATTCAT
GCTACGGATATCAATGAACAACAGCTTGATCTTACAGAGAAAATGTTTGC
TGATAAAAATCATGGAAGGTTGATATTAGAACAAGTGCCCAGAGGAGAAA
GTAAAACTTTGGCAATGCCTTGTGATATTCTATCCCCTAATGCtttggga
aatattttgaatgaGAATACCATTCCTACCATTCAATCAAAGATTGTCTG
TGGTGCAGCAAACAACCAGCTTGGGAAACTAGCAGATAACAAATTGATGA
TGGATCATGGAATAACTTACGTTGTTGATTTTCTATGCAACAGAATGGGG
ATCGTGAATTGTGCCAATGAAACTTATGGCCGGTTAAATGATGATCCAGC
ACTTCTTCAACATTTTAGTAAAGAATGGCCTCATTCTATTTGGAAGGTCA
CTCATGAAGTTTTGTCAACAGCTAAGGATAAAGGAATCACACCAGTTGAA
GCTGCAATTGAAATTGCTGATAGAGAAAGTCTTGAAATTCACCCGATATG
GCCTTACCGCACcaagaaaattattgaaaatcttGTAACTGATGACTGGG
CAAGTGCTTGAATTAGAATAACACTATCCAAAATTGAGACATTTCTTCAA
ATGAACTTTATTTTAGAATCTTAGGGAAactttaaagtattttttttcgg
aaaggtatttgattttatttatcattttgacatgagacattttttaatgt
ttttaggaAAAGACAGAATCTAGCTTTACATACAAATTTTTCTTCGTATG
ACTTTTGCAGCTTGAGCTTATTTTTAAATTGACCTCAGAAAATTACTTTT
GATTTAATGATTTACAAACCACAAACAAATTGCAGAAAATAAGCTAGG
Run BLAST on NCBI

protein sequence of Amino-acid dehydrogenase

>TCONS_00001654-protein ID=TCONS_00001654-protein|Name=Amino-acid dehydrogenase|organism=Clytia hemisphaerica|type=polypeptide|length=460bp
MALVTTAIRHLKKLNNVLQRRNQSILSMKPGQFVDYMKSNNLKRCSVTYD
DTSMSSQTSSPKFNELKEFCSVENNKDYQKHEGLFLEIGSRSGALLGAFV
WRTNRGQACGGVRLWEYDTMKDYLFDGLRLSQGMGLKSALAGLWAGGGKG
VIASPGKDKANDPDFRRNIFLDYGDFLTSLNGAYIGAEDAGVVVSDMDTI
FERTRFMTCISEAKGGSGNPSIATGKGIVCAMEATLDFLGQGTLEGKSVV
SQGSGNVARVIFDTLLDKDIGQIHATDINEQQLDLTEKMFADKNHGRLIL
EQVPRGESKTLAMPCDILSPNALGNILNENTIPTIQSKIVCGAANNQLGK
LADNKLMMDHGITYVVDFLCNRMGIVNCANETYGRLNDDPALLQHFSKEW
PHSIWKVTHEVLSTAKDKGITPVEAAIEIADRESLEIHPIWPYRTKKIIE
NLVTDDWASA
Run BLAST on NCBI

transcript from alignment at sc0000011:292285..294114-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001654 ID=TCONS_00001654|Name=TCONS_00001654|organism=Clytia hemisphaerica|type=transcript|length=1830bp|location=Sequence derived from alignment at sc0000011:292285..294114- (Clytia hemisphaerica)
ATTGTGCTGTTTTATATTTATTTTCGAAACGTTTATATTTCGACCTTCTT TTCATTATCAGACACAGCCATTTCTAGAAGAACGAGAGAAAAGCATAGCA GCATATAAGCAGCACTCGATTTTTCAACATGGCTTTGGTTACAACAGCAA TCAGACATTTAAAAAAATTAAACAATGTTCTACAAAGAAGGAACCAATCT ATTCTATCAATGAAACCTGGCCAGTTTGTTGATTACATGAAATCAAACAA TTTGAAACGATGCTCAGTGACCTATGATGATACAAGCATGAGCTCTCAAA CTAGCTCACCAAAATTTAACGAGCTGAAGGAATTTTGCTCTGTTGAAAAC AACAAAGATTATCAAAAACACGAGGGGCTCTTCCTTGAAATTGGATCTCG GAGTGGAGCCCTTCTTGGTGCATTTGTTTGGCGAACCAATCGTGGTCAAG CATGTGGTGGTGTCAGATTATGGGAGTATGATACAATGAAAGATTATCTA TTTGATGGTTTACGGTTATCACAAGGAATGGGTTTAAAATCTGCTCTTGC TGGTTTATGGGCTGGTGGCGGTAAAGGTGTTATTGCATCTCCAGGAAAGG ATAAAGCAAATGATCCAGATTTCCGCAGAAACATCTTCCTTGATTATGGA GACTTTTTAACATCCTTAAATGGTGCTTATATAGGGGCTGAGGATGCAGG TGTTGTTGTCTCGGACATGGATACCATTTTTGAGCGCACCCGATTTATGA CATGCATATCAGAAGCAAAAGGGGGCTCTGGAAACCCTTCCATTGCAACT GGAAAAGGTATTGTCTGTGCTATGGAGGCAACTCTAGATTTTCTTGGACA AGGAACATTGGAAGGGAAATCTGTTGTTTCTCAAGGCTCTGGAAATGTAG CAAGAGTGATCTTTGATACCCTCCTTGATAAAGATATTGGTCAAATTCAT GCTACGGATATCAATGAACAACAGCTTGATCTTACAGAGAAAATGTTTGC TGATAAAAATCATGGAAGGTTGATATTAGAACAAGTGCCCAGAGGAGAAA GTAAAACTTTGGCAATGCCTTGTGATATTCTATCCCCTAATGCTTTGGGA AATATTTTGAATGAGAATACCATTCCTACCATTCAATCAAAGATTGTCTG TGGTGCAGCAAACAACCAGCTTGGGAAACTAGCAGATAACAAATTGATGA TGGATCATGGAATAACTTACGTTGTTGATTTTCTATGCAACAGAATGGGG ATCGTGAATTGTGCCAATGAAACTTATGGCCGGTTAAATGATGATCCAGC ACTTCTTCAACATTTTAGTAAAGAATGGCCTCATTCTATTTGGAAGGTCA CTCATGAAGTTTTGTCAACAGCTAAGGATAAAGGAATCACACCAGTTGAA GCTGCAATTGAAATTGCTGATAGAGAAAGTCTTGAAATTCACCCGATATG GCCTTACCGCACCAAGAAAATTATTGAAAATCTTGTAACTGATGACTGGG CAAGTGCTTGAATTAGAATAACACTATCCAAAATTGAGACATTTCTTCAA ATGAACTTTATTTTAGAATCTTAGGGAAACTTTAAAGTATTTTTTTTCGG AAAGGTATTTGATTTTATTTATCATTTTGACATGAGACATTTTTTAATGT TTTTAGGAAAAGACAGAATCTAGCTTTACATACAAATTTTTCTTCGTATG ACTTTTGCAGCTTGAGCTTATTTTTAAATTGACCTCAGAAAATTACTTTT GATTTAATGATTTACAAGCATTCAATCATTTTATATTAAGTATCACTAGA CCACAAACAAATTGCAGAAAATAAGCTAGG

Coding sequence (CDS) from alignment at sc0000011:292285..294114-

>TCONS_00001654 ID=TCONS_00001654|Name=TCONS_00001654|organism=Clytia hemisphaerica|type=CDS|length=1383bp|location=Sequence derived from alignment at sc0000011:292285..294114- (Clytia hemisphaerica)
ATGGCTTTGGTTACAACAGCAATCAGACATTTAAAAAAATTAAACAATGT
TCTACAAAGAAGGAACCAATCTATTCTATCAATGAAACCTGGCCAGTTTG
TTGATTACATGAAATCAAACAATTTGAAACGATGCTCAGTGACCTATGAT
GATACAAGCATGAGCTCTCAAACTAGCTCACCAAAATTTAACGAGCTGAA
GGAATTTTGCTCTGTTGAAAACAACAAAGATTATCAAAAACACGAGGGGC
TCTTCCTTGAAATTGGATCTCGGAGTGGAGCCCTTCTTGGTGCATTTGTT
TGGCGAACCAATCGTGGTCAAGCATGTGGTGGTGTCAGATTATGGGAGTA
TGATACAATGAAAGATTATCTATTTGATGGTTTACGGTTATCACAAGGAA
TGGGTTTAAAATCTGCTCTTGCTGGTTTATGGGCTGGTGGCGGTAAAGGT
GTTATTGCATCTCCAGGAAAGGATAAAGCAAATGATCCAGATTTCCGCAG
AAACATCTTCCTTGATTATGGAGACTTTTTAACATCCTTAAATGGTGCTT
ATATAGGGGCTGAGGATGCAGGTGTTGTTGTCTCGGACATGGATACCATT
TTTGAGCGCACCCGATTTATGACATGCATATCAGAAGCAAAAGGGGGCTC
TGGAAACCCTTCCATTGCAACTGGAAAAGGTATTGTCTGTGCTATGGAGG
CAACTCTAGATTTTCTTGGACAAGGAACATTGGAAGGGAAATCTGTTGTT
TCTCAAGGCTCTGGAAATGTAGCAAGAGTGATCTTTGATACCCTCCTTGA
TAAAGATATTGGTCAAATTCATGCTACGGATATCAATGAACAACAGCTTG
ATCTTACAGAGAAAATGTTTGCTGATAAAAATCATGGAAGGTTGATATTA
GAACAAGTGCCCAGAGGAGAAAGTAAAACTTTGGCAATGCCTTGTGATAT
TCTATCCCCTAATGCTTTGGGAAATATTTTGAATGAGAATACCATTCCTA
CCATTCAATCAAAGATTGTCTGTGGTGCAGCAAACAACCAGCTTGGGAAA
CTAGCAGATAACAAATTGATGATGGATCATGGAATAACTTACGTTGTTGA
TTTTCTATGCAACAGAATGGGGATCGTGAATTGTGCCAATGAAACTTATG
GCCGGTTAAATGATGATCCAGCACTTCTTCAACATTTTAGTAAAGAATGG
CCTCATTCTATTTGGAAGGTCACTCATGAAGTTTTGTCAACAGCTAAGGA
TAAAGGAATCACACCAGTTGAAGCTGCAATTGAAATTGCTGATAGAGAAA
GTCTTGAAATTCACCCGATATGGCCTTACCGCACCAAGAAAATTATTGAA
AATCTTGTAACTGATGACTGGGCAAGTGCTTGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000863XLOC_000863Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
Amino-acid dehydrogenaseTCONS_00001654-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001654-exon-sc0000011-1575043694:292348..294114TCONS_00001654-exon-sc0000011-1575043694:292348..294114Clytia hemisphaericaexon
TCONS_00001654-exon-sc0000011-1575043694:292285..292315TCONS_00001654-exon-sc0000011-1575043694:292285..292315Clytia hemisphaericaexon
TCONS_00001654-exon-sc0000011-1510915933:292348..294114TCONS_00001654-exon-sc0000011-1510915933:292348..294114Clytia hemisphaericaexon
TCONS_00001654-exon-sc0000011-1510915933:292285..292315TCONS_00001654-exon-sc0000011-1510915933:292285..292315Clytia hemisphaericaexon
TCONS_00001654-exon-sc0000011-1491911889:292348..294114TCONS_00001654-exon-sc0000011-1491911889:292348..294114Clytia hemisphaericaexon
TCONS_00001654-exon-sc0000011-1491911889:292285..292315TCONS_00001654-exon-sc0000011-1491911889:292285..292315Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000011supercontigsc0000011:292285..294114 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.424215 0.413676 0.404478 0.296789 192.73 151.203 43.8038 46.9745 4.64721 7.97029 4.65979 2.64681 6.57813 7.24781 7.74629 4.68029 14.1462 10.6168 0.996836 2.58296 10.7288 6.98101 1.27999 1.34989 0.383546 0.748793 0.581683 0.882171 0.37172 0.328227
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR006095Glu/Leu/Phe/Val_DH
IPR006096Glu/Leu/Phe/Val_DH_C
IPR006097Glu/Leu/Phe/Val_DH_dimer_dom
IPR016040NAD(P)-bd_dom
Vocabulary: Biological Process
TermDefinition
GO:0055114oxidation-reduction process
GO:0006520cellular amino acid metabolic process
Vocabulary: Molecular Function
TermDefinition
GO:0016491oxidoreductase activity
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006520 cellular amino acid metabolic process
biological_process GO:0055114 oxidation-reduction process
molecular_function GO:0016491 oxidoreductase activity
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00001654 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top