Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001576 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001576
Unique NameTCONS_00001576
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1741

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001576 ID=TCONS_00001576|Name=TCONS_00001576|organism=Clytia hemisphaerica|type=transcript|length=1741bp
TCTCACCATCAAAAACTATTGCGACTTTCGAAATCCCCACCAAATTCAAC
ATGTCTGCCCTCTGCAGTGCACGTTTGTTGACTCGTGTCAGTGGTAAATT
CACAAACTCAACATCTATTGCAAGATCTCTGTTCACAAACTCCATTAAAA
TGtCAAGTGGATTCCGTATAGAAACTGACACACTGGGAGAAGTCGAGGTC
CCAAATGATAAATACTATGGTGCACAAACTGTCCGCTCCACAAGGAACTT
TCCAATAGGGGATGAAACTGAAAGAATGCCAatgCCAGTAATCAAGGCTT
TTGGTATTCTAAAGAAAGCAGCTGCAGAGGTCAACACTGAATTTGGTCTT
GATGCAAACATTGCAAAACAGATTTCCCTTGCTTGTGATGAGGTCATTGA
TGGCAAACTTAAAGATCATTTTCCCTTGGTGATCTGGCAAACAGGCTCTG
GTACTCAGAGTAACATGAACTGTAATGAAGTGATCAGCAATCGGGCAAAC
GAAATGTTGGGAGCAGAACTTGGTACTAAATCACCTGTGCACCCAAATGA
TCATGTCAACAAATCTCAGAGTTCAAATGATACCTTTCCAACGGCCATGC
ACATCGCTGTCGGGCAAATGGTCAACGAAACATTGTTACCTGGTATGAAG
AAATTGCACCAAGCTCTCCTCGAAAAAACTGAAGAATTCAAAGACATTGT
CAAGATTGGACGTACCCACACTCAAGATGCTACACCACTGACATTAGGAC
AAGAATTCGGTGGGTACGCCACGCAGATGGAATACGGTATCAAACGTATT
GAAGCTGCATTGCCACGTGTGTACGAACTAGCTATCGGAGGAACCGCTGT
TGGAACTGGATTGAACACCAGAATTGGATTTGCGGAAAAGATGTCTGCTA
AGATTGCTGAATTTACAGGTCTTCCTTATGAGAGTGCACCGAACAAGTTC
GAAGCTTTAGCAGCGCACGATGCAATGGTAGAGATCAGCGGTGCGATGAA
CGTTGTCGCATGCAGTATCATGAAGATCGCAAACGATATCCGATTTTTAG
GATCTGGCCCACGATGCGGACTCGGCGAACTTTTATTGCCAGAGAATGAA
CCAGGAAGCAGCATCATGCCTGGAAAAGTGAACCCAACTCAATGCGAGGC
TATCACCATGGTAGCAGCACAAGTCATGGGAAACCATGTTGCAGTCTCGG
TTGGCGGTAGTAACGGACATTTCGAATTGAACGTTTTCAAACCGATGATG
GTAAAAAACGTATTACAGTCTGCACGCCTACTCGGTGACTCATGTGTTGC
TTTCACTGATAATTGTGTTGTAGATATTATTGCTAACCGTGAACGAATCG
ATAAACTTTTACACGAATCATTGATGTTGGTAACTGCTTTGAATACCCAC
ATTGGGTACGATAAAGCAGCCAAGATTGCCAAAACAGCTCACAAGAATGG
ATCTACCCTGAAAGCAACAGCCATTGAATTAGGATATTTGACCGAAGAGG
AATTTGATGCTTGGGTACGCCCTGAAGATATGTTAGGTCCTAAATAATGT
AATTTAGTTTTGTAATTATAATGAatattttgtttagtttttgtTGGACT
TAATATGGTTTCTCTTCGGTGCTAATGTTGCcctgtttcttttttttaaa
gaaatatttctatcaATGAAAAGTGAAACTTTCATTTTGTCTATTTTCAA
CCTTAAAGGAGAAAACTTAGTCGGCTAGAACTTTACGTCGG
Run BLAST on NCBI

protein sequence of TCONS_00001576-protein

>TCONS_00001576-protein ID=TCONS_00001576-protein|Name=TCONS_00001576-protein|organism=Clytia hemisphaerica|type=polypeptide|length=514bp
SPSKTIATFEIPTKFNMSALCSARLLTRVSGKFTNSTSIARSLFTNSIKM
SSGFRIETDTLGEVEVPNDKYYGAQTVRSTRNFPIGDETERMPMPVIKAF
GILKKAAAEVNTEFGLDANIAKQISLACDEVIDGKLKDHFPLVIWQTGSG
TQSNMNCNEVISNRANEMLGAELGTKSPVHPNDHVNKSQSSNDTFPTAMH
IAVGQMVNETLLPGMKKLHQALLEKTEEFKDIVKIGRTHTQDATPLTLGQ
EFGGYATQMEYGIKRIEAALPRVYELAIGGTAVGTGLNTRIGFAEKMSAK
IAEFTGLPYESAPNKFEALAAHDAMVEISGAMNVVACSIMKIANDIRFLG
SGPRCGLGELLLPENEPGSSIMPGKVNPTQCEAITMVAAQVMGNHVAVSV
GGSNGHFELNVFKPMMVKNVLQSARLLGDSCVAFTDNCVVDIIANRERID
KLLHESLMLVTALNTHIGYDKAAKIAKTAHKNGSTLKATAIELGYLTEEE
FDAWVRPEDMLGPK
Run BLAST on NCBI

transcript from alignment at sc0000011:274908..290930+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001576 ID=TCONS_00001576|Name=TCONS_00001576|organism=Clytia hemisphaerica|type=transcript|length=16023bp|location=Sequence derived from alignment at sc0000011:274908..290930+ (Clytia hemisphaerica)
TCTCACCATCAAAAACTATTGCGACTTTCGAAATCCCCACCAAATTCAAC ATGTCTGCCCTCTGCAGTGCACGTTTGTTGACTCGTGTCAGTGGTAAATT CACAAACTCAACATCTATTGCAAGATCTCTGTTCACAAACTCCATTAAAA TGGTAAGGCAATTATCTTTAACTTTAGGCAGTCTCCAGGGCGTCATTTTT GTCATATGCAAGCTATTCAAATTTAGACCATTCAAGAGCTTTGTTTCCAT CCTTCTGTTCATTCATTTGTAAACAGCATCTAGAGAACTAGAAATACTCT ATATCATCTTAATTGCTGATTTCTTTCATCAAGCAAGGGTTGTCTGCAAA TGATGATTATATAGAATGGATGACTTTGCCGCCAATGTCTTGGATCATGG GGAGGAGAAAGGTCATGGCTTCTATTCTGCACAAAGACGAAAGACACAGA TCTAGACTTATTTCATTTCGTACTTTCTGGTACTTTGTgatttattttct atgttttccaGTTGATTGAATGACTTAAAGAAAGTttgccaccggtggga ttcgaacccactaaatgcaaagttctgaTGTTCAGGAACCCAACGTCTCA CAAGTGTTACGCgcaagccaaatcgcgtattacaaacaacctctaaattg ccgagtacaggagaaaaaaatcgaaattcaaaatggcggccaagcccacg ctgataactaccgtaacttggtctaatgtcgacatccctcctctaattcc gacaccctttttatcagctgaaattgatagaaaggttgaaactgttttta ttTGCTTAgctggtcagagaggaataatcctttttcaatagacctttttt caaagaggccaccctgttgaataattatgtagtccagcagattaaaacaa tgataaaaccatgcataattattacaatatgcatgatatagtaattatgc atggctctatcattgtttttatggctggactacataattattcaacagga cgtcctctttgaaaaaaggtctatcagtgattcaagctttcatattattc ccgtctctaaagaagggtgttggaattagaagagggatgttgatattaga ccaacttacggtattaaaaatcttcgtttttcaatcagctattgcagctc aataaatctatgaaataatttgaaataaaaagtaaacaaaccttgaacct ttcatgaatccaaataaataaaagtattcatctaaagtgaagattacatt tcaaaataaNNNNNNNatttccaaaccaacctaaagtcagtgtctgccaa ctaaaaatttctctgcggggtcactggcaaggagttatgacttcagactt tagattccaattcttgtataggctgcaactacactgccaaatgatctgta tcagtcagggacagtcgccttattaggagacgcctcctgattaggagacc cgtctcctaatcaggagtttcacgtctcctaatcaggagacgggtgtaat tatctcgtgaacgagcaaactgcgcatgattttattgctcccaatggaaa gagcacaaaaaattgattccatatggtgattttcagaaaaatccaccggt ggaatcaatcacaattctaataatccataagaacCAATCNGAAAAATCCa ccggtggaatcaatcacaattctaataatccataagacccaatcagaagt aagaatctgtcttctgaacaaaagtgtctcaaaaagaaaaatggtggaca tgaaaaaaatcaagaggggcttccttgtagtgctttatattaggattgtg atcgattgcacccagaaatttttataatttttttaaaactttaccaattc gaggctgctctttccattaaaactagtttcaaaatgcgcagaaaagccta aagcccttaaaattgagatCAAAGTNNNNNNNNNNNNNNNNNNNNNNaat taggagacgggtctcctaatcaagcgaccccaagcgacctacatgtctcc taatcaggagacgtctcctaatcaggaggcgtctcctaataaggcgactg tccctgactgtgtattacaaatacttccaaatgggtccataagttaagaa aatgaaattatcatctagcacaggggttttgtttttaaaaaccaacttca aaataaaattcttaatgaacttgttacttaacatatcacttacttacata cagtaatttatttatgatataacagccctttcttaaataagtgggctctt aaagtcttttatgattgccgcaagaagggaaaaaattgaatttgaccccc ggttttttctctctttttctagctagttcccgcgtgttagtgtagacaca actttaatccggggaaatgaagcttttttattggtctaaaatcacggatg gtcacgtgaccaaaacttttatccagggaaatgccatggcggcaatgttt tgctttagtgagattgaccattttgttgttttgatttgagcgggcgaaac ttctgtacaaaccaaaatatggcttcgttggaataccggctGAAACACTT GTGGTCTTAACCATTGCACCACGAATTCATGCCGGAAGACCGTTTCTAAC AACTATTTATATTGTATAAACTACAGACCATACTATATTAAGAGGAAATc tcaaaagagtgcttgtttcgagctccaaccctaaccaccctaactgataa taacccactTCCTAGACAATCTggtacgtaaccacacccaaaccacaccc atacccaaccctaccaggtcgcctgcaggccCTGatactattcccgcatg ccggatctgtaaaatagatataatatatgtttttgcttttatgaagaagc cttcaccgaGGAGAAATTAGGAATATAGGCCGAGCAATGGACGACCCTTC TTGTGTTGGGAGAACATGTGATAGCTTCTATATTTTGGCCTTTCGGCAGA CAAGGTTGAATTTACTGAGActctttcaattcaatttgtcaaaaatgaTC AGGCTGCATTTGAAGAAAAGAGGGACCTTATCTTGAAATCCTAGGACTAC GGTGACGAACTGTTGGTGCATAAACACTGCAACAGCAAaccatttatttt caatttctggTAGATTTGATTTCTGCTCTACATTCTTTGttgcaaaacag aaattaataaaaagcagccttacaagatttaaaaccatttaaaacatcca aagattacaccagagtccatgaacaagtttgcatgcattatcatgaccaa tatgttttcttggaaatgaacttgcctctatTTTCTTCATGCCTCATGTT TTCATGTACCGTGAATGGCCCTAAATCTGACAGCCTTGCCTAAATCTgac ccccaaataactgctatgaaaaaaaattctatgtttacaaacattcgctc tccaagttgaacaataaactattgcaaggactctcgaaacaaaacatcta acaagataactataatgtcaagatgtcaattaatgtgatcaaaaaagtgt gagttgtaaaaataattacctctattattctgaatccgttgcttgtgttt aaaacgttaacaatttatgtaatgaaaagttatgtttttttataagaagc aattattgtaatttggttcaattggttcagtgtatcaaatctctcagttt agttgacactttggtatcttcattgtgtcacagcgaaaggtttgttttta ttttagtttgtatttttgaaagaccccatcagttttaggcagggctgtag gatttaggaccactcacgacaggggggcacgcagttactacaagacagta tgacacttactaccgtggtgggtACTGTTTCAAAGATTCAAAGTGAAGTA ACTGCTGTTTTGGGTGGTGCCTTTTTGCGTGCGCAGCGCATCTCTTTTGT TAAGACATATGCCCGGTTAATTAAAATACGCCTGTCCCCTATATGGCTTT GTGAAATTTGTGTATGACTACATGGTTCGTGCCACTTTTTAAATCCTTAA ATTGTGCCGGAGTTTTGTTAAATCATGACGGTGAGCCATAAACCGCGATT CCATTGGTCAGTTCTGTGTCAATCCTGTGtcgttttttgaaaactttttg gcTTTTCTTTTGTTGCAAGTTAGAGAAATGCACGGAAATGGACTTGTCAA ATTGATGTTGAAGACTTGTCGGAAGATATattattgaaagtttcattTGT ATTCCTATGATGTTTAGTGTGTGTTTAGATGTATCTTCTGACTGTGTGCA TAGATGTATCTTCTGACTGTGTGCATCAATTTTGTTTGGTTTGTTGGTTG GGTTGATAACATACGCATCTTGTTGGGTTATGTTAGTatgttttttaaaa gttttttttcgattcAAGAAAACAGAAGTCATCACACATCTGGTATGTAG ACAACTAATATTAATAGATAGAATTATAGCTCCGGTCCCCTTATCTAGAC CACTTGCAGAGCATGGGTTATGTATGGGTTACTTTCCACAGTAGAAATTC GAGACTTTTGTTTACCAGCAGTTACCAGACCTATAATGTATTGGTAAATG TTCATTgttaaatgaaagtgaaagtaaacagAAATATTTCTTCACAATGT CACAAAGTTGCATAGGAACTTTGATAGACACCACTTTGATATTTCCACCC AAGAATGGAGGTGGCACCTGAATTATTTTCCCGGAAAACAGTCACTACCC TGGTGTAGTTAATGCAAACAAGGGTGGTGCCTAAattctttttctgaaaa cagttactaccctGGTGTAGTAAATGCAATGGGTGGTGGTCCTAAAAAAA AGTGCTGAAAAGACACTTACTAcacatactgtcttgtagtaactgcgtgc ccccctgCTCACGgtaacagaaagctctatcttcactaACAAGTgcagga ctatcctatttttgcttcagaattgctccACGCCTTGAAGATTTGTCCTT ACGGCTTTAACGAAGTGGGTGCAAGCAAGCGGAATGCATTCTcatacagt tagtaaaagtacTTCGATTTGCGAAGTGTCTTTACGTCAcacagaacaaa agaaaatagcaaaagaacaaaggaattacccacAACTACCAATTTCTCAA CCATTGGGAATCGCAATTTTAAGGAAATGGGACCCTCATATTGATTcaaa gcatcttctgaaaatttaactcttccccataaatgcgaaaatgaaaaacg aagaaacttttgttttctaattgtctttttaatctgccatgaagtgttat aaaattccttattgaTTGACACGTTCTCTTACTAAGAGGTTTAAAAAATG CTGTAGAAACAAGAAACTGTGAAAATCGATTACAAAACTTACGTCACAAC CACAGAgtgctgacttttagttttaacgACTTGTTCTCACTTGTTTGGTT TCCGTAATAAAAAAAAGTCGTTATTGTGACCTTTCAACATGCTTTAAATG GAGGTATTTCCACTTACTGTCATATGAGAATGCAAAacgctgtaaaccag aacataaaatatcaaaaactagattgtgaaatagtttacagcctggatat ccaggctactccCAAAGTAATTTCAACCAAACCCTGTCATACCAATTTTG ATAAATCTAACCACCAGGGCTTAAAATAACAGTCAATTCATGGAACATTG TTCAAACCCAAAActcataattttcaagcaaaattaaCCCTATTCTCAAA GGAAGCCTCCAAAATCAAACCTGCCAACTTGAGATGTTCATCTTGTGTTA GATAAAAATTTATGGGCAAAAGCCAAAATATTTAAAGGGATTCTGgcaca aaaaataaaactttgtcaTGGCAAAGCTATCATGAAAAGCATTTGGAAAA TTCAAGTCAAAGTTGTTAATCTTCAGTGATTCTATCCCAAGATATTGACA TCCAAAGTTCCAAATTCAATTCAAGACATCTGCACTTTGTGGAAGCCATA TTGAaatgataatttcaaagtttgatttcaaACTTTCGGGTATCCTTAAT CCATATTAGGTAAAGATTAGAGGACTTGATCAAAAAAGCCTAACAAATTG AATCGCTATCTCAGAAATTGAATAGCAAAATTTGTTTAGTTGTTCAGCTT GCTGCTGCACGTTAGCAATCGgtcattttgtttcatttcaagtcttcaga tttgattttaattaagtgtcttgggatcttgaacttgattcaggcaacac tcatccttgttgttgcaaatcctgtagatgactgatgttgtttttttctg aaagttagatttcctagtgtgactaactgtctttCGTTTTCCCTTGAGCA CAGAAGAGagaaatgattagctcgcattcttGCATATGtgaataatagac cttttgccATTTGCGATACCATTTTAGCTCCAGTTATAATTAGCAACGAA AACAGAGGTTTGTTTATAGAGTTACATCTcttgttgttacacttttttct gatttataAAAAAGGAAACACCTTGTGAACCCCATTTCCAATTTGTTGTC TTAATGAAGGATGtggaaaaaagcatgaaaaaataaagatttttaaaaat ctttcaaatttttaaccTAGCTTGGAGTTGAACCTGCGACCCCTCTATTT GGGCaatctttttatattttatttgtgAGAATTGGAAATTTACGACAAAC AGTGTTGTTAAAGGAAGAGCttaacaatttcattttcaatgttatttcaa ttgtttttaaaCAAAGAGCTTAAAAAAGCGCAGATGACACATTTCTATGT GCACatctttttttgatattttatctttttttgtcaATCTTTATAGGAAT GCTTAATTTCAAATGGGAATATGTTGGAGTATAGTGAGAGTCACTTACCT CTAGTGATTTACTATTTGTCCTGTTCAGAGGAAAATTTCCCATACATTTC TTATTTATCTGTATGTTCAAAAGagaatttctgtttttttttacagaaac tATGAACTTGTgtaatttttaaaggaaaattattctttacttttgaagaa acaTGGATCCAATTTGAGCAGTTAGTGCACAAAATTTGTTTTCCTAgcta ttttttcacttttattgtTTAGAGGTCTAATTCCCATCCAAAATTGCTCC AAATATCCTGCATATTTAGAGAAAATTATTTCCTGTAATGTATTTTGGAA GGAAAATGGGTTTTCACCAtgaaatataagaaaataactgtttttggttt ctttttatATTCAAACTAGTCATTGTTCCTTTATATTTCAAGGGAAATGA GTTGAACTTCTTGACACTTTATCGGAATCTCTGCCAAAACAACCACGCTA AAATGAATCCATTGAAATGCAGAGGTAAACAAATTCGCGGAGCTCTAAAA AAGCGGCTCATTATTCCCTATCCAGCAAGTTTTATAATTCAGTGCCAGGC TTATTTGTCCTTGTCTATCTTGTTGAGACATTCCTTAAAATACACATAAA TTTCACTGGATCTGAAGAAAAGTAATTTAAACAACTAGAATCTaagtagg ctacgtcatatcttcctccATTTcaagcgtaaaactcctactcttcggga tattgaatttgaatattgaaattctccagataaatcgcatacacactgag gttttaatgaaagaaTAGTGAGTTCcaaaacctaagccaatcagctgtgt ttgaaacattcttttatttgaaatctctattgataaacatcttttgtgaa agttgtctattatgtttaaacctattaaacAAGCAATTTTTGATGGGGGT TACTAGTGGCCgtctatagcagtgcctatagaccaagagtaaggcctaaa agcctggagctgtgtattgtgtagactagaatCTAAGATGTTAGATATAA GAGAAAGAAATACAACAACTTTGATGGCACTTTAGCCATTTTTGCATGAA ATCGGCTATTTTGGGACTTGTTTACAAAAGTGTTGTCAGGCAACattcag tgctgcaaataagaaaatttcagttggccggtaattttttgAGTGTAACG AGCAGGGGGTCTGGTGGAACCATCTTAGAAAATTTTGTGGTATGTGATGA CCTAGATTGGTTAAACAccaattttagtttaaaaactGTTCCTCTTTTAA TTAGAAGCGCTATTAAGTTTTTGTCTAAGCCTCtaatctttaaattttaa ccggacaaaatgaaaaactgagcctcagaatgaccggtagaaactacaaa atgactgctaattaccggtcaccggccgttatttgcagcactgacaTTGC AAGGAGGCAAACTTTTCGATAAGGTGTATTCAAAGGCTAAATCAGGTAGA ATATTCtaactttgtttttctttgtcaaaaaacttgattccaaagttttt tttaaagtaaaaaagaacCCATAGATATTCATCCTCCAATAAACGAGTTC ACAAAATTCGAGTTCGCAAAATCTAATcgttttgaagtctccaggctgac TCTGAGTTTTAGCCTCTTTTTGCAAATAAGGGGGGGTGTCAACTAATACT GTTAAGTTAGAAATGACTGAAATTTTGTTCTAAGATAGAGAAATACgaga ttgaaaatttaaaaaaattctttgtatATTCTAATTAAATGATCTAAATC ATGGCAATTTTTCAGaccaaatttgtttttagaaGTCTTCAGAAGGGTTG TGGGAACTTAATTAGGAAGTTTAGAATTAGTCTCTGTACGTTGAGCAGAT GGCCAAGTGTGTTAAGGAGTCATCAAGTAAGGATTTTGACAGATGAGGAC CCAGTCCGCTTTTTCTCATGTTTTGAAACTTCTTGTTTTCGAGGTTGTCA TCACAAAAAAAACTGTCCAGCGTCTTAAAAAAATCTCCACAACCCTCCAG GAGCCTACAGAGGTCATGGAGCCTGCAGAGGTcatggttttttttttcaa gaactttcaAGCACAACCATTTTCCATTTCATGGAGTTTGGACTGCATTC TTAAAATTTAGCTGGGGCTATTTTCATCAGTCACCTCTGAAAATTGCTCT GTTCACTATGTCCTCTTTGTTTGCAATGTTGCACTTTCTTTCACTTCGAT GCCTCATCTCTCTCGTTTTttactcaggggggggggtatcgagtcagtgt actggcccatagctggtggggtggtattttttaggttaaattgagttagt acagtgtactaaaagggtggtcctctgagaaaaatacaatgaaaaagtta gtacagtgtagtgtactaaaagggtggtcctctgagaaaaatacaatgaa aaagttagtacactgtactaaaaagggtggtgttcTGAATTGATACACAC TGAGAAGTTAGTACATTGTACTAATTTCAGTGGTAAAAACACAAACCCAG TAAATTCCCATGTATATTGCCCTAATTTGCCAGGTCCAAGCTGGTCCGAG ACCTTCAAGTCAAGGCTGGTTGAGCTATACAAATTGGTACACTGATTTTT CTCCCAATGTTTCCTGTTTacttgattggatttgtttcagAGTCGCAGCA TGCGCAAGTGGAGACTGGCCTTAAGTCCAATCTTGTTTTCTTTAAGGCCC TATCTACATTATGGCAACAACAAGAATTTGAAATGTGTAAACGTTCGAAT CGAAGCTTtcaagttttataaaaacaaatccgctctattgttttatgttt tttagtAACCTTGTTGGAttgttaattgaaaaaaatctgtttaAGTGAAA tcaccggggggagggggtgaaaacgaccatacgttcgggcaaaaatcagg tctctaaaatcggtcccttacagtgcatgaaaaatttggctgaaaatcga cccttatagtgtaatttttcgaattttttgcccttttcagggcaaaattt tttgaaatttctcaaatttttacctcaaaatttggtattttataaaattt tacacccttacagtgcactttttcccactttctcacaaatcaaccctNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCCCCCGGGAAAAGcac ctttttatatattttgtatagtattacatttgataaaagattttccattt cagtttgtgtacaatgttagtaagtcttttatttttatttttcaaaaaga aaaactgctACAGTTTGCCAGACAACCAGAAATCAAGTCACAAAGGGAAA TAACTTAAAGttggttttgaatgttttgacgtgctaatttcagctaattt cactgtatttgattgactttgctttgtctgtttcattgtttcagtgtTTG TACTACTGTATATAAGGATTCAAgtattttaatattcaaatctttccttt tatataatttggtgcttttcttagcaaaatacttcaaaaccTTTGTATAT GGTGGCAATTAAACTTATCTGGCCAAGAATAAATTAGaacagtgcactat aagggtggtttctaaacttatctgatcgaaaaaaaaaggtaatacagtgt actaaaagggtggtatcaaaaATCCGGTCATGGAGaagtcagtacagtgt actgaaaggttggtaataaaaatctagttgtagaaaaacatttttaaaag ctAAGTTTTTACGATATTTCCTGATTATTTTTGGATTCAGTcaaatttct ggaaaagctaTTGTTACTATCAGTCACTACTACCAGGCGACTTTTTCGTT AGAGAACGTTTATAAATATCAAAACCAAAAGGACTTCGTCCCTAGTCCTT TATACTCATTGTTTCAACCTATAAAGTAATGCTGTTCAAAAGTATCAAAT TGTATAAAAATGTTGCTATATTTGATTTAATCAGCTTTTTTGAGTAAAAA GTAGTGGCAGTGGTTTacaaaaaatctagaaaaatccTTTTAGTGCTTAT GTCTGGGATTTTAATACAGGGGGTGCTTTTGATTTTACATAttatttttg atcatttttctttgaattttagtCAAGTGGATTCCGTATAGAAACTGACA CACTGGGAGAAGTCGAGGTCCCAAATGATAAATACTATGGTGCACAAACT GTCCGCTCCACAAGGAACTTTCCAATAGGGGATGAAACTGAAAGAATGCC AGTAAGTTGTTTTGTCGTTTTATGATTTAGTTTCAGTCAATCTGTAAGAT TCATTCGACTACCAGAGCGGTAATAAGCATAATGTTAATTATCTTAATAC TTATGAAAACTTTTGTAGACTATTATTGTCTTTACAGAGTTCTCCAATTT TCaaagggaccattcaaaaagtacataCCCTCTAAGGGCGTAGGGTATCT TTTAAAAAGCGTACGAAAGCGTAGATAGGGGGGTCAATCAAGAAAATGTA CCGTGcgctttgaattttttttcaaactgttttttccgttttttttttat ttgaaaaatcaaaatattttcaacgtaTTATAATCTTTAAGTTTATTTAA GCTTGATCTTGTCTTGAAAAAGTTATATCATTAAAACTGAGACCGAACTT GCGTCAGTCAATTTCtgttataatttcaaaatttttcctagAGAAGGAGG GGAGGGGTGTTATTCGGTAAAGCGTTACTGTCAAAGCGTATGAGAGCATA CAAGGGGGTGGGGTCGAATTCTGCTTACTTTCGAGCGtgcgtactttttg aatggtcccaacGGTTTATTAATTCAAATCTTTTACCGGAAGTGGACTAG AAAGCAATAAGTTTTTtatgtaatttcattttttagatgCCAGTAATCAA GGCTTTTGGTATTCTAAAGAAAGCAGCTGCAGAGGTCAACACTGAATTTG GTCTTGATGCAAACATTGCAAAACAGATTTCCCTTGCTTGTGATGAGGTA AGACtactaaaaaatgttttgttcaaCTTTCAAAATTAAGGTTTTGAGGA CTAAAGAATGAATAAGTTACTGGCAATACAACCGAATACAAAAGCCTTTA AAGTCTGAATCTGGGATGAAATTCTGgtcctctctctctctctgtcATAC CGACAGTACCTGTTGCTTCATACCTGAGTTATCCAAACTGTAAAATTACT TTGACTATAAAATGTAATGCaatatttttgctctttttAGGTCATTGATG GCAAACTTAAAGATCATTTTCCCTTGGTGATCTGGCAAACAGGCTCTGGT ACTCAGAGTAACATGAACTGTAATGAAGTGATCAGCAATCGGGCAAACGA AATGTTGGGAGCAGAACTTGGTACTAAATCACCTGTGCACCCAAATGATC ATGTCAACAAATCTCAGGTAATTTAGTTAGAAggaactttacaaatggaa tacCTCAAAATATTACCACTGACTTTAATAAGCCCTGGAGTAAGCTATAT TATGTCATCTTAATTTTATGTCAAAATTGACACCCTAATAGTAGCATACA CTCTAATGGTAGCATACACTACTCTATATGAGTCAATTtataattcaatg aaattttcggTTCAAGTTTTTTCACCTacattgagtagtgctaccattag ggtaccagtagtgcgggtaccactttcaaaaaaaactctgatcagCGGAT TTTTTCTATaggaaaagataaacaaatattttaatgCAAGACTGAGtgca aatcttttgttttcatttctctaacctttgctccatttaattttttttcc gtgcaGAGTTCAAATGATACCTTTCCAACGGCCATGCACATCGCTGTCGG GCAAATGGTCAACGAAACATTGTTACCTGGTATGAAGAAATTGCACCAAG CTCTCCTCGAAAAAACTGAAGAATTCAAAGACATTGTCAAGATTGGACGT ACCCACACTCAAGTAAATAATTCATCTGTTCACTGAAAACGAGAATTCTC TGACACTTTATTAGTTTGCTGTTAGTTTCATTGATATTAGACATCGAAAC CCATACTATTATTATATATAAAAGCACGTCGAAGGTTATTAATTAGGAAA ATTTATGAACAAGCAGTTGTTTAACAGTGTGATATTTATGAGTAATaaac ttaaaatatttttaattagtTCTAATTAACTATTTTACAGcagaaatttt tagtttgatTTTAGTATGGAATAAATTTAGAATTAAGAATTATGGATTTA ACCTCATAACGGTTAGCCTGTGATGGGACTAAAATCGTTCGAAttgtgaa atttgaaaaaaatcacataTTTGACAGATCAAAGATTTGAATtataataa gtttttttttataaattatgagaaaattttcattggTCTATAGGATGCTA CACCACTGACATTAGGACAAGAATTCGGTGGGTACGCCACGCAGATGGAA TACGGTATCAAACGTATTGAAGCTGCATTGCCACGTGTGTACGAACTAGC TATCGGAGGAACCGCTGTTGGAACTGGATTGAACACCAGAATTGGATTTG CGGAAAAGATGTCTGCTAAGATTGCTGAATTTACAGGTCTTCCTTATGAG AGGTGGGTAAAGGGGATAAGGCGCAATTAATTCTCTAGTAAGCGTTCTAG CACTTCATTTTGTTGtgatttttgtagatttttacctttaataaaatgaa ataaataaacaacatcGAAAAATCGCTGATGAGCCTGGAAACCGTCTGAA GATAGCCAAATTATGGCTGGTTGTAGCAAAAATGAAGCGTTAGTCTGGTC TTTGTATCGCAAAAAAACAAGGCTACCAAGCGATATCGTCTGACAAAACG AACGACTTCTCTCATCAGAAACTTGACACGCTAGTTTTGGTTTACAAATC TCCCATGTCAAATGGTGGTGCCAATCAAGTCAAAGTTAAGCTATAGAAAA TTTATTCCAGCGATAAAagagattcaaaagtatacgCGCAGTAGAAATTC TTAAAGGGGACGTCTGGTCTGATTTTAGGtattgttttttataatttttg gaaaaattattccAGGGAGATTAAAATGAGCTATCTCActtcaagagatt ttttttcaatcactttctatggCCATTTAAAAAATCCCTCTTTTTNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNttttcaaaatttatgacgtaG CTTATGTTATATGTTTTCTATGTTCTTTCAAGTAAACAAGATTAACTCCT CTTTCTGTGCAGCtggcatttttataagaaagtttTAAGTAAGTCAGAGA TGTGCAAGAGCATTTAAAGTCGTTAAAACATCTTTTTCTCAACATTTTGT CAATGAAAGCTTACTCCAACATCTTCATAGaaaactgaaatatttataTA GTTGTGGACTGGAAAAATCATCGAAATTAGAAGTTTGAATTAAAATNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNAGACAAgatttctgttcttataaattacgAACAA AGGTTACGTCAAAAATCAGGTAAAAGAGAGGAAATTGTAAAACACTAAAA TCTGAATATGTCAGTCAAAACTTAAGATTTTGAGTTCGTTTTTTCTGCAA ACTTCTTTTTACTAATTTAGCTATCTGGCATAGAATTATGATTGAAATGA TCTTCCAAAGCAGACGTGTTTGCTCCGTGAGCCTTACCGAAACTATATTT TACCTTTCTTTAGTGCACCGAACAAGTTCGAAGCTTTAGCAGCGCACGAT GCAATGGTAGAGATCAGCGGTGCGATGAACGTTGTCGCATGCAGTATCAT GAAGATCGCAAACGATATCCGATTTTTAGGATCTGGCCCACGATGCGGAC TCGGCGAACTTTTATTGCCAGAGAATGAACCAGGAAGCAGCATCATGCCT GGTAAGGATCGGTcgttttacttttatttatgtAAACTGTACTTTTATTA CGTTCGGGTCTTAGGTTAAAAGAGGTACAGTGATTTACTGCTGGACGGGG TACCctttttgcaataactcaagattgaaaagtttagatttgCGAAAAAG ACGAcaatcaatcaaaaaataattttgttttttgtatacTTGGAGATTTA TGTTCTGTTTAGCTCTGTTGTATTTTTTGACATGTGTCACGCTCCTCACG TTAAAAGCTcttgaaaaaataaacttaaaacaCATATTTTCTTTTGTCTT CCAGGAAAAGTGAACCCAACTCAATGCGAGGCTATCACCATGGTAGCAGC ACAAGTCATGGGAAACCATGTTGCAGTCTCGGTTGGCGGTAGTAACGGAC ATTTCGAATTGAACGTTTTCAAACCGATGATGGTAAAAAACGTATTACAG TCTGCACGCCTACTCGGTGACTCATGTGTTGCTTTCACTGATAATTGTGT TGTAGATATTATTGCTAACCGTGAACGAATCGATAAACTTTTACACGAAT CATTGATGTTGGTAACTGCTTTGAATACCCACATTGGGTACGATAAAGCA GCCAAGATTGCCAAAACAGCTCACAAGAATGGATCTACCCTGAAAGCAAC AGCCATTGAATTAGGATATTTGACCGAAGAGGAATTTGATGCTTGGGTAC GCCCTGAAGATATGTTAGGTCCTAAATAATGTAATTTAGTTTTGTAATTA TAATGAatattttgtttagtttttgtTGGACTTAATATGGTTTCTCTTCG GTGCTAATGTTGCcctgtttcttttttttaaagaaatatttctatcaATG AAAAGTGAAACTTTCATTTTGTCTATTTTCAACCTTAAAGGAGAAAACTT AGTCGGCTAGAACTTTACGTCGG

Coding sequence (CDS) from alignment at sc0000011:274908..290930+

>TCONS_00001576 ID=TCONS_00001576|Name=TCONS_00001576|organism=Clytia hemisphaerica|type=CDS|length=12360bp|location=Sequence derived from alignment at sc0000011:274908..290930+ (Clytia hemisphaerica)
TCACCATCAAAAACTATTGCGACTTTCGAAATCCCCACCAAATTCAACAT
GTCTGCCCTCTGCAGTGCACGTTTGTTGACTCGTGTCAGTGGTAAATTCA
CAAACTCAACATCTATTGCAAGATCTCTGTTCACAAACTCCATTAAAATG
tCAAGTGGATTCCGTATAGAAACTGACACACTGGGAGAAGTCGAGGTCCC
AAATGATAAATACTATGGTGCACAAACTGTCCGCTCCACAAGGAACTTTC
CAATAGGGGATGAAACTGAAAGAATGCCAatgCCAGTAATCAAGGCTTTT
GGTATTCTAAAGAAAGCAGCTGCAGAGGTCAACACTGAATTTGGTCTTGA
TGCAAACATTGCAAAACAGATTTCCCTTGCTTGTGATGAGGTCATTGATG
GCAAACTTAAAGATCATTTTCCCTTGGTGATCTGGCAAACAGGCTCTGGT
ACTCAGAGTAACATGAACTGTAATGAAGTGATCAGCAATCGGGCAAACGA
AATGTTGGGAGCAGAACTTGGTACTAAATCACCTGTGCACCCAAATGATC
ATGTCAACAAATCTCAGAGTTCAAATGATACCTTTCCAACGGCCATGCAC
ATCGCTGTCGGGCAAATGGTCAACGAAACATTGTTACCTGGTATGAAGAA
ATTGCACCAAGCTCTCCTCGAAAAAACTGAAGAATTCAAAGACATTGTCA
AGATTGGACGTACCCACACTCAAGATGCTACACCACTGACATTAGGACAA
GAATTCGGTGGGTACGCCACGCAGATGGAATACGGTATCAAACGTATTGA
AGCTGCATTGCCACGTGTGTACGAACTAGCTATCGGAGGAACCGCTGTTG
GAACTGGATTGAACACCAGAATTGGATTTGCGGAAAAGATGTCTGCTAAG
ATTGCTGAATTTACAGGTCTTCCTTATGAGAGTGCACCGAACAAGTTCGA
AGCTTTAGCAGCGCACGATGCAATGGTAGAGATCAGCGGTGCGATGAACG
TTGTCGCATGCAGTATCATGAAGATCGCAAACGATATCCGATTTTTAGGA
TCTGGCCCACGATGCGGACTCGGCGAACTTTTATTGCCAGAGAATGAACC
AGGAAGCAGCATCATGCCTGGAAAAGTGAACCCAACTCAATGCGAGGCTA
TCACCATGGTAGCAGCACAAGTCATGGGAAACCATGTTGCAGTCTCGGTT
GGCGGTAGTAACGGACATTTCGAATTGAACGTTTTCAAACCGATGATGGT
AAAAAACGTATTACAGTCTGCACGCCTACTCGGTGACTCATGTGTTGCTT
TCACTGATAATTGTGTTGTAGATATTATTGCTAACCGTGAACGAATCGAT
AAACTTTTACACGAATCATTGATGTTGGTAACTGCTTTGAATACCCACAT
TGGGTACGATAAAGCAGCCAAGATTGCCAAAACAGCTCACAAGAATGGAT
CTACCCTGAAAGCAACAGCCATTGAATTAGGATATTTGACCGAAGAGGAA
TTTGATGCTTGGGTACGCCCTGAAGATATGTTAGGTCCTAAATAATCACC
ATCAAAAACTATTGCGACTTTCGAAATCCCCACCAAATTCAACATGTCTG
CCCTCTGCAGTGCACGTTTGTTGACTCGTGTCAGTGGTAAATTCACAAAC
TCAACATCTATTGCAAGATCTCTGTTCACAAACTCCATTAAAATGtCAAG
TGGATTCCGTATAGAAACTGACACACTGGGAGAAGTCGAGGTCCCAAATG
ATAAATACTATGGTGCACAAACTGTCCGCTCCACAAGGAACTTTCCAATA
GGGGATGAAACTGAAAGAATGCCAatgCCAGTAATCAAGGCTTTTGGTAT
TCTAAAGAAAGCAGCTGCAGAGGTCAACACTGAATTTGGTCTTGATGCAA
ACATTGCAAAACAGATTTCCCTTGCTTGTGATGAGGTCATTGATGGCAAA
CTTAAAGATCATTTTCCCTTGGTGATCTGGCAAACAGGCTCTGGTACTCA
GAGTAACATGAACTGTAATGAAGTGATCAGCAATCGGGCAAACGAAATGT
TGGGAGCAGAACTTGGTACTAAATCACCTGTGCACCCAAATGATCATGTC
AACAAATCTCAGAGTTCAAATGATACCTTTCCAACGGCCATGCACATCGC
TGTCGGGCAAATGGTCAACGAAACATTGTTACCTGGTATGAAGAAATTGC
ACCAAGCTCTCCTCGAAAAAACTGAAGAATTCAAAGACATTGTCAAGATT
GGACGTACCCACACTCAAGATGCTACACCACTGACATTAGGACAAGAATT
CGGTGGGTACGCCACGCAGATGGAATACGGTATCAAACGTATTGAAGCTG
CATTGCCACGTGTGTACGAACTAGCTATCGGAGGAACCGCTGTTGGAACT
GGATTGAACACCAGAATTGGATTTGCGGAAAAGATGTCTGCTAAGATTGC
TGAATTTACAGGTCTTCCTTATGAGAGTGCACCGAACAAGTTCGAAGCTT
TAGCAGCGCACGATGCAATGGTAGAGATCAGCGGTGCGATGAACGTTGTC
GCATGCAGTATCATGAAGATCGCAAACGATATCCGATTTTTAGGATCTGG
CCCACGATGCGGACTCGGCGAACTTTTATTGCCAGAGAATGAACCAGGAA
GCAGCATCATGCCTGGAAAAGTGAACCCAACTCAATGCGAGGCTATCACC
ATGGTAGCAGCACAAGTCATGGGAAACCATGTTGCAGTCTCGGTTGGCGG
TAGTAACGGACATTTCGAATTGAACGTTTTCAAACCGATGATGGTAAAAA
ACGTATTACAGTCTGCACGCCTACTCGGTGACTCATGTGTTGCTTTCACT
GATAATTGTGTTGTAGATATTATTGCTAACCGTGAACGAATCGATAAACT
TTTACACGAATCATTGATGTTGGTAACTGCTTTGAATACCCACATTGGGT
ACGATAAAGCAGCCAAGATTGCCAAAACAGCTCACAAGAATGGATCTACC
CTGAAAGCAACAGCCATTGAATTAGGATATTTGACCGAAGAGGAATTTGA
TGCTTGGGTACGCCCTGAAGATATGTTAGGTCCTAAATAATCACCATCAA
AAACTATTGCGACTTTCGAAATCCCCACCAAATTCAACATGTCTGCCCTC
TGCAGTGCACGTTTGTTGACTCGTGTCAGTGGTAAATTCACAAACTCAAC
ATCTATTGCAAGATCTCTGTTCACAAACTCCATTAAAATGtCAAGTGGAT
TCCGTATAGAAACTGACACACTGGGAGAAGTCGAGGTCCCAAATGATAAA
TACTATGGTGCACAAACTGTCCGCTCCACAAGGAACTTTCCAATAGGGGA
TGAAACTGAAAGAATGCCAatgCCAGTAATCAAGGCTTTTGGTATTCTAA
AGAAAGCAGCTGCAGAGGTCAACACTGAATTTGGTCTTGATGCAAACATT
GCAAAACAGATTTCCCTTGCTTGTGATGAGGTCATTGATGGCAAACTTAA
AGATCATTTTCCCTTGGTGATCTGGCAAACAGGCTCTGGTACTCAGAGTA
ACATGAACTGTAATGAAGTGATCAGCAATCGGGCAAACGAAATGTTGGGA
GCAGAACTTGGTACTAAATCACCTGTGCACCCAAATGATCATGTCAACAA
ATCTCAGAGTTCAAATGATACCTTTCCAACGGCCATGCACATCGCTGTCG
GGCAAATGGTCAACGAAACATTGTTACCTGGTATGAAGAAATTGCACCAA
GCTCTCCTCGAAAAAACTGAAGAATTCAAAGACATTGTCAAGATTGGACG
TACCCACACTCAAGATGCTACACCACTGACATTAGGACAAGAATTCGGTG
GGTACGCCACGCAGATGGAATACGGTATCAAACGTATTGAAGCTGCATTG
CCACGTGTGTACGAACTAGCTATCGGAGGAACCGCTGTTGGAACTGGATT
GAACACCAGAATTGGATTTGCGGAAAAGATGTCTGCTAAGATTGCTGAAT
TTACAGGTCTTCCTTATGAGAGTGCACCGAACAAGTTCGAAGCTTTAGCA
GCGCACGATGCAATGGTAGAGATCAGCGGTGCGATGAACGTTGTCGCATG
CAGTATCATGAAGATCGCAAACGATATCCGATTTTTAGGATCTGGCCCAC
GATGCGGACTCGGCGAACTTTTATTGCCAGAGAATGAACCAGGAAGCAGC
ATCATGCCTGGAAAAGTGAACCCAACTCAATGCGAGGCTATCACCATGGT
AGCAGCACAAGTCATGGGAAACCATGTTGCAGTCTCGGTTGGCGGTAGTA
ACGGACATTTCGAATTGAACGTTTTCAAACCGATGATGGTAAAAAACGTA
TTACAGTCTGCACGCCTACTCGGTGACTCATGTGTTGCTTTCACTGATAA
TTGTGTTGTAGATATTATTGCTAACCGTGAACGAATCGATAAACTTTTAC
ACGAATCATTGATGTTGGTAACTGCTTTGAATACCCACATTGGGTACGAT
AAAGCAGCCAAGATTGCCAAAACAGCTCACAAGAATGGATCTACCCTGAA
AGCAACAGCCATTGAATTAGGATATTTGACCGAAGAGGAATTTGATGCTT
GGGTACGCCCTGAAGATATGTTAGGTCCTAAATAATCACCATCAAAAACT
ATTGCGACTTTCGAAATCCCCACCAAATTCAACATGTCTGCCCTCTGCAG
TGCACGTTTGTTGACTCGTGTCAGTGGTAAATTCACAAACTCAACATCTA
TTGCAAGATCTCTGTTCACAAACTCCATTAAAATGtCAAGTGGATTCCGT
ATAGAAACTGACACACTGGGAGAAGTCGAGGTCCCAAATGATAAATACTA
TGGTGCACAAACTGTCCGCTCCACAAGGAACTTTCCAATAGGGGATGAAA
CTGAAAGAATGCCAatgCCAGTAATCAAGGCTTTTGGTATTCTAAAGAAA
GCAGCTGCAGAGGTCAACACTGAATTTGGTCTTGATGCAAACATTGCAAA
ACAGATTTCCCTTGCTTGTGATGAGGTCATTGATGGCAAACTTAAAGATC
ATTTTCCCTTGGTGATCTGGCAAACAGGCTCTGGTACTCAGAGTAACATG
AACTGTAATGAAGTGATCAGCAATCGGGCAAACGAAATGTTGGGAGCAGA
ACTTGGTACTAAATCACCTGTGCACCCAAATGATCATGTCAACAAATCTC
AGAGTTCAAATGATACCTTTCCAACGGCCATGCACATCGCTGTCGGGCAA
ATGGTCAACGAAACATTGTTACCTGGTATGAAGAAATTGCACCAAGCTCT
CCTCGAAAAAACTGAAGAATTCAAAGACATTGTCAAGATTGGACGTACCC
ACACTCAAGATGCTACACCACTGACATTAGGACAAGAATTCGGTGGGTAC
GCCACGCAGATGGAATACGGTATCAAACGTATTGAAGCTGCATTGCCACG
TGTGTACGAACTAGCTATCGGAGGAACCGCTGTTGGAACTGGATTGAACA
CCAGAATTGGATTTGCGGAAAAGATGTCTGCTAAGATTGCTGAATTTACA
GGTCTTCCTTATGAGAGTGCACCGAACAAGTTCGAAGCTTTAGCAGCGCA
CGATGCAATGGTAGAGATCAGCGGTGCGATGAACGTTGTCGCATGCAGTA
TCATGAAGATCGCAAACGATATCCGATTTTTAGGATCTGGCCCACGATGC
GGACTCGGCGAACTTTTATTGCCAGAGAATGAACCAGGAAGCAGCATCAT
GCCTGGAAAAGTGAACCCAACTCAATGCGAGGCTATCACCATGGTAGCAG
CACAAGTCATGGGAAACCATGTTGCAGTCTCGGTTGGCGGTAGTAACGGA
CATTTCGAATTGAACGTTTTCAAACCGATGATGGTAAAAAACGTATTACA
GTCTGCACGCCTACTCGGTGACTCATGTGTTGCTTTCACTGATAATTGTG
TTGTAGATATTATTGCTAACCGTGAACGAATCGATAAACTTTTACACGAA
TCATTGATGTTGGTAACTGCTTTGAATACCCACATTGGGTACGATAAAGC
AGCCAAGATTGCCAAAACAGCTCACAAGAATGGATCTACCCTGAAAGCAA
CAGCCATTGAATTAGGATATTTGACCGAAGAGGAATTTGATGCTTGGGTA
CGCCCTGAAGATATGTTAGGTCCTAAATAATCACCATCAAAAACTATTGC
GACTTTCGAAATCCCCACCAAATTCAACATGTCTGCCCTCTGCAGTGCAC
GTTTGTTGACTCGTGTCAGTGGTAAATTCACAAACTCAACATCTATTGCA
AGATCTCTGTTCACAAACTCCATTAAAATGtCAAGTGGATTCCGTATAGA
AACTGACACACTGGGAGAAGTCGAGGTCCCAAATGATAAATACTATGGTG
CACAAACTGTCCGCTCCACAAGGAACTTTCCAATAGGGGATGAAACTGAA
AGAATGCCAatgCCAGTAATCAAGGCTTTTGGTATTCTAAAGAAAGCAGC
TGCAGAGGTCAACACTGAATTTGGTCTTGATGCAAACATTGCAAAACAGA
TTTCCCTTGCTTGTGATGAGGTCATTGATGGCAAACTTAAAGATCATTTT
CCCTTGGTGATCTGGCAAACAGGCTCTGGTACTCAGAGTAACATGAACTG
TAATGAAGTGATCAGCAATCGGGCAAACGAAATGTTGGGAGCAGAACTTG
GTACTAAATCACCTGTGCACCCAAATGATCATGTCAACAAATCTCAGAGT
TCAAATGATACCTTTCCAACGGCCATGCACATCGCTGTCGGGCAAATGGT
CAACGAAACATTGTTACCTGGTATGAAGAAATTGCACCAAGCTCTCCTCG
AAAAAACTGAAGAATTCAAAGACATTGTCAAGATTGGACGTACCCACACT
CAAGATGCTACACCACTGACATTAGGACAAGAATTCGGTGGGTACGCCAC
GCAGATGGAATACGGTATCAAACGTATTGAAGCTGCATTGCCACGTGTGT
ACGAACTAGCTATCGGAGGAACCGCTGTTGGAACTGGATTGAACACCAGA
ATTGGATTTGCGGAAAAGATGTCTGCTAAGATTGCTGAATTTACAGGTCT
TCCTTATGAGAGTGCACCGAACAAGTTCGAAGCTTTAGCAGCGCACGATG
CAATGGTAGAGATCAGCGGTGCGATGAACGTTGTCGCATGCAGTATCATG
AAGATCGCAAACGATATCCGATTTTTAGGATCTGGCCCACGATGCGGACT
CGGCGAACTTTTATTGCCAGAGAATGAACCAGGAAGCAGCATCATGCCTG
GAAAAGTGAACCCAACTCAATGCGAGGCTATCACCATGGTAGCAGCACAA
GTCATGGGAAACCATGTTGCAGTCTCGGTTGGCGGTAGTAACGGACATTT
CGAATTGAACGTTTTCAAACCGATGATGGTAAAAAACGTATTACAGTCTG
CACGCCTACTCGGTGACTCATGTGTTGCTTTCACTGATAATTGTGTTGTA
GATATTATTGCTAACCGTGAACGAATCGATAAACTTTTACACGAATCATT
GATGTTGGTAACTGCTTTGAATACCCACATTGGGTACGATAAAGCAGCCA
AGATTGCCAAAACAGCTCACAAGAATGGATCTACCCTGAAAGCAACAGCC
ATTGAATTAGGATATTTGACCGAAGAGGAATTTGATGCTTGGGTACGCCC
TGAAGATATGTTAGGTCCTAAATAATCACCATCAAAAACTATTGCGACTT
TCGAAATCCCCACCAAATTCAACATGTCTGCCCTCTGCAGTGCACGTTTG
TTGACTCGTGTCAGTGGTAAATTCACAAACTCAACATCTATTGCAAGATC
TCTGTTCACAAACTCCATTAAAATGtCAAGTGGATTCCGTATAGAAACTG
ACACACTGGGAGAAGTCGAGGTCCCAAATGATAAATACTATGGTGCACAA
ACTGTCCGCTCCACAAGGAACTTTCCAATAGGGGATGAAACTGAAAGAAT
GCCAatgCCAGTAATCAAGGCTTTTGGTATTCTAAAGAAAGCAGCTGCAG
AGGTCAACACTGAATTTGGTCTTGATGCAAACATTGCAAAACAGATTTCC
CTTGCTTGTGATGAGGTCATTGATGGCAAACTTAAAGATCATTTTCCCTT
GGTGATCTGGCAAACAGGCTCTGGTACTCAGAGTAACATGAACTGTAATG
AAGTGATCAGCAATCGGGCAAACGAAATGTTGGGAGCAGAACTTGGTACT
AAATCACCTGTGCACCCAAATGATCATGTCAACAAATCTCAGAGTTCAAA
TGATACCTTTCCAACGGCCATGCACATCGCTGTCGGGCAAATGGTCAACG
AAACATTGTTACCTGGTATGAAGAAATTGCACCAAGCTCTCCTCGAAAAA
ACTGAAGAATTCAAAGACATTGTCAAGATTGGACGTACCCACACTCAAGA
TGCTACACCACTGACATTAGGACAAGAATTCGGTGGGTACGCCACGCAGA
TGGAATACGGTATCAAACGTATTGAAGCTGCATTGCCACGTGTGTACGAA
CTAGCTATCGGAGGAACCGCTGTTGGAACTGGATTGAACACCAGAATTGG
ATTTGCGGAAAAGATGTCTGCTAAGATTGCTGAATTTACAGGTCTTCCTT
ATGAGAGTGCACCGAACAAGTTCGAAGCTTTAGCAGCGCACGATGCAATG
GTAGAGATCAGCGGTGCGATGAACGTTGTCGCATGCAGTATCATGAAGAT
CGCAAACGATATCCGATTTTTAGGATCTGGCCCACGATGCGGACTCGGCG
AACTTTTATTGCCAGAGAATGAACCAGGAAGCAGCATCATGCCTGGAAAA
GTGAACCCAACTCAATGCGAGGCTATCACCATGGTAGCAGCACAAGTCAT
GGGAAACCATGTTGCAGTCTCGGTTGGCGGTAGTAACGGACATTTCGAAT
TGAACGTTTTCAAACCGATGATGGTAAAAAACGTATTACAGTCTGCACGC
CTACTCGGTGACTCATGTGTTGCTTTCACTGATAATTGTGTTGTAGATAT
TATTGCTAACCGTGAACGAATCGATAAACTTTTACACGAATCATTGATGT
TGGTAACTGCTTTGAATACCCACATTGGGTACGATAAAGCAGCCAAGATT
GCCAAAACAGCTCACAAGAATGGATCTACCCTGAAAGCAACAGCCATTGA
ATTAGGATATTTGACCGAAGAGGAATTTGATGCTTGGGTACGCCCTGAAG
ATATGTTAGGTCCTAAATAATCACCATCAAAAACTATTGCGACTTTCGAA
ATCCCCACCAAATTCAACATGTCTGCCCTCTGCAGTGCACGTTTGTTGAC
TCGTGTCAGTGGTAAATTCACAAACTCAACATCTATTGCAAGATCTCTGT
TCACAAACTCCATTAAAATGtCAAGTGGATTCCGTATAGAAACTGACACA
CTGGGAGAAGTCGAGGTCCCAAATGATAAATACTATGGTGCACAAACTGT
CCGCTCCACAAGGAACTTTCCAATAGGGGATGAAACTGAAAGAATGCCAa
tgCCAGTAATCAAGGCTTTTGGTATTCTAAAGAAAGCAGCTGCAGAGGTC
AACACTGAATTTGGTCTTGATGCAAACATTGCAAAACAGATTTCCCTTGC
TTGTGATGAGGTCATTGATGGCAAACTTAAAGATCATTTTCCCTTGGTGA
TCTGGCAAACAGGCTCTGGTACTCAGAGTAACATGAACTGTAATGAAGTG
ATCAGCAATCGGGCAAACGAAATGTTGGGAGCAGAACTTGGTACTAAATC
ACCTGTGCACCCAAATGATCATGTCAACAAATCTCAGAGTTCAAATGATA
CCTTTCCAACGGCCATGCACATCGCTGTCGGGCAAATGGTCAACGAAACA
TTGTTACCTGGTATGAAGAAATTGCACCAAGCTCTCCTCGAAAAAACTGA
AGAATTCAAAGACATTGTCAAGATTGGACGTACCCACACTCAAGATGCTA
CACCACTGACATTAGGACAAGAATTCGGTGGGTACGCCACGCAGATGGAA
TACGGTATCAAACGTATTGAAGCTGCATTGCCACGTGTGTACGAACTAGC
TATCGGAGGAACCGCTGTTGGAACTGGATTGAACACCAGAATTGGATTTG
CGGAAAAGATGTCTGCTAAGATTGCTGAATTTACAGGTCTTCCTTATGAG
AGTGCACCGAACAAGTTCGAAGCTTTAGCAGCGCACGATGCAATGGTAGA
GATCAGCGGTGCGATGAACGTTGTCGCATGCAGTATCATGAAGATCGCAA
ACGATATCCGATTTTTAGGATCTGGCCCACGATGCGGACTCGGCGAACTT
TTATTGCCAGAGAATGAACCAGGAAGCAGCATCATGCCTGGAAAAGTGAA
CCCAACTCAATGCGAGGCTATCACCATGGTAGCAGCACAAGTCATGGGAA
ACCATGTTGCAGTCTCGGTTGGCGGTAGTAACGGACATTTCGAATTGAAC
GTTTTCAAACCGATGATGGTAAAAAACGTATTACAGTCTGCACGCCTACT
CGGTGACTCATGTGTTGCTTTCACTGATAATTGTGTTGTAGATATTATTG
CTAACCGTGAACGAATCGATAAACTTTTACACGAATCATTGATGTTGGTA
ACTGCTTTGAATACCCACATTGGGTACGATAAAGCAGCCAAGATTGCCAA
AACAGCTCACAAGAATGGATCTACCCTGAAAGCAACAGCCATTGAATTAG
GATATTTGACCGAAGAGGAATTTGATGCTTGGGTACGCCCTGAAGATATG
TTAGGTCCTAAATAATCACCATCAAAAACTATTGCGACTTTCGAAATCCC
CACCAAATTCAACATGTCTGCCCTCTGCAGTGCACGTTTGTTGACTCGTG
TCAGTGGTAAATTCACAAACTCAACATCTATTGCAAGATCTCTGTTCACA
AACTCCATTAAAATGtCAAGTGGATTCCGTATAGAAACTGACACACTGGG
AGAAGTCGAGGTCCCAAATGATAAATACTATGGTGCACAAACTGTCCGCT
CCACAAGGAACTTTCCAATAGGGGATGAAACTGAAAGAATGCCAatgCCA
GTAATCAAGGCTTTTGGTATTCTAAAGAAAGCAGCTGCAGAGGTCAACAC
TGAATTTGGTCTTGATGCAAACATTGCAAAACAGATTTCCCTTGCTTGTG
ATGAGGTCATTGATGGCAAACTTAAAGATCATTTTCCCTTGGTGATCTGG
CAAACAGGCTCTGGTACTCAGAGTAACATGAACTGTAATGAAGTGATCAG
CAATCGGGCAAACGAAATGTTGGGAGCAGAACTTGGTACTAAATCACCTG
TGCACCCAAATGATCATGTCAACAAATCTCAGAGTTCAAATGATACCTTT
CCAACGGCCATGCACATCGCTGTCGGGCAAATGGTCAACGAAACATTGTT
ACCTGGTATGAAGAAATTGCACCAAGCTCTCCTCGAAAAAACTGAAGAAT
TCAAAGACATTGTCAAGATTGGACGTACCCACACTCAAGATGCTACACCA
CTGACATTAGGACAAGAATTCGGTGGGTACGCCACGCAGATGGAATACGG
TATCAAACGTATTGAAGCTGCATTGCCACGTGTGTACGAACTAGCTATCG
GAGGAACCGCTGTTGGAACTGGATTGAACACCAGAATTGGATTTGCGGAA
AAGATGTCTGCTAAGATTGCTGAATTTACAGGTCTTCCTTATGAGAGTGC
ACCGAACAAGTTCGAAGCTTTAGCAGCGCACGATGCAATGGTAGAGATCA
GCGGTGCGATGAACGTTGTCGCATGCAGTATCATGAAGATCGCAAACGAT
ATCCGATTTTTAGGATCTGGCCCACGATGCGGACTCGGCGAACTTTTATT
GCCAGAGAATGAACCAGGAAGCAGCATCATGCCTGGAAAAGTGAACCCAA
CTCAATGCGAGGCTATCACCATGGTAGCAGCACAAGTCATGGGAAACCAT
GTTGCAGTCTCGGTTGGCGGTAGTAACGGACATTTCGAATTGAACGTTTT
CAAACCGATGATGGTAAAAAACGTATTACAGTCTGCACGCCTACTCGGTG
ACTCATGTGTTGCTTTCACTGATAATTGTGTTGTAGATATTATTGCTAAC
CGTGAACGAATCGATAAACTTTTACACGAATCATTGATGTTGGTAACTGC
TTTGAATACCCACATTGGGTACGATAAAGCAGCCAAGATTGCCAAAACAG
CTCACAAGAATGGATCTACCCTGAAAGCAACAGCCATTGAATTAGGATAT
TTGACCGAAGAGGAATTTGATGCTTGGGTACGCCCTGAAGATATGTTAGG
TCCTAAATAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000823XLOC_000823Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001576-exon-sc0000011-1491911889:274908..275059TCONS_00001576-exon-sc0000011-1491911889:274908..275059Clytia hemisphaericaexon
TCONS_00001576-exon-sc0000011-1510915933:274908..275059TCONS_00001576-exon-sc0000011-1510915933:274908..275059Clytia hemisphaericaexon
TCONS_00001576-exon-sc0000011-1575043694:274908..275059TCONS_00001576-exon-sc0000011-1575043694:274908..275059Clytia hemisphaericaexon
TCONS_00001576-exon-sc0000011-1491911889:286030..286158TCONS_00001576-exon-sc0000011-1491911889:286030..286158Clytia hemisphaericaexon
TCONS_00001576-exon-sc0000011-1510915933:286030..286158TCONS_00001576-exon-sc0000011-1510915933:286030..286158Clytia hemisphaericaexon
TCONS_00001576-exon-sc0000011-1575043694:286030..286158TCONS_00001576-exon-sc0000011-1575043694:286030..286158Clytia hemisphaericaexon
TCONS_00001576-exon-sc0000011-1491911889:286794..286904TCONS_00001576-exon-sc0000011-1491911889:286794..286904Clytia hemisphaericaexon
TCONS_00001576-exon-sc0000011-1510915933:286794..286904TCONS_00001576-exon-sc0000011-1510915933:286794..286904Clytia hemisphaericaexon
TCONS_00001576-exon-sc0000011-1575043694:286794..286904TCONS_00001576-exon-sc0000011-1575043694:286794..286904Clytia hemisphaericaexon
TCONS_00001576-exon-sc0000011-1491911889:287148..287324TCONS_00001576-exon-sc0000011-1491911889:287148..287324Clytia hemisphaericaexon
TCONS_00001576-exon-sc0000011-1510915933:287148..287324TCONS_00001576-exon-sc0000011-1510915933:287148..287324Clytia hemisphaericaexon
TCONS_00001576-exon-sc0000011-1575043694:287148..287324TCONS_00001576-exon-sc0000011-1575043694:287148..287324Clytia hemisphaericaexon
TCONS_00001576-exon-sc0000011-1491911889:287714..287869TCONS_00001576-exon-sc0000011-1491911889:287714..287869Clytia hemisphaericaexon
TCONS_00001576-exon-sc0000011-1510915933:287714..287869TCONS_00001576-exon-sc0000011-1510915933:287714..287869Clytia hemisphaericaexon
TCONS_00001576-exon-sc0000011-1575043694:287714..287869TCONS_00001576-exon-sc0000011-1575043694:287714..287869Clytia hemisphaericaexon
TCONS_00001576-exon-sc0000011-1491911889:288301..288509TCONS_00001576-exon-sc0000011-1491911889:288301..288509Clytia hemisphaericaexon
TCONS_00001576-exon-sc0000011-1510915933:288301..288509TCONS_00001576-exon-sc0000011-1510915933:288301..288509Clytia hemisphaericaexon
TCONS_00001576-exon-sc0000011-1575043694:288301..288509TCONS_00001576-exon-sc0000011-1575043694:288301..288509Clytia hemisphaericaexon
TCONS_00001576-exon-sc0000011-1491911889:289821..290008TCONS_00001576-exon-sc0000011-1491911889:289821..290008Clytia hemisphaericaexon
TCONS_00001576-exon-sc0000011-1510915933:289821..290008TCONS_00001576-exon-sc0000011-1510915933:289821..290008Clytia hemisphaericaexon
TCONS_00001576-exon-sc0000011-1575043694:289821..290008TCONS_00001576-exon-sc0000011-1575043694:289821..290008Clytia hemisphaericaexon
TCONS_00001576-exon-sc0000011-1491911889:290312..290930TCONS_00001576-exon-sc0000011-1491911889:290312..290930Clytia hemisphaericaexon
TCONS_00001576-exon-sc0000011-1510915933:290312..290930TCONS_00001576-exon-sc0000011-1510915933:290312..290930Clytia hemisphaericaexon
TCONS_00001576-exon-sc0000011-1575043694:290312..290930TCONS_00001576-exon-sc0000011-1575043694:290312..290930Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001576-proteinTCONS_00001576-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000011supercontigsc0000011:274908..290930 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
379.603 384.106 339.66 345.848 48.1872 43.0385 75.415 78.1005 112.56 102.514 125.686 171.072 151.967 166.632 150.762 151.786 219.583 219.079 77.1012 72.3088 154.65 156.741 195.186 182.691 131.453 131.72 87.0693 82.8239 109.239 103.206
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000362Fumarate_lyase_fam
IPR022761Fumarate_lyase_N
IPR018951Fumarase_C_C
IPR024083Fumarase/histidase_N
IPR005677Fum_hydII
IPR020557Fumarate_lyase_CS
IPR008948L-Aspartase-like
Vocabulary: Biological Process
TermDefinition
GO:0006099tricarboxylic acid cycle
GO:0006106fumarate metabolic process
Vocabulary: Molecular Function
TermDefinition
GO:0016829lyase activity
GO:0004333fumarate hydratase activity
GO:0003824catalytic activity
Vocabulary: Cellular Component
TermDefinition
GO:0045239tricarboxylic acid cycle enzyme complex
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006106 fumarate metabolic process
biological_process GO:0006099 tricarboxylic acid cycle
cellular_component GO:0045239 tricarboxylic acid cycle enzyme complex
molecular_function GO:0003824 catalytic activity
molecular_function GO:0004333 fumarate hydratase activity
molecular_function GO:0016829 lyase activity
Blast
BLAST of TCONS_00001576 vs. Swiss-Prot (Human)
Match: FUMH (Fumarate hydratase, mitochondrial OS=Homo sapiens GN=FH PE=1 SV=3)

HSP 1 Score: 729.554 bits (1882), Expect = 0.000e+0
Identity = 369/471 (78.34%), Postives = 414/471 (87.90%), Query Frame = 3
Query:  138 NSIKMSS--GFRIETDTLGEVEVPNDKYYGAQTVRSTRNFPIGDETERMPMPVIKAFGILKKAAAEVNTEFGLDANIAKQISLACDEVIDGKLKDHFPLVIWQTGSGTQSNMNCNEVISNRANEMLGAELGTKSPVHPNDHVNKSQSSNDTFPTAMHIAVGQMVNETLLPGMKKLHQALLEKTEEFKDIVKIGRTHTQDATPLTLGQEFGGYATQMEYGIKRIEAALPRVYELAIGGTAVGTGLNTRIGFAEKMSAKIAEFTGLPYESAPNKFEALAAHDAMVEISGAMNVVACSIMKIANDIRFLGSGPRCXXXXXXXXXXXXXSSIMPGKVNPTQCEAITMVAAQVMGNHVAVSVGGSNGHFELNVFKPMMVKNVLQSARLLGDSCVAFTDNCVVDIIANRERIDKLLHESLMLVTALNTHIGYDKAAKIAKTAHKNGSTLKATAIELGYLTEEEFDAWVRPEDMLGPK 1544
            N+ +M+S   FRIE DT GE++VPNDKYYGAQTVRST NF IG  TERMP PVIKAFGILK+AAAEVN ++GLD  IA  I  A DEV +GKL DHFPLV+WQTGSGTQ+NMN NEVISNRA EMLG ELG+K PVHPNDHVNKSQSSNDTFPTAMHIA    V+E LLPG++KLH AL  K++EF  I+KIGRTHTQDA PLTLGQEF GY  Q++Y + RI+AA+PR+YELA GGTAVGTGLNTRIGFAEK++AK+A  TGLP+ +APNKFEALAAHDA+VE+SGAMN  ACS+MKIANDIRFLGSGPR GLGEL+LPENEPGSSIMPGKVNPTQCEA+TMVAAQVMGNHVAV+VGGSNGHFELNVFKPMM+KNVL SARLLGD+ V+FT+NCVV I AN ERI+KL++ESLMLVTALN HIGYDKAAKIAKTAHKNGSTLK TAIELGYLT E+FD WV+P+DMLGPK
Sbjct:   40 NAARMASQNSFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVNQDYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGELGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALDAKSKEFAQIIKIGRTHTQDAVPLTLGQEFSGYVQQVKYAMTRIKAAMPRIYELAAGGTAVGTGLNTRIGFAEKVAAKVAALTGLPFVTAPNKFEALAAHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQCEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVVGIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQFDEWVKPKDMLGPK 510          
The following BLAST results are available for this feature:
BLAST of TCONS_00001576 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
FUMH0.000e+078.34Fumarate hydratase, mitochondrial OS=Homo sapiens ... [more]
back to top