Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

Amino-acid dehydrogenase (polypeptide) - C. hemisphaerica

Overview
NameAmino-acid dehydrogenase
Unique NameTCONS_00001654-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length460

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001654-protein ID=TCONS_00001654-protein|Name=Amino-acid dehydrogenase|organism=Clytia hemisphaerica|type=polypeptide|length=460bp
MALVTTAIRHLKKLNNVLQRRNQSILSMKPGQFVDYMKSNNLKRCSVTYD
DTSMSSQTSSPKFNELKEFCSVENNKDYQKHEGLFLEIGSRSGALLGAFV
WRTNRGQACGGVRLWEYDTMKDYLFDGLRLSQGMGLKSALAGLWAGGGKG
VIASPGKDKANDPDFRRNIFLDYGDFLTSLNGAYIGAEDAGVVVSDMDTI
FERTRFMTCISEAKGGSGNPSIATGKGIVCAMEATLDFLGQGTLEGKSVV
SQGSGNVARVIFDTLLDKDIGQIHATDINEQQLDLTEKMFADKNHGRLIL
EQVPRGESKTLAMPCDILSPNALGNILNENTIPTIQSKIVCGAANNQLGK
LADNKLMMDHGITYVVDFLCNRMGIVNCANETYGRLNDDPALLQHFSKEW
PHSIWKVTHEVLSTAKDKGITPVEAAIEIADRESLEIHPIWPYRTKKIIE
NLVTDDWASA
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000863XLOC_000863Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001654TCONS_00001654Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR006095Glu/Leu/Phe/Val_DH
IPR006096Glu/Leu/Phe/Val_DH_C
IPR006097Glu/Leu/Phe/Val_DH_dimer_dom
IPR016040NAD(P)-bd_dom
Vocabulary: Biological Process
TermDefinition
GO:0055114oxidation-reduction process
GO:0006520cellular amino acid metabolic process
Vocabulary: Molecular Function
TermDefinition
GO:0016491oxidoreductase activity
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006520 cellular amino acid metabolic process
biological_process GO:0055114 oxidation-reduction process
molecular_function GO:0016491 oxidoreductase activity
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006095Glutamate/phenylalanine/leucine/valine dehydrogenasePRINTSPR00082GLFDHDRGNASEcoord: 135..149
score: 46.86
coord: 249..269
score: 30.68
coord: 206..228
score: 34.6
IPR006096Glutamate/phenylalanine/leucine/valine dehydrogenase, C-terminalSMARTSM00839ELFV_dehydrog_3coord: 218..433
e-value: 1.2E-12
score: 58.0
IPR006096Glutamate/phenylalanine/leucine/valine dehydrogenase, C-terminalPFAMPF00208ELFV_dehydrogcoord: 215..429
e-value: 2.3E-13
score: 50.3
NoneNo IPR availableGENE3D3.40.50.10860coord: 85..222
e-value: 5.6E-31
score: 106.6
NoneNo IPR availableGENE3D3.40.50.720coord: 223..452
e-value: 7.2E-27
score: 93.9
NoneNo IPR availableSUPERFAMILY53223Aminoacid dehydrogenase-like, N-terminal domaincoord: 99..218
IPR006097Glutamate/phenylalanine/leucine/valine dehydrogenase, dimerisation domainPFAMPF02812ELFV_dehydrog_Ncoord: 102..204
e-value: 4.1E-8
score: 33.1
IPR016040NAD(P)-binding domainSUPERFAMILY51735NAD(P)-binding Rossmann-fold domainscoord: 215..432

Blast
The following BLAST results are available for this feature:
BLAST of Amino-acid dehydrogenase vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top