Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001570 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001570
Unique NameTCONS_00001570
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3266

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001570 ID=TCONS_00001570|Name=TCONS_00001570|organism=Clytia hemisphaerica|type=transcript|length=3266bp
CGAGACGGTCAATAACAAGACCTTCTTTTGCTGATTCtgcaaaataattt
tagatgtAAACAAGAGCCGGAGAAGatcgtttgaaaaaaatttgctggta
ggaaaatttatatattttattttaaattgcctAATTGATGTAAACAGCTC
GTAAAGAAGATGTCAATTTTGCAAAGAGATGAAGAACTGATAATCTTTTT
CTAATGGAGCGTATTGCTTTTTGTGAAGACTCCATTTTTTGCAGCAATGG
CACAGGTTTCCTGTTCAAATGGTTTTTCTTCAACAGAGGAAACTTCCAAG
ATGGCTGCCGACCAAGCCTTGCTAAAAAACTCAAATGCTAATATCTTTGG
AGATATTGAATCCATGAGATGTGAAAAAtgcaaaagcaaaaagaaaaagg
tgACCGTTGTCTGTATTGACTGTGGAGAACTTGCTTTATGCAATGATTGT
AACCGCAAAGTACATGAAAATAATAAAGTTCAACATCAGCTGCATGAATT
GAGACCAAAAACACAGACTCTAGCCAAAGAAAAGCAAATTAATGGAACAT
TGAATGGATCAATTAATGGAACAATTCATCACAAGAAGAACAATAGTATT
GCAAAGCTTGACATAGTGCACAATGACAAACCAAAAAGTTTATTATTGAT
TGACAGTACAGAAAGATTGCAGGTAACAAAAGAGGGTGATTTCAAGCATT
TACTTGGTTGTGATGATGATCCTCGAGTGAAAGTTGTTTCAATCTTTGGA
AACACAGGAGATGGAAAATCACATACTCTGAATCATACATTTTTTGACGG
CGCTGAAGTATTTGATACATCACCATCCCAAAAATCATGTACCGTTGGTG
TATGGGTTTCCTACTGCCCGAACCAGAAAGCCATCATCGTGGATACAGAA
GGTCTGCTTGGtgtttcagaaaatgcaaataagAGGATGAGATTGTTGAT
GAAGATTCTTGCTGTCTCGGATGTTGTGATTTATCGTACAAGAGCAGAAC
GCCTACATTCTGATATGTTTACTTTCTTGGGTGATGCTTCAGAAGCCTAC
atcaaatatttcacaaaagaTCTTCAATCAGTTCAACAAAGAGGCCATAT
GGAGAATGTTCCCTTGTGTAGCTTAGGTCCCTCTATTGTTATCTTTCAAG
AGACACATTACACTACACCACTTGGTTTTGAAAATGATCCATCAGAACAT
GATAACAGTCCAGAAGAGATTTTGAGatccaattttttcaacattggACG
CAATCCAGCTGCATTTAGTTCCATCAATTATGTTGGTACAAGAACGACTA
CCCAATCCACTGATTTCTCTATCCTCTTGAATGAAGTGAAGAAAAACCTC
AAGAACAAGACCGTTCGTTCTGCAAGACCTGTTTCTGTCATTTTCAATGC
TTTGATgTTTTTGAATGACAAATTCGGTGATGATATCAATGACATCCTAC
CAAACAGTTTCCCTGATGAATATTTTACATGTGTTTCAAAATGTTTATCA
TGCAGTGCTCGATGTGGAAAAAACATGAATCAtgagaaagaagagaaaga
acatCGCTCAGAACAAAAGTGTACATATCAAGCACAATTTGACAACAAAG
TATATACGTGCAAGGCATGCCATGAGAAAGGCGTTGAATCACTTGTGATA
CCCAAAACTGCTGAAACTCAAGATTCTCCCTTGGTTGGTCTTGCAAAATA
TGCTTGGTCAGGATATGTTCTTGAATGTCCAAAATGTGGTGTTATTTACC
GAAGTCGACAATTTTGGTATGGCAATGGTGAAGTAGAGAATTTTGTGCGC
ATTGAAATCAAACATGTCTGGCCAGGGACACGACTTCCAAACACTAGTCA
AAATTCAGCACGACGCATTTTGGATGGTATGATGAACTTGGCAGATGCAA
TCACCAATGTTAGTGCAAAACCTACTAAAGCTGTCACCAGTTGGGTTACT
GATAAAGTTGCTCCAACCTACTGGACACCTAACTATCTCATTATTGACTG
TGCAAAATGTGGCCATGATTTTGAAGAGACAGAGAAGAAACATCATTGTC
GAGCCTGTGGTCGAGGTTATTGTGACTCGTGTACACAACATAGGATTCCT
GTACCGGACAGAGGCTGGGGAGACACGCCCGTTCGTGTTTGTGATGATTG
CTTCACTAAATCCGGACAAGTCGATCAATCGAGTGTGCAGAAGAATTCGA
TCGATATCAGTGAGTTGTTGGAAGCGATTGATGATGACCCTGAAATCGAT
ACAGGTGAAATGGTAGCCATCAAAACCGCCAAAAACATACCCACCCGCCA
CCCGCCTGAAGTTCTCACAACACGGAAAGTAACCGAGCAAGTCCAGTCCA
CACTTTCATTCCTATCAAGCTCTTTAGAATATCCCTTGGAGTATTTAGTG
GATTCGGCCAGACCTGATTATTGGGTTCCAGATTCCAAGATTTTGAATTG
CCACTCATGCGAAATGGAATTCTCAAAAAAAGATTCTAAGCATCATTGTC
GCAAGTGTGGAAAGGGCTTTTGTGATCCATGCTCAAAGTCTAGAGTGCCG
GTACCGAGTCGTGGTTGGGATTATCCAGTTCGTGTTTGTAACGGATGTTC
GTTGAAGAAAGGTCCTTTGTAATGATTGAGGGTATGATGTCATCATTTAT
AATGATCTGTTGATGGTTGGCTTTATTTGGCTttattatgttttgattta
actttctGCTTAAAAAAAGATATCTACAACCTATGCTGTTGTTTTCCATA
TAACTTTATCGTGATGCTCTTGAATGTAAAGTATCCACACATACTTGAag
cttttttgaatttattcaaAGCTGTGTGAAGAGCATCTCGCTACTTTTCT
TCATGTCTTTTTTGTATCTCTAAACTTGTAACTAGAACTGTATGAATTGT
CATCCCAAAGTTGTTCGTTGTCCCCTAGGACCAGTTATGAATCCTAGTGG
GACACTTCTTTGGAAATGATGAAGTAGACTTAGCTTTTATATCCTAAATC
ATAATCATAATTTTTATCGCTGTACTGTActttactttcgtttttaaccc
TAGTTTCTAAGGGTGCTTGTTCCTTATGTTGAGTTAAGTAGTTAGAGAAT
tgtgttgttttttaattttttacatCACTTTGTGGCTACTGAAAGGTCCC
GTCGAGTTTCTTCAAGTTTTAACCAAATGGGGCCAGATCAAGGATCACAG
acgggtcaaattaaattctcttTACCTTATAATTACGAAGCGTTTCAGTT
TCATTTTTGAGATGAC
Run BLAST on NCBI

protein sequence of TCONS_00001570-protein

>TCONS_00001570-protein ID=TCONS_00001570-protein|Name=TCONS_00001570-protein|organism=Clytia hemisphaerica|type=polypeptide|length=791bp
MAQVSCSNGFSSTEETSKMAADQALLKNSNANIFGDIESMRCEKCKSKKK
KVTVVCIDCGELALCNDCNRKVHENNKVQHQLHELRPKTQTLAKEKQING
TLNGSINGTIHHKKNNSIAKLDIVHNDKPKSLLLIDSTERLQVTKEGDFK
HLLGCDDDPRVKVVSIFGNTGDGKSHTLNHTFFDGAEVFDTSPSQKSCTV
GVWVSYCPNQKAIIVDTEGLLGVSENANKRMRLLMKILAVSDVVIYRTRA
ERLHSDMFTFLGDASEAYIKYFTKDLQSVQQRGHMENVPLCSLGPSIVIF
QETHYTTPLGFENDPSEHDNSPEEILRSNFFNIGRNPAAFSSINYVGTRT
TTQSTDFSILLNEVKKNLKNKTVRSARPVSVIFNALMFLNDKFGDDINDI
LPNSFPDEYFTCVSKCLSCSARCGKNMNHEKEEKEHRSEQKCTYQAQFDN
KVYTCKACHEKGVESLVIPKTAETQDSPLVGLAKYAWSGYVLECPKCGVI
YRSRQFWYGNGEVENFVRIEIKHVWPGTRLPNTSQNSARRILDGMMNLAD
AITNVSAKPTKAVTSWVTDKVAPTYWTPNYLIIDCAKCGHDFEETEKKHH
CRACGRGYCDSCTQHRIPVPDRGWGDTPVRVCDDCFTKSGQVDQSSVQKN
SIDISELLEAIDDDPEIDTGEMVAIKTAKNIPTRHPPEVLTTRKVTEQVQ
STLSFLSSSLEYPLEYLVDSARPDYWVPDSKILNCHSCEMEFSKKDSKHH
CRKCGKGFCDPCSKSRVPVPSRGWDYPVRVCNGCSLKKGPL
Run BLAST on NCBI

transcript from alignment at sc0000011:141382..153715+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001570 ID=TCONS_00001570|Name=TCONS_00001570|organism=Clytia hemisphaerica|type=transcript|length=12334bp|location=Sequence derived from alignment at sc0000011:141382..153715+ (Clytia hemisphaerica)
CGAGACGGTCAATAACAAGACCTTCTTTTGCTGATTCtgcaaaataattt tagatgtAAACAAGAGCCGGAGAAGatcgtttgaaaaaaatttgctggta ggaaaatttatatattttattttaaattgcctAATTGATGTAAACAGCTC GTAAAGAAGATGTCAATTTTGCAAAGAGATGAAGAACTGATAATCTTTTT CTAATGGAGCGTATTGCTTTTTGTGAAGACTCCATTTTTTGCAGCAATGG CACAGGTTTCCTGTTCAAATGGTTTTTCTTCAACAGAGGAAACTTCCAAG ATGGCTGCCGACCAAGCCTTGCTAAAAAACTCAAATGCTAATATCTTTGG AGATATTGAATCCATGAGATGTGAAAAAtgcaaaagcaaaaagaaaaagg tgACCGTTGTCTGTATTGACTGTGGAGAACTTGCTTTATGCAATGATTGT AACCGCAAAGTACATGAAAATAATAAAGTTCAACATCAGCTGCATGAATT GAGACCAAAAACACAGACTCTAGCCAAAGAAAAGCAAATTAATGGAACAT TGAATGGATCAATTAATGGAACAATTCATCACAAGAAGAACAATAGTATT GCAAAGCTTGACATAGTGCACAATGACAAACCAAAAAGTTTATTATTGAT TGACAGTACAGAAAGATTGCAGGTATGTAtatttttttcacaaagtcaAA AACTTCCAAATCATGAGGCAAGAGTAATCAATGAACGGGTTTACCATTGC TTTggataaaatattttatgtatatAATGATTTAAAGTTCATCAGTCATA ATCCATCATTTTCCAATACACAACCTTGTACACACAAGAAGATAAGCAGT CCAGCTTTCTACTTTCTGTGTGATTttgagcttgattttttgtcaaaaaa ttcatATGGAACAAAGGAAAATAGTCAAAGATcgacagtcaggcacatcc tggcaaatgaacggggtgagcatagaccttttttcaaagaggatgtcctg ttgaataattatgtagtccagccataaaaacaatgatagagccatgcata attacagTATCATGCATATTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNaaaagcgtgaaaatgaataaaaatgaacttcaaactg aaaaagggaaaaaaggaagaaaactgggaactttattttttcattaaaag tttcttcaatcttcaatcaagacaaaattgacccatggaaaaaaaatttc atctatgcagttctttgaaatgaagcaaaatatttccaaccctgttcaat taaactgggtattcggcgctattacgtcactttcgttttcgaccccattc atttgccaatggtcgcaagtgaaaaatacgccgttcatttgccaggatgt gcctgactgatcAAAGAAATTTACCTTTACTTTCAATTGCAATTGCATTA ATAGAAAGTACAGGGGCTTTCAAAGCTTTATGAAATAGGGACTTCCACAA GCTGCTAGAAAAAAGCCTTCAGATTGAAGACGAAAAAAATTTGCATTGTC ATGATGGAGCACATGAAAAAATGAGCACATGAATAAAACCTGAGTAAGCT GTTAAATAAATATCACTCTAACTACTTTGCAGACCAGACAGTTGCTATga cggaattagacaaggtacTGTGAGTTGGTCTAATCAgcgaggctggaact tcgatttttaaggattacgattttaccagctttttagcgaatTTTGCCTT GCTAATCCAAATTTTGCTAATCTAAAGTTTTTCAGTGTTCcgaaaaaacg catagcagaaattatttcatcttcacaggatcgattctcagcATTAAAAT ACATCTTATGATTAGCTCGCgttctcgcgcgggcgaataaagatgaggcg acAATCTTGCACTAAGGgtgctaccgtcaactgctctaacttgggactat ctgacaaaacatgggacggcaattcggccaccatttcaccgaatgtccaa agtcatttggtttgagttaaggaacagtatttaaaaatacaggatttctc tttcaattttacagtaagtgaaaatacagaccagatatgcaacagtccca tgttgcgaccaatcgtcccaagttagagcagttgacggtacttaGTTTCT GCCCTATTTTGCGCCAACAATAGAATGGTTCAAATACAGGgatattccaa atgataaatgaTGTtgttttgtaagtgtttattttctgagagatacaaat aatatattgaatattattaacttatttattcaagtatttttgagcgcaaa tttaaattttaaatttaaatttgatgtCAGATTTTTTCTGTGCTGCCACG ATcctgaaaatgcaaaaatatggcagaaatcaacgaaaattctaacaatg aaattcaacaaaattatgGATATTGCACACCCAATAACTGTTTAACAAAC ACCATCATAGCAGATAACGACACCTTACAATGTAGGAGATGTGATAGACT TGTCCATTATGCTTGCTCTGAGCTCCCGGCCTATATGATTCAGCTTTGTC TGCAATATAAAAGCTGGCGCTTCGAATGTGGAAATTGTGTTACAATAACG CCACTCTTACTTGAGAGGATTAAAACAAGCAGACAAAAAGCTCGCAGTAA CATCACAACGAAAGAAGTAGATAAAGATGAACATCATAGATTGAAATTAG GTTTCAACGAGAGAATAACCTTTCTAGAAAGGAAAGTCGAGAAgctaatg aataaaaaagacGTCAACAAAGAGAGGAACAACAAACGATCTGAAACACA GCTCGACAacacagaaacaaaaaaacaatcatatgcagaagtcaccaaag aagatctacaaaaacaagaggtgaccataaaaagtttcatcaaatcAGTG AACCAAGAGGAGCGTTGACTCAAATCAACCAAGTGCAACATCATAGTGCA TGATTTAGGtgaaaacaaacacaaaaacaaagaaGAGCAACAAGTTGGTG ACAAAGATTTTATAGAAAGAATACTGAAACAACAAATGGGTTTCGACGTG ATGATAATCAAGGTAGAACGCATAGGTGCTGGCAAAGATGAATTGTATAC AAATGAACGATGGAGACCATTAAAAGTTACTCTCGGGAGTGAAGAAGAAA GGATTAGAATACTTGCATCAGCCCACAAACTAGATAAAGATGATTTCAGA GTAtcagacgatttttcaaggaaagaatgggagataataaaacaatggca tcataaagcaaaagaaaaaacatcgaaagaaaaagacaagagtcatatat ggaaagtgagaggtagtcctaggactaaactctatttaaagaaatttacg acgGAAACAACATGATTGTAAGAAGAGTGGGTTAGAGGCCAGAATTGACA GATgaatggaatgataagatctataaattgtaaagatgtaagattgtttc atagaggtcaatagacctgagaaatacacttctataaataaaaaaataaa taccgtaaatcctcgaataagcgccccgcttgaataagtgccccgctcga ataagcgcctcCCTTTTAGTTGAAATAATATTATAAGCGCCctgcttgaa taagcgcccccctttgAATAAGCACCCCCTCCAGGGAGAAGTTTTTATTT ATGGGTAAGGTTGGTACTACTTTCAGATGTGTGTGGAGAGGTGCACGTAC ACGTGTGCATTGCACACCTCAAATGATTCAGTCTTAAGAAGTCTGAAAAT TGGACAAGAAATAGATACCTAGATGATTCAATTGAAGGGAAACAACAATG AAATAAACCAAATCAAGTCCAGCCTTATAATATTTGACTATTAAATTAAA CCCAAGCTGCTCTCAGATTTTTTCTCCAANTCTGATTGACAACAATAGAA TGATTAGTATTATAGAATCTTTTTATAtgtgttttcaaagtttttacaaC TTGGAGCTTTGGTTCTTCTATACTCTTCATTTTTCCCATAGGATCATAGA CCACATAGATAAATCAGTAATTGTTTCAGACAGTTTGAGATTTTCAAAGT ATTTCTGcaaatttcaacaaaaggatgggatcaaaaaattttttgcttcA TAAGGCATTACCTTTTAAAAAACTGTGTAATCTGGTGTAATCGAggtttt attatttatttggatttcaGGTAGAACAATAATTTTGTACATTTCTAGGT AACAAAAGAGGGTGATTTCAAGCATTTACTTGGTTGTGATGATGATCCTC GAGTGAAAGTTGTTTCAATCTTTGGAAACACAGGAGATGGAAAATCACAT ACTCTGAATCATACATTTTTTGACGGCGCTGAAGTATTTGATACATCACC ATCCCAAAAATCATGTACCGTTGGTGTATGGGTTTCCTACTGCCCGAACC AGAAAGCCATCATCGTGGATACAGAAGGTCTGCTTGGtgtttcagaaaat gcaaataagAGGATGAGATTGTTGATGAAGATTCTTGCTGTCTCGGATGT TGTGATTTATCGTACAAGAGCAGAACGCCTACATTCTGATATGTTTACTT TCTTGGGTGATGCTTCAGAAGCCTACatcaaatatttcacaaaagaTCTT CAATCAGTTCAACAAAGAGGCCATATGGAGAATGTTCCCTTGTGTAGCTT AGGTCCCTCTATTGTTATCTTTCAAGAGACACATTACACTACACCACTTG GTTTTGAAAATGATCCATCAGAACAGTAAGTAAATTATGACAGAAGGTCA ATTTGTACTCTCTGGAAAGACTTCTTGAATTAATTCTctccaaaaacttt taaaacttggCACTCttttttgtaaacgaaaaagaGGGGTTGATAACAAA GCTACACAGCTTTTCACCTTGAGTTTACACAAAAGTAACATAGATTTCTC TGAATAATCTTTTTGGTATATTCGTTCAATTGAGCACCAATTGATGCTGA ATAATCCAAATACATCGATTTGACAATCTTAGAATacttcaaatttgttt ttattttcactttacAGTGATAACAGTCCAGAAGAGATTTTGAGatccaa ttttttcaacattggACGCAATCCAGCTGCATNTAaataccgtaaatcct cgaataagcgccccgcttgaataagtgccccgctcgaataagcgcctcCC TTTTAGTTGAAATAATATTATAAGCGCCctgcttgaataagcgcccccct ttgAATAAGCACCCCCTCCAGGGAGAAGTTTTTATTTATGGGTAAGGTTG GTACTACTTTCAGATGTGTGTGGAGAGGTGCACGTACACGTGTGCATTGC ACACCTCAAATGATTCAGTCTTAAGAAGTCTGAAAATTGGACAAGAAATA GATACCTAGATGATTCAATTGAAGGGAAACAACAATGAAATAAACCAAAT CAAGTCCAGCCTTATAATATTTGACTATTAAATTAAACCCAAGCTGCTCT cagattttttctccaattcaaGAATTGAATTTACATAATATTCCTAAGTG AAAGACTTGGAATGTCTCTTGAAAGGTACTTTCAGATAAGTATCCTTGGT AGATTTTTTTAATCGATTAAATGTGATAAACCTTCTTGGAAAATACTAGA ATTTTAAGCTAAATTTGATTGGGTAATTTTGATTTGGAAATACAAGGAAT TTTAAGGCAATTTTGCTTTAGAAAAATAAGAGGTAATTGTCCTGAGGAAG TACAATAAGTGAtgtatgtaatttttctttgagataCAAGGAAGTGTTTA TTAATGGATCGTTTAGTAAATCCAATTTCGAATTTGACAGATAGTCTGGC CGGAATACAATAAAATAGGGGTGAACGTAGAAAAAAATTCCGCGTAGACt ttcttggtaccgttggaagcgaaattttatgtagattatcaTACTCAAAG CCTCNGTGATGATGATCCTCGAGTGAAAGTTGTTTCAATCTTTGGAAACA CAGGAGATGGAAAATCACATACTCTGAATCATACATTTTTTGACGGCGCT GAAGTATTTGATACATCACCATCCCAAAAATCATGTACCGTTGGTGTATG GGTTTCCTACTGCCCGAACCAGAAAGCCATCATCGTGGATACAGAAGGTC TGCTTGGtgtttcagaaaatgcaaataagAGGATGAGATTGTTGATGAAG ATTCTTGCTGTCTCAGATGTTGTGATTTATCGTACAAGAGCAGAACGCCT ACATTCTGATATGTTTACTTTCTTGGGTGATGCTTCAGAAGCCTACatca aatatttcacaaaagaTCTTCAATCAGTTCAACAAAGAGGCCATATGGAG AATGTTCCCTTGTGTAGCTTAGGTCCCTCTATTGTTATCTTTCAAGAGAC ACATTACACTACACCACTTGGTTTTGAAAATGATCCATCAGAACAGTAAG TAAATTATGACAGAAGGTCAATTTGTACTCTCTGGAAAGACTTCTTGAAT TAATTCTctccaaaaacttttaaaacttggCACNCTCTGGAAAGACTTCT TGAATTATTTCTctccaaaaacttttaaaacttggCACTCttttttgtaa acgaaaaagaGGGGTTGATAACAAAGCTACACAGCTTTTCACCTTGAGTT TACACAAAAGTAACATAGATTTCTCTGAATAATCTTTTTGGTATATTCGT TCAATTGAGCACCAATTGATGCTGAATAATCCAAATACATCGATTTGACA ATCTTAGAATacttcaaatttgtttttattttcactttacAGTGATAACA GTCCAGAAGAGATTTTGAGatccaattttttcaacattggACGCAATCCA GCTGCATTTAGTTCCATCAATTATGTTGGTACAAGAACGACTACCCAATC CACTGATTTCTCTATCCTCTTGAATGAAGTGAAGAAAAACCTCAAGAACA AGACCGTTCGTTCTGCAAGACCTGTTTCTGTCATTTTCAATGCTTTGATg gtaaatttgattttaaagattatgttcttttttatatgatataaaagttg ttctttcttttgtttaaaaatgctgtctAAGCAATTGTTAGGAGAtacat taaattaaattttaaaataattaaaaaaataactaTTAAGAACGTTCTTA AACCTTTGGAAATTGTTATTCTTCTACAATTCTTTCTTCTTTAGTTCTAT TGCCAATAAGCTGAGTGTTTGTATTTAAGCGCACTCCTTTGAGTCTGAGA TTTATATCAGTGGATCGGGCGTGCACTGACGATAACCACTCTTTACCTTT ATTGTAGTTTTTGAATGACAAATTCGGTGATGATATCAATGACATCCTAC CAAACAGTTTCCCTGATGAATATTTTACATGTGTTTCAAAATGTTTATCA TGCAGGTATGTTTAATGTTCTTGGAATATCTATTCAATTTATAGAGGATT TTAATCAGTGTTAATCCTTGTTATTCTGTTGTAATGGAATCCTTAAAAGA ATTTGGAAGTAGAACTGCGCAAAATCTAGCAGAACTTGTTTATAGAATCC TTAAAATCATTTTACTGTGGACCGAACTGACTTGATCACTGTACGGAACC AATTCTATGTTTTTTTCGAAAGATATCAATCAACTTTCGATCCAGCTCCC AAGCAACTCTAGACATTTCCAACAGAACCTTCTCCAATACCTTCCATTCT TTCTAATAGTGCTCGATGTGGAAAAAACATGAATCAtgagaaagaagaga aagaacatCGCTCAGAACAAAAGTGTACATATCAAGCACAATTTGACAAC AAAGTATATACGTGCAAGGTACGTCTGATTTTTATCTACTTTTATTTTGA AGTAATGTCAGTAAAAGTTTTGCCGTCTCGGTCCGCTTTTTGTCTCAGCT TTGCCAGCTAGTCTAAAAAGTTAGCAAAAAATCTATAGAATCTGTTGGAA TTTGTTGTGTAAagttaatttttatttgatacgctacttttgttttcatt tgttttgttAATCGCGAGTGTTGGTAGAGTCTTTTATTATAAACAAGGCA ATAGTCGACCAATTTTAAACCTGTTTATTTCCTAGGCATGCCATGAGAAA GGCGTTGAATCACTTGTGATACCCAAAACTGCTGAAACTCAAGATTCTCC CTTGGTTGGTCTTGCAAAATATGCTTGGTCAGGGTATGTTCTCATTGTGT TTGTGATTTGTATTAAGAAAAGAAGTTGTATTTAGAATGCtgtgttttga tttctttttcaatgtatttttcattaaaagttatACATAACATTGAATTC GCACctttaaaattaagaaaattgcaGAGAAAAAGATTGCATTTTGTTAA tacttttaaattaaaatagttTTCAGAAGATACACTAAAATCGactgttt gttttttaataCACGATACTGAATAGCATTTGGCTTCCAGAGCAGAACAG GCTCCTTACATTGTTATTTCACAAAATAATTtcactaaaaagttcaaaag tgATTAATTCTGACGACGttttatttttggaaagtttttctttttagatt ttgtCTGGATTTCTCCTATACCTTTCAAACTGGCTGTCTGTAGATAATCC AAGTTATATTCAAATACACGATTTTCGTATTGCCAGTTAGATGAGCTTGG ACTTAAAATGGTCCGCTAAATAAAAGATTTGTAATGATTTTCGtccagaa tcacaaaatatggTCCAAACAAGTTTTtctatcttttaattttttggagg ATTGTTTCTTGAATTTACATCCATAAGACTTTTTGTACAGTCGTTTGTCA TGCAACGAATAATGATACAAAAATTAGTATCTTTTCTTTTCCCTAGATAT GTTCTTGAATGTCCAAAATGTGGTGTTATTTACCGAAGTCGACAATTTTG GTATGGCAATGGTGAAGTAGAGAATTTTGTGCGCATTGAAATCAAACATG TCTGGCCAGGGgtaagattttgatattttctgttCATCGCGTATACAAGT CTCTCATTCCAAGCTTCTTCAAATTTGTAGCCAAGAGTGTCGTGAGAAGT ACATGAATGCAAAGCTCATAAAGAGAACTTTACccaaaaagctaaaactt taCTTTAGTTTATACTGAATTGTGTCTAGAGCTTTTTAATTCTGTTNAAA CTTTACTTTAGTTTATAATGAATTGTGTCTAGAGCTTTTTAAATATGTTG ATGAACGATTTGCTTGAAAATAGACTCACTTCACAATCAATGCATTCCTC TACCACATTTCGaaattataagaatattaatTCGTTTGCAGACACGACTT CCAAACACTAGTCAAAATTCAGCACGACGCATTTTGGATGGTATGATGAA CTTGGCAGATGCAATCACCAATGTTAGTGCAAAACCTACTAAAGCTGTCA CCAGTTGGGTTACTGATAAAGTTGCTCCAACCTACTGGACACCTAACTAT CTCATTATTGTAAGttcttttgttatattttcgaatatattgTGTCTTTG AGAGATATGTTGTTGAACGATGGAAAAAATTGTGATCCGCTCTCaatgat atttttatttgtgTCTTTGAAAGATAAACTTTTGGAATCTATAATGTATt aaattggagaaaaatttgTCCAATGGCCCTGAATGGCCATGCTTAAGAAG ATGTTGTAAAATATGAAAGATTCGAGGTTTTTTCTTTTGGACAAACTATT CAAATTAAAAGGGCTATTCAAATATGCAATTTCTAGGTAAAAATTAGCAT GGTAAAAAGGGTGTGTCATTTGtcgattggaattttttttgtctaAAGTA ATTATATGGGAAGTTCATATAATTCCACtgttttcaaagaaaagttttgt ttatttttgagtAATGAGTAACTGCGAGTTTGAAAGTCGTTTTTTCCTCC AATTAATATCAGACCTGGTGGGAGGGCAGAAGGCTGGAAGaaagaatgaa gaagaagaaaacaatcCATTCATGTTTTctccttaaaatgttttttataa gaaaatcacTTTCAAGAAAGTACTTGATTAAACCTTAAACTTTGCCAGCC AATCTCTTGGATGGACAAAAAttcttcgaatttttttacaatattatggt gaaaatatttgaaatatatCTCACTTCGATTTTTCACCCTCTCTAGGACT GTGCAAAATGTGGCCATGATTTTGAAGAGACAGAGAAGAAACATCATTGT CGAGCCTGTGGTCGAGGTTATTGTGACTCGTGTACACAACATAGGATTCC TGTACCGGACAGAGGCTGGGGAGACACGCCCGTTCGTGTTTGTGATGATT GCTTCACTAAATCCGGACAAGTCGATCAATCGAGTGTGCAGAAGAATTCG ATCGATATCAGGTAAGAAAATTTCCAGTTTGTTAAATGTGCAAGATTTTG AGTTGCAAACATCGTTAAgaataacacccccttctcactgaCACGGTAGG ATTCTTTCAGCCTggaataaaaataacggactgaaattcgatggggatta acattcccatattttttatggcttgggatttcaattcttttgttttcaag tcacaaaattcagtggggatagaaagaatagtataatattttgcagtgaa gattggtttatttgattattttcagtggggataaaaattggaggataatt ttcaactatggacgatatttttgccaatttttccagtgtgaaggggtccc agtaggtctgtgagaaggggtttaAGAATAGTACACGAaggaatctttta aaaaaatcgcaaaagctcaaagtttcaaatttaaaaactgAACCACCTTC ATATTATTTGCATGCTTTCTTTTACCAAAAACGCAATGTTAAAATCGATA ATGACGACGATATAGTACCCAAAAGGCAAGGGTTAGACCTATGGTTTtcc tagaaaaaaattaaagccGGTTCTCGGTATAGTCTAAATCACATCCCTTT GTAAAACCGCAGGTCTAAGGAGCtagaatccgttagtggatgctaGCAGC AGTAGAATTTTCTTGTGATATCATTGGAATATCTTTATAGATGCCTTTTT AGGAATTCtagctttacagatctgtgaatATTATCAAATCGAAAATTGAC CATCTTTTCTCTCTCCTTCCATCCATAGTGAGTTGTTGGAAGCGATTGAT GATGACCCTGAAATCGATACAGGTGAAATGGTAGCCATCAAAACCGCCAA AAACATACCCACCCGCCACCCGCCTGAAGTTCTCACAACACGGAAAGTAA CCGAGCAAGTCCAGTCCACACTTTCATTCCTATCAAGCTCTTTAGAATAT CCCTTGGAGTATTTAGTGGATTCGGCCAGACCTGATTATTGGGTTCCAGA TTCCAAGATTTTGAATTGCCACTCATGCGAAATGGAATTCTCAAAAAAAG ATTCTAAGCATCATTGTCGCAAGTGTGGAAAGGGCTTTTGTGATCCATGC TCAAAGTCTAGAGTGCCGGTACCGAGTCGTGGTTGGGATTATCCAGTTCG TGTTTGTAACGGATGTTCGTTGAAGAAAGGTCCTTTGTAATGATTGAGGG TATGATGTCATCATTTATAATGATCTGTTGATGGTTGGCTTTATTTGGCT ttattatgttttgatttaactttctGCTTAAAAAAAGATATCTACAACCT ATGCTGTTGTTTTCCATATAACTTTATCGTGATGCTCTTGAATGTAAAGT ATCCACACATACTTGAagcttttttgaatttattcaaAGCTGTGTGAAGA GCATCTCGCTACTTTTCTTCATGTCTTTTTTGTATCTCTAAACTTGTAAC TAGAACTGTATGAATTGTCATCCCAAAGTTGTTCGTTGTCCCCTAGGACC AGTTATGAATCCTAGTGGGACACTTCTTTGGAAATGATGAAGTAGACTTA GCTTTTATATCCTAAATCATAATCATAATTTTTATCGCTGTACTGTActt tactttcgtttttaacccTAGTTTCTAAGGGTGCTTGTTCCTTATGTTGA GTTAAGTAGTTAGAGAATtgtgttgttttttaattttttacatCACTTTG TGGCTACTGAAAGGTCCCGTCGAGTTTCTTCAAGTTTTAACCAAATGGGG CCAGATCAAGGATCACAGacgggtcaaattaaattctcttTACCTTATAA TTACGAAGCGTTTCAGTTTCATTTTTGAGATGAC

Coding sequence (CDS) from alignment at sc0000011:141382..153715+

>TCONS_00001570 ID=TCONS_00001570|Name=TCONS_00001570|organism=Clytia hemisphaerica|type=CDS|length=26136bp|location=Sequence derived from alignment at sc0000011:141382..153715+ (Clytia hemisphaerica)
ATGGCACAGGTTTCCTGTTCAAATGGTTTTTCTTCAACAGAGGAAACTTC
CAAGATGGCTGCCGACCAAGCCTTGCTAAAAAACTCAAATGCTAATATCT
TTGGAGATATTGAATCCATGAGATGTGAAAAAtgcaaaagcaaaaagaaa
aaggtgACCGTTGTCTGTATTGACTGTGGAGAACTTGCTTTATGCAATGA
TTGTAACCGCAAAGTACATGAAAATAATAAAGTTCAACATCAGCTGCATG
AATTGAGACCAAAAACACAGACTCTAGCCAAAGAAAAGCAAATTAATGGA
ACATTGAATGGATCAATTAATGGAACAATTCATCACAAGAAGAACAATAG
TATTGCAAAGCTTGACATAGTGCACAATGACAAACCAAAAAGTTTATTAT
TGATTGACAGTACAGAAAGATTGCAGGTAACAAAAGAGGGTGATTTCAAG
CATTTACTTGGTTGTGATGATGATCCTCGAGTGAAAGTTGTTTCAATCTT
TGGAAACACAGGAGATGGAAAATCACATACTCTGAATCATACATTTTTTG
ACGGCGCTGAAGTATTTGATACATCACCATCCCAAAAATCATGTACCGTT
GGTGTATGGGTTTCCTACTGCCCGAACCAGAAAGCCATCATCGTGGATAC
AGAAGGTCTGCTTGGtgtttcagaaaatgcaaataagAGGATGAGATTGT
TGATGAAGATTCTTGCTGTCTCGGATGTTGTGATTTATCGTACAAGAGCA
GAACGCCTACATTCTGATATGTTTACTTTCTTGGGTGATGCTTCAGAAGC
CTACatcaaatatttcacaaaagaTCTTCAATCAGTTCAACAAAGAGGCC
ATATGGAGAATGTTCCCTTGTGTAGCTTAGGTCCCTCTATTGTTATCTTT
CAAGAGACACATTACACTACACCACTTGGTTTTGAAAATGATCCATCAGA
ACATGATAACAGTCCAGAAGAGATTTTGAGatccaattttttcaacattg
gACGCAATCCAGCTGCATTTAGTTCCATCAATTATGTTGGTACAAGAACG
ACTACCCAATCCACTGATTTCTCTATCCTCTTGAATGAAGTGAAGAAAAA
CCTCAAGAACAAGACCGTTCGTTCTGCAAGACCTGTTTCTGTCATTTTCA
ATGCTTTGATgTTTTTGAATGACAAATTCGGTGATGATATCAATGACATC
CTACCAAACAGTTTCCCTGATGAATATTTTACATGTGTTTCAAAATGTTT
ATCATGCAGTGCTCGATGTGGAAAAAACATGAATCAtgagaaagaagaga
aagaacatCGCTCAGAACAAAAGTGTACATATCAAGCACAATTTGACAAC
AAAGTATATACGTGCAAGGCATGCCATGAGAAAGGCGTTGAATCACTTGT
GATACCCAAAACTGCTGAAACTCAAGATTCTCCCTTGGTTGGTCTTGCAA
AATATGCTTGGTCAGGATATGTTCTTGAATGTCCAAAATGTGGTGTTATT
TACCGAAGTCGACAATTTTGGTATGGCAATGGTGAAGTAGAGAATTTTGT
GCGCATTGAAATCAAACATGTCTGGCCAGGGACACGACTTCCAAACACTA
GTCAAAATTCAGCACGACGCATTTTGGATGGTATGATGAACTTGGCAGAT
GCAATCACCAATGTTAGTGCAAAACCTACTAAAGCTGTCACCAGTTGGGT
TACTGATAAAGTTGCTCCAACCTACTGGACACCTAACTATCTCATTATTG
ACTGTGCAAAATGTGGCCATGATTTTGAAGAGACAGAGAAGAAACATCAT
TGTCGAGCCTGTGGTCGAGGTTATTGTGACTCGTGTACACAACATAGGAT
TCCTGTACCGGACAGAGGCTGGGGAGACACGCCCGTTCGTGTTTGTGATG
ATTGCTTCACTAAATCCGGACAAGTCGATCAATCGAGTGTGCAGAAGAAT
TCGATCGATATCAGTGAGTTGTTGGAAGCGATTGATGATGACCCTGAAAT
CGATACAGGTGAAATGGTAGCCATCAAAACCGCCAAAAACATACCCACCC
GCCACCCGCCTGAAGTTCTCACAACACGGAAAGTAACCGAGCAAGTCCAG
TCCACACTTTCATTCCTATCAAGCTCTTTAGAATATCCCTTGGAGTATTT
AGTGGATTCGGCCAGACCTGATTATTGGGTTCCAGATTCCAAGATTTTGA
ATTGCCACTCATGCGAAATGGAATTCTCAAAAAAAGATTCTAAGCATCAT
TGTCGCAAGTGTGGAAAGGGCTTTTGTGATCCATGCTCAAAGTCTAGAGT
GCCGGTACCGAGTCGTGGTTGGGATTATCCAGTTCGTGTTTGTAACGGAT
GTTCGTTGAAGAAAGGTCCTTTGTAAATGGCACAGGTTTCCTGTTCAAAT
GGTTTTTCTTCAACAGAGGAAACTTCCAAGATGGCTGCCGACCAAGCCTT
GCTAAAAAACTCAAATGCTAATATCTTTGGAGATATTGAATCCATGAGAT
GTGAAAAAtgcaaaagcaaaaagaaaaaggtgACCGTTGTCTGTATTGAC
TGTGGAGAACTTGCTTTATGCAATGATTGTAACCGCAAAGTACATGAAAA
TAATAAAGTTCAACATCAGCTGCATGAATTGAGACCAAAAACACAGACTC
TAGCCAAAGAAAAGCAAATTAATGGAACATTGAATGGATCAATTAATGGA
ACAATTCATCACAAGAAGAACAATAGTATTGCAAAGCTTGACATAGTGCA
CAATGACAAACCAAAAAGTTTATTATTGATTGACAGTACAGAAAGATTGC
AGGTAACAAAAGAGGGTGATTTCAAGCATTTACTTGGTTGTGATGATGAT
CCTCGAGTGAAAGTTGTTTCAATCTTTGGAAACACAGGAGATGGAAAATC
ACATACTCTGAATCATACATTTTTTGACGGCGCTGAAGTATTTGATACAT
CACCATCCCAAAAATCATGTACCGTTGGTGTATGGGTTTCCTACTGCCCG
AACCAGAAAGCCATCATCGTGGATACAGAAGGTCTGCTTGGtgtttcaga
aaatgcaaataagAGGATGAGATTGTTGATGAAGATTCTTGCTGTCTCGG
ATGTTGTGATTTATCGTACAAGAGCAGAACGCCTACATTCTGATATGTTT
ACTTTCTTGGGTGATGCTTCAGAAGCCTACatcaaatatttcacaaaaga
TCTTCAATCAGTTCAACAAAGAGGCCATATGGAGAATGTTCCCTTGTGTA
GCTTAGGTCCCTCTATTGTTATCTTTCAAGAGACACATTACACTACACCA
CTTGGTTTTGAAAATGATCCATCAGAACATGATAACAGTCCAGAAGAGAT
TTTGAGatccaattttttcaacattggACGCAATCCAGCTGCATTTAGTT
CCATCAATTATGTTGGTACAAGAACGACTACCCAATCCACTGATTTCTCT
ATCCTCTTGAATGAAGTGAAGAAAAACCTCAAGAACAAGACCGTTCGTTC
TGCAAGACCTGTTTCTGTCATTTTCAATGCTTTGATgTTTTTGAATGACA
AATTCGGTGATGATATCAATGACATCCTACCAAACAGTTTCCCTGATGAA
TATTTTACATGTGTTTCAAAATGTTTATCATGCAGTGCTCGATGTGGAAA
AAACATGAATCAtgagaaagaagagaaagaacatCGCTCAGAACAAAAGT
GTACATATCAAGCACAATTTGACAACAAAGTATATACGTGCAAGGCATGC
CATGAGAAAGGCGTTGAATCACTTGTGATACCCAAAACTGCTGAAACTCA
AGATTCTCCCTTGGTTGGTCTTGCAAAATATGCTTGGTCAGGATATGTTC
TTGAATGTCCAAAATGTGGTGTTATTTACCGAAGTCGACAATTTTGGTAT
GGCAATGGTGAAGTAGAGAATTTTGTGCGCATTGAAATCAAACATGTCTG
GCCAGGGACACGACTTCCAAACACTAGTCAAAATTCAGCACGACGCATTT
TGGATGGTATGATGAACTTGGCAGATGCAATCACCAATGTTAGTGCAAAA
CCTACTAAAGCTGTCACCAGTTGGGTTACTGATAAAGTTGCTCCAACCTA
CTGGACACCTAACTATCTCATTATTGACTGTGCAAAATGTGGCCATGATT
TTGAAGAGACAGAGAAGAAACATCATTGTCGAGCCTGTGGTCGAGGTTAT
TGTGACTCGTGTACACAACATAGGATTCCTGTACCGGACAGAGGCTGGGG
AGACACGCCCGTTCGTGTTTGTGATGATTGCTTCACTAAATCCGGACAAG
TCGATCAATCGAGTGTGCAGAAGAATTCGATCGATATCAGTGAGTTGTTG
GAAGCGATTGATGATGACCCTGAAATCGATACAGGTGAAATGGTAGCCAT
CAAAACCGCCAAAAACATACCCACCCGCCACCCGCCTGAAGTTCTCACAA
CACGGAAAGTAACCGAGCAAGTCCAGTCCACACTTTCATTCCTATCAAGC
TCTTTAGAATATCCCTTGGAGTATTTAGTGGATTCGGCCAGACCTGATTA
TTGGGTTCCAGATTCCAAGATTTTGAATTGCCACTCATGCGAAATGGAAT
TCTCAAAAAAAGATTCTAAGCATCATTGTCGCAAGTGTGGAAAGGGCTTT
TGTGATCCATGCTCAAAGTCTAGAGTGCCGGTACCGAGTCGTGGTTGGGA
TTATCCAGTTCGTGTTTGTAACGGATGTTCGTTGAAGAAAGGTCCTTTGT
AAATGGCACAGGTTTCCTGTTCAAATGGTTTTTCTTCAACAGAGGAAACT
TCCAAGATGGCTGCCGACCAAGCCTTGCTAAAAAACTCAAATGCTAATAT
CTTTGGAGATATTGAATCCATGAGATGTGAAAAAtgcaaaagcaaaaaga
aaaaggtgACCGTTGTCTGTATTGACTGTGGAGAACTTGCTTTATGCAAT
GATTGTAACCGCAAAGTACATGAAAATAATAAAGTTCAACATCAGCTGCA
TGAATTGAGACCAAAAACACAGACTCTAGCCAAAGAAAAGCAAATTAATG
GAACATTGAATGGATCAATTAATGGAACAATTCATCACAAGAAGAACAAT
AGTATTGCAAAGCTTGACATAGTGCACAATGACAAACCAAAAAGTTTATT
ATTGATTGACAGTACAGAAAGATTGCAGGTAACAAAAGAGGGTGATTTCA
AGCATTTACTTGGTTGTGATGATGATCCTCGAGTGAAAGTTGTTTCAATC
TTTGGAAACACAGGAGATGGAAAATCACATACTCTGAATCATACATTTTT
TGACGGCGCTGAAGTATTTGATACATCACCATCCCAAAAATCATGTACCG
TTGGTGTATGGGTTTCCTACTGCCCGAACCAGAAAGCCATCATCGTGGAT
ACAGAAGGTCTGCTTGGtgtttcagaaaatgcaaataagAGGATGAGATT
GTTGATGAAGATTCTTGCTGTCTCGGATGTTGTGATTTATCGTACAAGAG
CAGAACGCCTACATTCTGATATGTTTACTTTCTTGGGTGATGCTTCAGAA
GCCTACatcaaatatttcacaaaagaTCTTCAATCAGTTCAACAAAGAGG
CCATATGGAGAATGTTCCCTTGTGTAGCTTAGGTCCCTCTATTGTTATCT
TTCAAGAGACACATTACACTACACCACTTGGTTTTGAAAATGATCCATCA
GAACATGATAACAGTCCAGAAGAGATTTTGAGatccaattttttcaacat
tggACGCAATCCAGCTGCATTTAGTTCCATCAATTATGTTGGTACAAGAA
CGACTACCCAATCCACTGATTTCTCTATCCTCTTGAATGAAGTGAAGAAA
AACCTCAAGAACAAGACCGTTCGTTCTGCAAGACCTGTTTCTGTCATTTT
CAATGCTTTGATgTTTTTGAATGACAAATTCGGTGATGATATCAATGACA
TCCTACCAAACAGTTTCCCTGATGAATATTTTACATGTGTTTCAAAATGT
TTATCATGCAGTGCTCGATGTGGAAAAAACATGAATCAtgagaaagaaga
gaaagaacatCGCTCAGAACAAAAGTGTACATATCAAGCACAATTTGACA
ACAAAGTATATACGTGCAAGGCATGCCATGAGAAAGGCGTTGAATCACTT
GTGATACCCAAAACTGCTGAAACTCAAGATTCTCCCTTGGTTGGTCTTGC
AAAATATGCTTGGTCAGGATATGTTCTTGAATGTCCAAAATGTGGTGTTA
TTTACCGAAGTCGACAATTTTGGTATGGCAATGGTGAAGTAGAGAATTTT
GTGCGCATTGAAATCAAACATGTCTGGCCAGGGACACGACTTCCAAACAC
TAGTCAAAATTCAGCACGACGCATTTTGGATGGTATGATGAACTTGGCAG
ATGCAATCACCAATGTTAGTGCAAAACCTACTAAAGCTGTCACCAGTTGG
GTTACTGATAAAGTTGCTCCAACCTACTGGACACCTAACTATCTCATTAT
TGACTGTGCAAAATGTGGCCATGATTTTGAAGAGACAGAGAAGAAACATC
ATTGTCGAGCCTGTGGTCGAGGTTATTGTGACTCGTGTACACAACATAGG
ATTCCTGTACCGGACAGAGGCTGGGGAGACACGCCCGTTCGTGTTTGTGA
TGATTGCTTCACTAAATCCGGACAAGTCGATCAATCGAGTGTGCAGAAGA
ATTCGATCGATATCAGTGAGTTGTTGGAAGCGATTGATGATGACCCTGAA
ATCGATACAGGTGAAATGGTAGCCATCAAAACCGCCAAAAACATACCCAC
CCGCCACCCGCCTGAAGTTCTCACAACACGGAAAGTAACCGAGCAAGTCC
AGTCCACACTTTCATTCCTATCAAGCTCTTTAGAATATCCCTTGGAGTAT
TTAGTGGATTCGGCCAGACCTGATTATTGGGTTCCAGATTCCAAGATTTT
GAATTGCCACTCATGCGAAATGGAATTCTCAAAAAAAGATTCTAAGCATC
ATTGTCGCAAGTGTGGAAAGGGCTTTTGTGATCCATGCTCAAAGTCTAGA
GTGCCGGTACCGAGTCGTGGTTGGGATTATCCAGTTCGTGTTTGTAACGG
ATGTTCGTTGAAGAAAGGTCCTTTGTAAATGGCACAGGTTTCCTGTTCAA
ATGGTTTTTCTTCAACAGAGGAAACTTCCAAGATGGCTGCCGACCAAGCC
TTGCTAAAAAACTCAAATGCTAATATCTTTGGAGATATTGAATCCATGAG
ATGTGAAAAAtgcaaaagcaaaaagaaaaaggtgACCGTTGTCTGTATTG
ACTGTGGAGAACTTGCTTTATGCAATGATTGTAACCGCAAAGTACATGAA
AATAATAAAGTTCAACATCAGCTGCATGAATTGAGACCAAAAACACAGAC
TCTAGCCAAAGAAAAGCAAATTAATGGAACATTGAATGGATCAATTAATG
GAACAATTCATCACAAGAAGAACAATAGTATTGCAAAGCTTGACATAGTG
CACAATGACAAACCAAAAAGTTTATTATTGATTGACAGTACAGAAAGATT
GCAGGTAACAAAAGAGGGTGATTTCAAGCATTTACTTGGTTGTGATGATG
ATCCTCGAGTGAAAGTTGTTTCAATCTTTGGAAACACAGGAGATGGAAAA
TCACATACTCTGAATCATACATTTTTTGACGGCGCTGAAGTATTTGATAC
ATCACCATCCCAAAAATCATGTACCGTTGGTGTATGGGTTTCCTACTGCC
CGAACCAGAAAGCCATCATCGTGGATACAGAAGGTCTGCTTGGtgtttca
gaaaatgcaaataagAGGATGAGATTGTTGATGAAGATTCTTGCTGTCTC
GGATGTTGTGATTTATCGTACAAGAGCAGAACGCCTACATTCTGATATGT
TTACTTTCTTGGGTGATGCTTCAGAAGCCTACatcaaatatttcacaaaa
gaTCTTCAATCAGTTCAACAAAGAGGCCATATGGAGAATGTTCCCTTGTG
TAGCTTAGGTCCCTCTATTGTTATCTTTCAAGAGACACATTACACTACAC
CACTTGGTTTTGAAAATGATCCATCAGAACATGATAACAGTCCAGAAGAG
ATTTTGAGatccaattttttcaacattggACGCAATCCAGCTGCATTTAG
TTCCATCAATTATGTTGGTACAAGAACGACTACCCAATCCACTGATTTCT
CTATCCTCTTGAATGAAGTGAAGAAAAACCTCAAGAACAAGACCGTTCGT
TCTGCAAGACCTGTTTCTGTCATTTTCAATGCTTTGATgTTTTTGAATGA
CAAATTCGGTGATGATATCAATGACATCCTACCAAACAGTTTCCCTGATG
AATATTTTACATGTGTTTCAAAATGTTTATCATGCAGTGCTCGATGTGGA
AAAAACATGAATCAtgagaaagaagagaaagaacatCGCTCAGAACAAAA
GTGTACATATCAAGCACAATTTGACAACAAAGTATATACGTGCAAGGCAT
GCCATGAGAAAGGCGTTGAATCACTTGTGATACCCAAAACTGCTGAAACT
CAAGATTCTCCCTTGGTTGGTCTTGCAAAATATGCTTGGTCAGGATATGT
TCTTGAATGTCCAAAATGTGGTGTTATTTACCGAAGTCGACAATTTTGGT
ATGGCAATGGTGAAGTAGAGAATTTTGTGCGCATTGAAATCAAACATGTC
TGGCCAGGGACACGACTTCCAAACACTAGTCAAAATTCAGCACGACGCAT
TTTGGATGGTATGATGAACTTGGCAGATGCAATCACCAATGTTAGTGCAA
AACCTACTAAAGCTGTCACCAGTTGGGTTACTGATAAAGTTGCTCCAACC
TACTGGACACCTAACTATCTCATTATTGACTGTGCAAAATGTGGCCATGA
TTTTGAAGAGACAGAGAAGAAACATCATTGTCGAGCCTGTGGTCGAGGTT
ATTGTGACTCGTGTACACAACATAGGATTCCTGTACCGGACAGAGGCTGG
GGAGACACGCCCGTTCGTGTTTGTGATGATTGCTTCACTAAATCCGGACA
AGTCGATCAATCGAGTGTGCAGAAGAATTCGATCGATATCAGTGAGTTGT
TGGAAGCGATTGATGATGACCCTGAAATCGATACAGGTGAAATGGTAGCC
ATCAAAACCGCCAAAAACATACCCACCCGCCACCCGCCTGAAGTTCTCAC
AACACGGAAAGTAACCGAGCAAGTCCAGTCCACACTTTCATTCCTATCAA
GCTCTTTAGAATATCCCTTGGAGTATTTAGTGGATTCGGCCAGACCTGAT
TATTGGGTTCCAGATTCCAAGATTTTGAATTGCCACTCATGCGAAATGGA
ATTCTCAAAAAAAGATTCTAAGCATCATTGTCGCAAGTGTGGAAAGGGCT
TTTGTGATCCATGCTCAAAGTCTAGAGTGCCGGTACCGAGTCGTGGTTGG
GATTATCCAGTTCGTGTTTGTAACGGATGTTCGTTGAAGAAAGGTCCTTT
GTAAATGGCACAGGTTTCCTGTTCAAATGGTTTTTCTTCAACAGAGGAAA
CTTCCAAGATGGCTGCCGACCAAGCCTTGCTAAAAAACTCAAATGCTAAT
ATCTTTGGAGATATTGAATCCATGAGATGTGAAAAAtgcaaaagcaaaaa
gaaaaaggtgACCGTTGTCTGTATTGACTGTGGAGAACTTGCTTTATGCA
ATGATTGTAACCGCAAAGTACATGAAAATAATAAAGTTCAACATCAGCTG
CATGAATTGAGACCAAAAACACAGACTCTAGCCAAAGAAAAGCAAATTAA
TGGAACATTGAATGGATCAATTAATGGAACAATTCATCACAAGAAGAACA
ATAGTATTGCAAAGCTTGACATAGTGCACAATGACAAACCAAAAAGTTTA
TTATTGATTGACAGTACAGAAAGATTGCAGGTAACAAAAGAGGGTGATTT
CAAGCATTTACTTGGTTGTGATGATGATCCTCGAGTGAAAGTTGTTTCAA
TCTTTGGAAACACAGGAGATGGAAAATCACATACTCTGAATCATACATTT
TTTGACGGCGCTGAAGTATTTGATACATCACCATCCCAAAAATCATGTAC
CGTTGGTGTATGGGTTTCCTACTGCCCGAACCAGAAAGCCATCATCGTGG
ATACAGAAGGTCTGCTTGGtgtttcagaaaatgcaaataagAGGATGAGA
TTGTTGATGAAGATTCTTGCTGTCTCGGATGTTGTGATTTATCGTACAAG
AGCAGAACGCCTACATTCTGATATGTTTACTTTCTTGGGTGATGCTTCAG
AAGCCTACatcaaatatttcacaaaagaTCTTCAATCAGTTCAACAAAGA
GGCCATATGGAGAATGTTCCCTTGTGTAGCTTAGGTCCCTCTATTGTTAT
CTTTCAAGAGACACATTACACTACACCACTTGGTTTTGAAAATGATCCAT
CAGAACATGATAACAGTCCAGAAGAGATTTTGAGatccaattttttcaac
attggACGCAATCCAGCTGCATTTAGTTCCATCAATTATGTTGGTACAAG
AACGACTACCCAATCCACTGATTTCTCTATCCTCTTGAATGAAGTGAAGA
AAAACCTCAAGAACAAGACCGTTCGTTCTGCAAGACCTGTTTCTGTCATT
TTCAATGCTTTGATgTTTTTGAATGACAAATTCGGTGATGATATCAATGA
CATCCTACCAAACAGTTTCCCTGATGAATATTTTACATGTGTTTCAAAAT
GTTTATCATGCAGTGCTCGATGTGGAAAAAACATGAATCAtgagaaagaa
gagaaagaacatCGCTCAGAACAAAAGTGTACATATCAAGCACAATTTGA
CAACAAAGTATATACGTGCAAGGCATGCCATGAGAAAGGCGTTGAATCAC
TTGTGATACCCAAAACTGCTGAAACTCAAGATTCTCCCTTGGTTGGTCTT
GCAAAATATGCTTGGTCAGGATATGTTCTTGAATGTCCAAAATGTGGTGT
TATTTACCGAAGTCGACAATTTTGGTATGGCAATGGTGAAGTAGAGAATT
TTGTGCGCATTGAAATCAAACATGTCTGGCCAGGGACACGACTTCCAAAC
ACTAGTCAAAATTCAGCACGACGCATTTTGGATGGTATGATGAACTTGGC
AGATGCAATCACCAATGTTAGTGCAAAACCTACTAAAGCTGTCACCAGTT
GGGTTACTGATAAAGTTGCTCCAACCTACTGGACACCTAACTATCTCATT
ATTGACTGTGCAAAATGTGGCCATGATTTTGAAGAGACAGAGAAGAAACA
TCATTGTCGAGCCTGTGGTCGAGGTTATTGTGACTCGTGTACACAACATA
GGATTCCTGTACCGGACAGAGGCTGGGGAGACACGCCCGTTCGTGTTTGT
GATGATTGCTTCACTAAATCCGGACAAGTCGATCAATCGAGTGTGCAGAA
GAATTCGATCGATATCAGTGAGTTGTTGGAAGCGATTGATGATGACCCTG
AAATCGATACAGGTGAAATGGTAGCCATCAAAACCGCCAAAAACATACCC
ACCCGCCACCCGCCTGAAGTTCTCACAACACGGAAAGTAACCGAGCAAGT
CCAGTCCACACTTTCATTCCTATCAAGCTCTTTAGAATATCCCTTGGAGT
ATTTAGTGGATTCGGCCAGACCTGATTATTGGGTTCCAGATTCCAAGATT
TTGAATTGCCACTCATGCGAAATGGAATTCTCAAAAAAAGATTCTAAGCA
TCATTGTCGCAAGTGTGGAAAGGGCTTTTGTGATCCATGCTCAAAGTCTA
GAGTGCCGGTACCGAGTCGTGGTTGGGATTATCCAGTTCGTGTTTGTAAC
GGATGTTCGTTGAAGAAAGGTCCTTTGTAAATGGCACAGGTTTCCTGTTC
AAATGGTTTTTCTTCAACAGAGGAAACTTCCAAGATGGCTGCCGACCAAG
CCTTGCTAAAAAACTCAAATGCTAATATCTTTGGAGATATTGAATCCATG
AGATGTGAAAAAtgcaaaagcaaaaagaaaaaggtgACCGTTGTCTGTAT
TGACTGTGGAGAACTTGCTTTATGCAATGATTGTAACCGCAAAGTACATG
AAAATAATAAAGTTCAACATCAGCTGCATGAATTGAGACCAAAAACACAG
ACTCTAGCCAAAGAAAAGCAAATTAATGGAACATTGAATGGATCAATTAA
TGGAACAATTCATCACAAGAAGAACAATAGTATTGCAAAGCTTGACATAG
TGCACAATGACAAACCAAAAAGTTTATTATTGATTGACAGTACAGAAAGA
TTGCAGGTAACAAAAGAGGGTGATTTCAAGCATTTACTTGGTTGTGATGA
TGATCCTCGAGTGAAAGTTGTTTCAATCTTTGGAAACACAGGAGATGGAA
AATCACATACTCTGAATCATACATTTTTTGACGGCGCTGAAGTATTTGAT
ACATCACCATCCCAAAAATCATGTACCGTTGGTGTATGGGTTTCCTACTG
CCCGAACCAGAAAGCCATCATCGTGGATACAGAAGGTCTGCTTGGtgttt
cagaaaatgcaaataagAGGATGAGATTGTTGATGAAGATTCTTGCTGTC
TCGGATGTTGTGATTTATCGTACAAGAGCAGAACGCCTACATTCTGATAT
GTTTACTTTCTTGGGTGATGCTTCAGAAGCCTACatcaaatatttcacaa
aagaTCTTCAATCAGTTCAACAAAGAGGCCATATGGAGAATGTTCCCTTG
TGTAGCTTAGGTCCCTCTATTGTTATCTTTCAAGAGACACATTACACTAC
ACCACTTGGTTTTGAAAATGATCCATCAGAACATGATAACAGTCCAGAAG
AGATTTTGAGatccaattttttcaacattggACGCAATCCAGCTGCATTT
AGTTCCATCAATTATGTTGGTACAAGAACGACTACCCAATCCACTGATTT
CTCTATCCTCTTGAATGAAGTGAAGAAAAACCTCAAGAACAAGACCGTTC
GTTCTGCAAGACCTGTTTCTGTCATTTTCAATGCTTTGATgTTTTTGAAT
GACAAATTCGGTGATGATATCAATGACATCCTACCAAACAGTTTCCCTGA
TGAATATTTTACATGTGTTTCAAAATGTTTATCATGCAGTGCTCGATGTG
GAAAAAACATGAATCAtgagaaagaagagaaagaacatCGCTCAGAACAA
AAGTGTACATATCAAGCACAATTTGACAACAAAGTATATACGTGCAAGGC
ATGCCATGAGAAAGGCGTTGAATCACTTGTGATACCCAAAACTGCTGAAA
CTCAAGATTCTCCCTTGGTTGGTCTTGCAAAATATGCTTGGTCAGGATAT
GTTCTTGAATGTCCAAAATGTGGTGTTATTTACCGAAGTCGACAATTTTG
GTATGGCAATGGTGAAGTAGAGAATTTTGTGCGCATTGAAATCAAACATG
TCTGGCCAGGGACACGACTTCCAAACACTAGTCAAAATTCAGCACGACGC
ATTTTGGATGGTATGATGAACTTGGCAGATGCAATCACCAATGTTAGTGC
AAAACCTACTAAAGCTGTCACCAGTTGGGTTACTGATAAAGTTGCTCCAA
CCTACTGGACACCTAACTATCTCATTATTGACTGTGCAAAATGTGGCCAT
GATTTTGAAGAGACAGAGAAGAAACATCATTGTCGAGCCTGTGGTCGAGG
TTATTGTGACTCGTGTACACAACATAGGATTCCTGTACCGGACAGAGGCT
GGGGAGACACGCCCGTTCGTGTTTGTGATGATTGCTTCACTAAATCCGGA
CAAGTCGATCAATCGAGTGTGCAGAAGAATTCGATCGATATCAGTGAGTT
GTTGGAAGCGATTGATGATGACCCTGAAATCGATACAGGTGAAATGGTAG
CCATCAAAACCGCCAAAAACATACCCACCCGCCACCCGCCTGAAGTTCTC
ACAACACGGAAAGTAACCGAGCAAGTCCAGTCCACACTTTCATTCCTATC
AAGCTCTTTAGAATATCCCTTGGAGTATTTAGTGGATTCGGCCAGACCTG
ATTATTGGGTTCCAGATTCCAAGATTTTGAATTGCCACTCATGCGAAATG
GAATTCTCAAAAAAAGATTCTAAGCATCATTGTCGCAAGTGTGGAAAGGG
CTTTTGTGATCCATGCTCAAAGTCTAGAGTGCCGGTACCGAGTCGTGGTT
GGGATTATCCAGTTCGTGTTTGTAACGGATGTTCGTTGAAGAAAGGTCCT
TTGTAAATGGCACAGGTTTCCTGTTCAAATGGTTTTTCTTCAACAGAGGA
AACTTCCAAGATGGCTGCCGACCAAGCCTTGCTAAAAAACTCAAATGCTA
ATATCTTTGGAGATATTGAATCCATGAGATGTGAAAAAtgcaaaagcaaa
aagaaaaaggtgACCGTTGTCTGTATTGACTGTGGAGAACTTGCTTTATG
CAATGATTGTAACCGCAAAGTACATGAAAATAATAAAGTTCAACATCAGC
TGCATGAATTGAGACCAAAAACACAGACTCTAGCCAAAGAAAAGCAAATT
AATGGAACATTGAATGGATCAATTAATGGAACAATTCATCACAAGAAGAA
CAATAGTATTGCAAAGCTTGACATAGTGCACAATGACAAACCAAAAAGTT
TATTATTGATTGACAGTACAGAAAGATTGCAGGTAACAAAAGAGGGTGAT
TTCAAGCATTTACTTGGTTGTGATGATGATCCTCGAGTGAAAGTTGTTTC
AATCTTTGGAAACACAGGAGATGGAAAATCACATACTCTGAATCATACAT
TTTTTGACGGCGCTGAAGTATTTGATACATCACCATCCCAAAAATCATGT
ACCGTTGGTGTATGGGTTTCCTACTGCCCGAACCAGAAAGCCATCATCGT
GGATACAGAAGGTCTGCTTGGtgtttcagaaaatgcaaataagAGGATGA
GATTGTTGATGAAGATTCTTGCTGTCTCGGATGTTGTGATTTATCGTACA
AGAGCAGAACGCCTACATTCTGATATGTTTACTTTCTTGGGTGATGCTTC
AGAAGCCTACatcaaatatttcacaaaagaTCTTCAATCAGTTCAACAAA
GAGGCCATATGGAGAATGTTCCCTTGTGTAGCTTAGGTCCCTCTATTGTT
ATCTTTCAAGAGACACATTACACTACACCACTTGGTTTTGAAAATGATCC
ATCAGAACATGATAACAGTCCAGAAGAGATTTTGAGatccaattttttca
acattggACGCAATCCAGCTGCATTTAGTTCCATCAATTATGTTGGTACA
AGAACGACTACCCAATCCACTGATTTCTCTATCCTCTTGAATGAAGTGAA
GAAAAACCTCAAGAACAAGACCGTTCGTTCTGCAAGACCTGTTTCTGTCA
TTTTCAATGCTTTGATgTTTTTGAATGACAAATTCGGTGATGATATCAAT
GACATCCTACCAAACAGTTTCCCTGATGAATATTTTACATGTGTTTCAAA
ATGTTTATCATGCAGTGCTCGATGTGGAAAAAACATGAATCAtgagaaag
aagagaaagaacatCGCTCAGAACAAAAGTGTACATATCAAGCACAATTT
GACAACAAAGTATATACGTGCAAGGCATGCCATGAGAAAGGCGTTGAATC
ACTTGTGATACCCAAAACTGCTGAAACTCAAGATTCTCCCTTGGTTGGTC
TTGCAAAATATGCTTGGTCAGGATATGTTCTTGAATGTCCAAAATGTGGT
GTTATTTACCGAAGTCGACAATTTTGGTATGGCAATGGTGAAGTAGAGAA
TTTTGTGCGCATTGAAATCAAACATGTCTGGCCAGGGACACGACTTCCAA
ACACTAGTCAAAATTCAGCACGACGCATTTTGGATGGTATGATGAACTTG
GCAGATGCAATCACCAATGTTAGTGCAAAACCTACTAAAGCTGTCACCAG
TTGGGTTACTGATAAAGTTGCTCCAACCTACTGGACACCTAACTATCTCA
TTATTGACTGTGCAAAATGTGGCCATGATTTTGAAGAGACAGAGAAGAAA
CATCATTGTCGAGCCTGTGGTCGAGGTTATTGTGACTCGTGTACACAACA
TAGGATTCCTGTACCGGACAGAGGCTGGGGAGACACGCCCGTTCGTGTTT
GTGATGATTGCTTCACTAAATCCGGACAAGTCGATCAATCGAGTGTGCAG
AAGAATTCGATCGATATCAGTGAGTTGTTGGAAGCGATTGATGATGACCC
TGAAATCGATACAGGTGAAATGGTAGCCATCAAAACCGCCAAAAACATAC
CCACCCGCCACCCGCCTGAAGTTCTCACAACACGGAAAGTAACCGAGCAA
GTCCAGTCCACACTTTCATTCCTATCAAGCTCTTTAGAATATCCCTTGGA
GTATTTAGTGGATTCGGCCAGACCTGATTATTGGGTTCCAGATTCCAAGA
TTTTGAATTGCCACTCATGCGAAATGGAATTCTCAAAAAAAGATTCTAAG
CATCATTGTCGCAAGTGTGGAAAGGGCTTTTGTGATCCATGCTCAAAGTC
TAGAGTGCCGGTACCGAGTCGTGGTTGGGATTATCCAGTTCGTGTTTGTA
ACGGATGTTCGTTGAAGAAAGGTCCTTTGTAAATGGCACAGGTTTCCTGT
TCAAATGGTTTTTCTTCAACAGAGGAAACTTCCAAGATGGCTGCCGACCA
AGCCTTGCTAAAAAACTCAAATGCTAATATCTTTGGAGATATTGAATCCA
TGAGATGTGAAAAAtgcaaaagcaaaaagaaaaaggtgACCGTTGTCTGT
ATTGACTGTGGAGAACTTGCTTTATGCAATGATTGTAACCGCAAAGTACA
TGAAAATAATAAAGTTCAACATCAGCTGCATGAATTGAGACCAAAAACAC
AGACTCTAGCCAAAGAAAAGCAAATTAATGGAACATTGAATGGATCAATT
AATGGAACAATTCATCACAAGAAGAACAATAGTATTGCAAAGCTTGACAT
AGTGCACAATGACAAACCAAAAAGTTTATTATTGATTGACAGTACAGAAA
GATTGCAGGTAACAAAAGAGGGTGATTTCAAGCATTTACTTGGTTGTGAT
GATGATCCTCGAGTGAAAGTTGTTTCAATCTTTGGAAACACAGGAGATGG
AAAATCACATACTCTGAATCATACATTTTTTGACGGCGCTGAAGTATTTG
ATACATCACCATCCCAAAAATCATGTACCGTTGGTGTATGGGTTTCCTAC
TGCCCGAACCAGAAAGCCATCATCGTGGATACAGAAGGTCTGCTTGGtgt
ttcagaaaatgcaaataagAGGATGAGATTGTTGATGAAGATTCTTGCTG
TCTCGGATGTTGTGATTTATCGTACAAGAGCAGAACGCCTACATTCTGAT
ATGTTTACTTTCTTGGGTGATGCTTCAGAAGCCTACatcaaatatttcac
aaaagaTCTTCAATCAGTTCAACAAAGAGGCCATATGGAGAATGTTCCCT
TGTGTAGCTTAGGTCCCTCTATTGTTATCTTTCAAGAGACACATTACACT
ACACCACTTGGTTTTGAAAATGATCCATCAGAACATGATAACAGTCCAGA
AGAGATTTTGAGatccaattttttcaacattggACGCAATCCAGCTGCAT
TTAGTTCCATCAATTATGTTGGTACAAGAACGACTACCCAATCCACTGAT
TTCTCTATCCTCTTGAATGAAGTGAAGAAAAACCTCAAGAACAAGACCGT
TCGTTCTGCAAGACCTGTTTCTGTCATTTTCAATGCTTTGATgTTTTTGA
ATGACAAATTCGGTGATGATATCAATGACATCCTACCAAACAGTTTCCCT
GATGAATATTTTACATGTGTTTCAAAATGTTTATCATGCAGTGCTCGATG
TGGAAAAAACATGAATCAtgagaaagaagagaaagaacatCGCTCAGAAC
AAAAGTGTACATATCAAGCACAATTTGACAACAAAGTATATACGTGCAAG
GCATGCCATGAGAAAGGCGTTGAATCACTTGTGATACCCAAAACTGCTGA
AACTCAAGATTCTCCCTTGGTTGGTCTTGCAAAATATGCTTGGTCAGGAT
ATGTTCTTGAATGTCCAAAATGTGGTGTTATTTACCGAAGTCGACAATTT
TGGTATGGCAATGGTGAAGTAGAGAATTTTGTGCGCATTGAAATCAAACA
TGTCTGGCCAGGGACACGACTTCCAAACACTAGTCAAAATTCAGCACGAC
GCATTTTGGATGGTATGATGAACTTGGCAGATGCAATCACCAATGTTAGT
GCAAAACCTACTAAAGCTGTCACCAGTTGGGTTACTGATAAAGTTGCTCC
AACCTACTGGACACCTAACTATCTCATTATTGACTGTGCAAAATGTGGCC
ATGATTTTGAAGAGACAGAGAAGAAACATCATTGTCGAGCCTGTGGTCGA
GGTTATTGTGACTCGTGTACACAACATAGGATTCCTGTACCGGACAGAGG
CTGGGGAGACACGCCCGTTCGTGTTTGTGATGATTGCTTCACTAAATCCG
GACAAGTCGATCAATCGAGTGTGCAGAAGAATTCGATCGATATCAGTGAG
TTGTTGGAAGCGATTGATGATGACCCTGAAATCGATACAGGTGAAATGGT
AGCCATCAAAACCGCCAAAAACATACCCACCCGCCACCCGCCTGAAGTTC
TCACAACACGGAAAGTAACCGAGCAAGTCCAGTCCACACTTTCATTCCTA
TCAAGCTCTTTAGAATATCCCTTGGAGTATTTAGTGGATTCGGCCAGACC
TGATTATTGGGTTCCAGATTCCAAGATTTTGAATTGCCACTCATGCGAAA
TGGAATTCTCAAAAAAAGATTCTAAGCATCATTGTCGCAAGTGTGGAAAG
GGCTTTTGTGATCCATGCTCAAAGTCTAGAGTGCCGGTACCGAGTCGTGG
TTGGGATTATCCAGTTCGTGTTTGTAACGGATGTTCGTTGAAGAAAGGTC
CTTTGTAAATGGCACAGGTTTCCTGTTCAAATGGTTTTTCTTCAACAGAG
GAAACTTCCAAGATGGCTGCCGACCAAGCCTTGCTAAAAAACTCAAATGC
TAATATCTTTGGAGATATTGAATCCATGAGATGTGAAAAAtgcaaaagca
aaaagaaaaaggtgACCGTTGTCTGTATTGACTGTGGAGAACTTGCTTTA
TGCAATGATTGTAACCGCAAAGTACATGAAAATAATAAAGTTCAACATCA
GCTGCATGAATTGAGACCAAAAACACAGACTCTAGCCAAAGAAAAGCAAA
TTAATGGAACATTGAATGGATCAATTAATGGAACAATTCATCACAAGAAG
AACAATAGTATTGCAAAGCTTGACATAGTGCACAATGACAAACCAAAAAG
TTTATTATTGATTGACAGTACAGAAAGATTGCAGGTAACAAAAGAGGGTG
ATTTCAAGCATTTACTTGGTTGTGATGATGATCCTCGAGTGAAAGTTGTT
TCAATCTTTGGAAACACAGGAGATGGAAAATCACATACTCTGAATCATAC
ATTTTTTGACGGCGCTGAAGTATTTGATACATCACCATCCCAAAAATCAT
GTACCGTTGGTGTATGGGTTTCCTACTGCCCGAACCAGAAAGCCATCATC
GTGGATACAGAAGGTCTGCTTGGtgtttcagaaaatgcaaataagAGGAT
GAGATTGTTGATGAAGATTCTTGCTGTCTCGGATGTTGTGATTTATCGTA
CAAGAGCAGAACGCCTACATTCTGATATGTTTACTTTCTTGGGTGATGCT
TCAGAAGCCTACatcaaatatttcacaaaagaTCTTCAATCAGTTCAACA
AAGAGGCCATATGGAGAATGTTCCCTTGTGTAGCTTAGGTCCCTCTATTG
TTATCTTTCAAGAGACACATTACACTACACCACTTGGTTTTGAAAATGAT
CCATCAGAACATGATAACAGTCCAGAAGAGATTTTGAGatccaatttttt
caacattggACGCAATCCAGCTGCATTTAGTTCCATCAATTATGTTGGTA
CAAGAACGACTACCCAATCCACTGATTTCTCTATCCTCTTGAATGAAGTG
AAGAAAAACCTCAAGAACAAGACCGTTCGTTCTGCAAGACCTGTTTCTGT
CATTTTCAATGCTTTGATgTTTTTGAATGACAAATTCGGTGATGATATCA
ATGACATCCTACCAAACAGTTTCCCTGATGAATATTTTACATGTGTTTCA
AAATGTTTATCATGCAGTGCTCGATGTGGAAAAAACATGAATCAtgagaa
agaagagaaagaacatCGCTCAGAACAAAAGTGTACATATCAAGCACAAT
TTGACAACAAAGTATATACGTGCAAGGCATGCCATGAGAAAGGCGTTGAA
TCACTTGTGATACCCAAAACTGCTGAAACTCAAGATTCTCCCTTGGTTGG
TCTTGCAAAATATGCTTGGTCAGGATATGTTCTTGAATGTCCAAAATGTG
GTGTTATTTACCGAAGTCGACAATTTTGGTATGGCAATGGTGAAGTAGAG
AATTTTGTGCGCATTGAAATCAAACATGTCTGGCCAGGGACACGACTTCC
AAACACTAGTCAAAATTCAGCACGACGCATTTTGGATGGTATGATGAACT
TGGCAGATGCAATCACCAATGTTAGTGCAAAACCTACTAAAGCTGTCACC
AGTTGGGTTACTGATAAAGTTGCTCCAACCTACTGGACACCTAACTATCT
CATTATTGACTGTGCAAAATGTGGCCATGATTTTGAAGAGACAGAGAAGA
AACATCATTGTCGAGCCTGTGGTCGAGGTTATTGTGACTCGTGTACACAA
CATAGGATTCCTGTACCGGACAGAGGCTGGGGAGACACGCCCGTTCGTGT
TTGTGATGATTGCTTCACTAAATCCGGACAAGTCGATCAATCGAGTGTGC
AGAAGAATTCGATCGATATCAGTGAGTTGTTGGAAGCGATTGATGATGAC
CCTGAAATCGATACAGGTGAAATGGTAGCCATCAAAACCGCCAAAAACAT
ACCCACCCGCCACCCGCCTGAAGTTCTCACAACACGGAAAGTAACCGAGC
AAGTCCAGTCCACACTTTCATTCCTATCAAGCTCTTTAGAATATCCCTTG
GAGTATTTAGTGGATTCGGCCAGACCTGATTATTGGGTTCCAGATTCCAA
GATTTTGAATTGCCACTCATGCGAAATGGAATTCTCAAAAAAAGATTCTA
AGCATCATTGTCGCAAGTGTGGAAAGGGCTTTTGTGATCCATGCTCAAAG
TCTAGAGTGCCGGTACCGAGTCGTGGTTGGGATTATCCAGTTCGTGTTTG
TAACGGATGTTCGTTGAAGAAAGGTCCTTTGTAAATGGCACAGGTTTCCT
GTTCAAATGGTTTTTCTTCAACAGAGGAAACTTCCAAGATGGCTGCCGAC
CAAGCCTTGCTAAAAAACTCAAATGCTAATATCTTTGGAGATATTGAATC
CATGAGATGTGAAAAAtgcaaaagcaaaaagaaaaaggtgACCGTTGTCT
GTATTGACTGTGGAGAACTTGCTTTATGCAATGATTGTAACCGCAAAGTA
CATGAAAATAATAAAGTTCAACATCAGCTGCATGAATTGAGACCAAAAAC
ACAGACTCTAGCCAAAGAAAAGCAAATTAATGGAACATTGAATGGATCAA
TTAATGGAACAATTCATCACAAGAAGAACAATAGTATTGCAAAGCTTGAC
ATAGTGCACAATGACAAACCAAAAAGTTTATTATTGATTGACAGTACAGA
AAGATTGCAGGTAACAAAAGAGGGTGATTTCAAGCATTTACTTGGTTGTG
ATGATGATCCTCGAGTGAAAGTTGTTTCAATCTTTGGAAACACAGGAGAT
GGAAAATCACATACTCTGAATCATACATTTTTTGACGGCGCTGAAGTATT
TGATACATCACCATCCCAAAAATCATGTACCGTTGGTGTATGGGTTTCCT
ACTGCCCGAACCAGAAAGCCATCATCGTGGATACAGAAGGTCTGCTTGGt
gtttcagaaaatgcaaataagAGGATGAGATTGTTGATGAAGATTCTTGC
TGTCTCGGATGTTGTGATTTATCGTACAAGAGCAGAACGCCTACATTCTG
ATATGTTTACTTTCTTGGGTGATGCTTCAGAAGCCTACatcaaatatttc
acaaaagaTCTTCAATCAGTTCAACAAAGAGGCCATATGGAGAATGTTCC
CTTGTGTAGCTTAGGTCCCTCTATTGTTATCTTTCAAGAGACACATTACA
CTACACCACTTGGTTTTGAAAATGATCCATCAGAACATGATAACAGTCCA
GAAGAGATTTTGAGatccaattttttcaacattggACGCAATCCAGCTGC
ATTTAGTTCCATCAATTATGTTGGTACAAGAACGACTACCCAATCCACTG
ATTTCTCTATCCTCTTGAATGAAGTGAAGAAAAACCTCAAGAACAAGACC
GTTCGTTCTGCAAGACCTGTTTCTGTCATTTTCAATGCTTTGATgTTTTT
GAATGACAAATTCGGTGATGATATCAATGACATCCTACCAAACAGTTTCC
CTGATGAATATTTTACATGTGTTTCAAAATGTTTATCATGCAGTGCTCGA
TGTGGAAAAAACATGAATCAtgagaaagaagagaaagaacatCGCTCAGA
ACAAAAGTGTACATATCAAGCACAATTTGACAACAAAGTATATACGTGCA
AGGCATGCCATGAGAAAGGCGTTGAATCACTTGTGATACCCAAAACTGCT
GAAACTCAAGATTCTCCCTTGGTTGGTCTTGCAAAATATGCTTGGTCAGG
ATATGTTCTTGAATGTCCAAAATGTGGTGTTATTTACCGAAGTCGACAAT
TTTGGTATGGCAATGGTGAAGTAGAGAATTTTGTGCGCATTGAAATCAAA
CATGTCTGGCCAGGGACACGACTTCCAAACACTAGTCAAAATTCAGCACG
ACGCATTTTGGATGGTATGATGAACTTGGCAGATGCAATCACCAATGTTA
GTGCAAAACCTACTAAAGCTGTCACCAGTTGGGTTACTGATAAAGTTGCT
CCAACCTACTGGACACCTAACTATCTCATTATTGACTGTGCAAAATGTGG
CCATGATTTTGAAGAGACAGAGAAGAAACATCATTGTCGAGCCTGTGGTC
GAGGTTATTGTGACTCGTGTACACAACATAGGATTCCTGTACCGGACAGA
GGCTGGGGAGACACGCCCGTTCGTGTTTGTGATGATTGCTTCACTAAATC
CGGACAAGTCGATCAATCGAGTGTGCAGAAGAATTCGATCGATATCAGTG
AGTTGTTGGAAGCGATTGATGATGACCCTGAAATCGATACAGGTGAAATG
GTAGCCATCAAAACCGCCAAAAACATACCCACCCGCCACCCGCCTGAAGT
TCTCACAACACGGAAAGTAACCGAGCAAGTCCAGTCCACACTTTCATTCC
TATCAAGCTCTTTAGAATATCCCTTGGAGTATTTAGTGGATTCGGCCAGA
CCTGATTATTGGGTTCCAGATTCCAAGATTTTGAATTGCCACTCATGCGA
AATGGAATTCTCAAAAAAAGATTCTAAGCATCATTGTCGCAAGTGTGGAA
AGGGCTTTTGTGATCCATGCTCAAAGTCTAGAGTGCCGGTACCGAGTCGT
GGTTGGGATTATCCAGTTCGTGTTTGTAACGGATGTTCGTTGAAGAAAGG
TCCTTTGTAAATGGCACAGGTTTCCTGTTCAAATGGTTTTTCTTCAACAG
AGGAAACTTCCAAGATGGCTGCCGACCAAGCCTTGCTAAAAAACTCAAAT
GCTAATATCTTTGGAGATATTGAATCCATGAGATGTGAAAAAtgcaaaag
caaaaagaaaaaggtgACCGTTGTCTGTATTGACTGTGGAGAACTTGCTT
TATGCAATGATTGTAACCGCAAAGTACATGAAAATAATAAAGTTCAACAT
CAGCTGCATGAATTGAGACCAAAAACACAGACTCTAGCCAAAGAAAAGCA
AATTAATGGAACATTGAATGGATCAATTAATGGAACAATTCATCACAAGA
AGAACAATAGTATTGCAAAGCTTGACATAGTGCACAATGACAAACCAAAA
AGTTTATTATTGATTGACAGTACAGAAAGATTGCAGGTAACAAAAGAGGG
TGATTTCAAGCATTTACTTGGTTGTGATGATGATCCTCGAGTGAAAGTTG
TTTCAATCTTTGGAAACACAGGAGATGGAAAATCACATACTCTGAATCAT
ACATTTTTTGACGGCGCTGAAGTATTTGATACATCACCATCCCAAAAATC
ATGTACCGTTGGTGTATGGGTTTCCTACTGCCCGAACCAGAAAGCCATCA
TCGTGGATACAGAAGGTCTGCTTGGtgtttcagaaaatgcaaataagAGG
ATGAGATTGTTGATGAAGATTCTTGCTGTCTCGGATGTTGTGATTTATCG
TACAAGAGCAGAACGCCTACATTCTGATATGTTTACTTTCTTGGGTGATG
CTTCAGAAGCCTACatcaaatatttcacaaaagaTCTTCAATCAGTTCAA
CAAAGAGGCCATATGGAGAATGTTCCCTTGTGTAGCTTAGGTCCCTCTAT
TGTTATCTTTCAAGAGACACATTACACTACACCACTTGGTTTTGAAAATG
ATCCATCAGAACATGATAACAGTCCAGAAGAGATTTTGAGatccaatttt
ttcaacattggACGCAATCCAGCTGCATTTAGTTCCATCAATTATGTTGG
TACAAGAACGACTACCCAATCCACTGATTTCTCTATCCTCTTGAATGAAG
TGAAGAAAAACCTCAAGAACAAGACCGTTCGTTCTGCAAGACCTGTTTCT
GTCATTTTCAATGCTTTGATgTTTTTGAATGACAAATTCGGTGATGATAT
CAATGACATCCTACCAAACAGTTTCCCTGATGAATATTTTACATGTGTTT
CAAAATGTTTATCATGCAGTGCTCGATGTGGAAAAAACATGAATCAtgag
aaagaagagaaagaacatCGCTCAGAACAAAAGTGTACATATCAAGCACA
ATTTGACAACAAAGTATATACGTGCAAGGCATGCCATGAGAAAGGCGTTG
AATCACTTGTGATACCCAAAACTGCTGAAACTCAAGATTCTCCCTTGGTT
GGTCTTGCAAAATATGCTTGGTCAGGATATGTTCTTGAATGTCCAAAATG
TGGTGTTATTTACCGAAGTCGACAATTTTGGTATGGCAATGGTGAAGTAG
AGAATTTTGTGCGCATTGAAATCAAACATGTCTGGCCAGGGACACGACTT
CCAAACACTAGTCAAAATTCAGCACGACGCATTTTGGATGGTATGATGAA
CTTGGCAGATGCAATCACCAATGTTAGTGCAAAACCTACTAAAGCTGTCA
CCAGTTGGGTTACTGATAAAGTTGCTCCAACCTACTGGACACCTAACTAT
CTCATTATTGACTGTGCAAAATGTGGCCATGATTTTGAAGAGACAGAGAA
GAAACATCATTGTCGAGCCTGTGGTCGAGGTTATTGTGACTCGTGTACAC
AACATAGGATTCCTGTACCGGACAGAGGCTGGGGAGACACGCCCGTTCGT
GTTTGTGATGATTGCTTCACTAAATCCGGACAAGTCGATCAATCGAGTGT
GCAGAAGAATTCGATCGATATCAGTGAGTTGTTGGAAGCGATTGATGATG
ACCCTGAAATCGATACAGGTGAAATGGTAGCCATCAAAACCGCCAAAAAC
ATACCCACCCGCCACCCGCCTGAAGTTCTCACAACACGGAAAGTAACCGA
GCAAGTCCAGTCCACACTTTCATTCCTATCAAGCTCTTTAGAATATCCCT
TGGAGTATTTAGTGGATTCGGCCAGACCTGATTATTGGGTTCCAGATTCC
AAGATTTTGAATTGCCACTCATGCGAAATGGAATTCTCAAAAAAAGATTC
TAAGCATCATTGTCGCAAGTGTGGAAAGGGCTTTTGTGATCCATGCTCAA
AGTCTAGAGTGCCGGTACCGAGTCGTGGTTGGGATTATCCAGTTCGTGTT
TGTAACGGATGTTCGTTGAAGAAAGGTCCTTTGTAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000820XLOC_000820Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001570-proteinTCONS_00001570-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001570-exon-sc0000011-1491911889:141382..142053TCONS_00001570-exon-sc0000011-1491911889:141382..142053Clytia hemisphaericaexon
TCONS_00001570-exon-sc0000011-1510915933:141382..142053TCONS_00001570-exon-sc0000011-1510915933:141382..142053Clytia hemisphaericaexon
TCONS_00001570-exon-sc0000011-1575043694:141382..142053TCONS_00001570-exon-sc0000011-1575043694:141382..142053Clytia hemisphaericaexon
TCONS_00001570-exon-sc0000011-1491911889:145780..146306TCONS_00001570-exon-sc0000011-1491911889:145780..146306Clytia hemisphaericaexon
TCONS_00001570-exon-sc0000011-1510915933:145780..146306TCONS_00001570-exon-sc0000011-1510915933:145780..146306Clytia hemisphaericaexon
TCONS_00001570-exon-sc0000011-1575043694:145780..146306TCONS_00001570-exon-sc0000011-1575043694:145780..146306Clytia hemisphaericaexon
TCONS_00001570-exon-sc0000011-1491911889:146599..146641TCONS_00001570-exon-sc0000011-1491911889:146599..146641Clytia hemisphaericaexon
TCONS_00001570-exon-sc0000011-1510915933:146599..146641TCONS_00001570-exon-sc0000011-1510915933:146599..146641Clytia hemisphaericaexon
TCONS_00001570-exon-sc0000011-1575043694:146599..146641TCONS_00001570-exon-sc0000011-1575043694:146599..146641Clytia hemisphaericaexon
TCONS_00001570-exon-sc0000011-1491911889:148367..148531TCONS_00001570-exon-sc0000011-1491911889:148367..148531Clytia hemisphaericaexon
TCONS_00001570-exon-sc0000011-1510915933:148367..148531TCONS_00001570-exon-sc0000011-1510915933:148367..148531Clytia hemisphaericaexon
TCONS_00001570-exon-sc0000011-1575043694:148367..148531TCONS_00001570-exon-sc0000011-1575043694:148367..148531Clytia hemisphaericaexon
TCONS_00001570-exon-sc0000011-1491911889:148839..148936TCONS_00001570-exon-sc0000011-1491911889:148839..148936Clytia hemisphaericaexon
TCONS_00001570-exon-sc0000011-1510915933:148839..148936TCONS_00001570-exon-sc0000011-1510915933:148839..148936Clytia hemisphaericaexon
TCONS_00001570-exon-sc0000011-1575043694:148839..148936TCONS_00001570-exon-sc0000011-1575043694:148839..148936Clytia hemisphaericaexon
TCONS_00001570-exon-sc0000011-1491911889:149241..149349TCONS_00001570-exon-sc0000011-1491911889:149241..149349Clytia hemisphaericaexon
TCONS_00001570-exon-sc0000011-1510915933:149241..149349TCONS_00001570-exon-sc0000011-1510915933:149241..149349Clytia hemisphaericaexon
TCONS_00001570-exon-sc0000011-1575043694:149241..149349TCONS_00001570-exon-sc0000011-1575043694:149241..149349Clytia hemisphaericaexon
TCONS_00001570-exon-sc0000011-1491911889:149617..149714TCONS_00001570-exon-sc0000011-1491911889:149617..149714Clytia hemisphaericaexon
TCONS_00001570-exon-sc0000011-1510915933:149617..149714TCONS_00001570-exon-sc0000011-1510915933:149617..149714Clytia hemisphaericaexon
TCONS_00001570-exon-sc0000011-1575043694:149617..149714TCONS_00001570-exon-sc0000011-1575043694:149617..149714Clytia hemisphaericaexon
TCONS_00001570-exon-sc0000011-1491911889:150378..150492TCONS_00001570-exon-sc0000011-1491911889:150378..150492Clytia hemisphaericaexon
TCONS_00001570-exon-sc0000011-1510915933:150378..150492TCONS_00001570-exon-sc0000011-1510915933:150378..150492Clytia hemisphaericaexon
TCONS_00001570-exon-sc0000011-1575043694:150378..150492TCONS_00001570-exon-sc0000011-1575043694:150378..150492Clytia hemisphaericaexon
TCONS_00001570-exon-sc0000011-1491911889:150823..150990TCONS_00001570-exon-sc0000011-1491911889:150823..150990Clytia hemisphaericaexon
TCONS_00001570-exon-sc0000011-1510915933:150823..150990TCONS_00001570-exon-sc0000011-1510915933:150823..150990Clytia hemisphaericaexon
TCONS_00001570-exon-sc0000011-1575043694:150823..150990TCONS_00001570-exon-sc0000011-1575043694:150823..150990Clytia hemisphaericaexon
TCONS_00001570-exon-sc0000011-1491911889:151678..151892TCONS_00001570-exon-sc0000011-1491911889:151678..151892Clytia hemisphaericaexon
TCONS_00001570-exon-sc0000011-1510915933:151678..151892TCONS_00001570-exon-sc0000011-1510915933:151678..151892Clytia hemisphaericaexon
TCONS_00001570-exon-sc0000011-1575043694:151678..151892TCONS_00001570-exon-sc0000011-1575043694:151678..151892Clytia hemisphaericaexon
TCONS_00001570-exon-sc0000011-1491911889:152660..153715TCONS_00001570-exon-sc0000011-1491911889:152660..153715Clytia hemisphaericaexon
TCONS_00001570-exon-sc0000011-1510915933:152660..153715TCONS_00001570-exon-sc0000011-1510915933:152660..153715Clytia hemisphaericaexon
TCONS_00001570-exon-sc0000011-1575043694:152660..153715TCONS_00001570-exon-sc0000011-1575043694:152660..153715Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000011supercontigsc0000011:141382..153715 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
3.81688 4.15168 2.84309 2.98962 30.369 23.0127 28.039 33.9263 26.9006 24.5154 34.3303 23.116 33.4845 28.317 14.7711 21.2388 33.6607 46.2178 23.25 29.9538 43.0652 44.2718 13.5276 20.3548 77.6742 64.6986 35.5238 25.4793 18.6686 21.4238
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000306Znf_FYVE
IPR013083Znf_RING/FYVE/PHD
IPR017455Znf_FYVE-rel
IPR011011Znf_FYVE_PHD
IPR027417P-loop_NTPase
Vocabulary: Molecular Function
TermDefinition
GO:0046872metal ion binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0046872 metal ion binding
Blast
BLAST of TCONS_00001570 vs. Swiss-Prot (Human)
Match: ZFYV1 (Zinc finger FYVE domain-containing protein 1 OS=Homo sapiens GN=ZFYVE1 PE=1 SV=1)

HSP 1 Score: 675.626 bits (1742), Expect = 0.000e+0
Identity = 351/670 (52.39%), Postives = 461/670 (68.81%), Query Frame = 1
Query:  625 DKPKSLLLIDSTERLQVTKEGDFKHLLGCDDDPRVKVVSIFGNTGDGKSHTLNHTFFDGAEVFDTSPSQKSCTVGVWVSYCPNQKAIIVDTEGLLGVSENANKRMRLLMKILAVSDVVIYRTRAERLHSDMFTFLGDASEAYIKYFTKDLQSVQQRGHMENVPLCSLGPSIVIFQETHYTTPLGFENDPSEHDNSPEEILRSNFFNIGRNPAAFSSINYVGTRTTTQSTDFSIXXXXXXXXXXXXTVRSARPVSVIFNALMFLNDKFGDDI-NDILPNS--FPDEYFTCVSKCLSCSARCGKNMNXXXXXXXXRSEQKCTYQAQFDNKVYTCKACHEKGVESLVIPKTAETQDSPLVGLAKYAWSGYVLECPKCGVIYRSRQFWYGNGE-VENFVRIEIKHVWPGTR-LPNTSQNSARRILDGMMNLADAITNVSAKPTKAVTSWVTDKVAPTYWTPNYLIIDCAKCGHDFEETEKKHHCRACGRGYCDSCTQHRIPVPDRGWGDTPVRVCDDCFTKSGQVDQSSVQKNSIDISELLEAIDDDPEIDTGEMVAIKTAKNIPTRHPPEVLTTRKVTEQVQSTXXXXXXXXXXXXXXXVDSARPDYWVPDSKILNCHSCEMEFSKKDSKHHCRKCGKGFCDPCSKSRVPVPSRGWDYPVRVCNGCSLKKGPL 2619
            +K  S LL+D  E +QVT E DF   L C  D  +KVVSIFGNTGDGKSHTLNHTFF G EVF TSP+Q+SCTVGVW +Y P  K  ++DTEGLLG + N ++R RLL+K+LA+SD+VIYRT A+RLH+D+F FLGDASEAY+K+FTK+L++   R  + +VPL +LGP+++IF ET +T  LG  + PSE    PE++++  F  +GR P AFSSI+Y GTRT    TDFS L   +++ L+N T RS R   VIF AL  L+D+F  +I +D + +S  FPDEYFTC S CLSC   C K+MNH KE   H ++ +C Y  Q+DN+VYTCKAC+E+G E  V+PKT+ + DSP +GLAKYAWSGYV+ECP CGV+YRSRQ+W+GN + V+  VR EI HVWPGT      + N+A+R+LDGM  +A +++ +S  PTKAVTSW+TD++AP YW PN  I+ C KC   F++ + KHHCRACG G+CDSC+    PVP+RGWG  PVRVCD+C+           +  ++ ++     +DD    + G ++A                  RKV E VQ+TL  + ++++ PL  + D+ARP YWVPD +IL+CH+C  EFS K SKHHCR CG+GFCD CS  R  VPSRGWD+PVRVC  C+ K G L
Sbjct:  146 EKVVSFLLVDENEEIQVTNEEDFIRKLDCKPDQHLKVVSIFGNTGDGKSHTLNHTFFYGREVFKTSPTQESCTVGVWAAYDPVHKVAVIDTEGLLGATVNLSQRTRLLLKVLAISDLVIYRTHADRLHNDLFKFLGDASEAYLKHFTKELKATTARCGL-DVPLSTLGPAVIIFHETVHTQLLG-SDHPSE---VPEKLIQDRFRKLGRFPEAFSSIHYKGTRTYNPPTDFSGLRRALEQLLENNTTRSPRHPGVIFKALKALSDRFSGEIPDDQMAHSSFFPDEYFTCSSLCLSCGVGCKKSMNHGKEGVPHEAKSRCRYSHQYDNRVYTCKACYERGEEVSVVPKTSASTDSPWMGLAKYAWSGYVIECPNCGVVYRSRQYWFGNQDPVDTVVRTEIVHVWPGTDGFLKDNNNAAQRLLDGMNFMAQSVSELSLGPTKAVTSWLTDQIAPAYWRPNSQILSCNKCATSFKDNDTKHHCRACGEGFCDSCSSKTRPVPERGWGPAPVRVCDNCY-----------EARNVQLAVTEAQVDD----EGGTLIA------------------RKVGEAVQNTLGAVVTAIDIPLGLVKDAARPAYWVPDHEILHCHNCRKEFSIKLSKHHCRACGQGFCDECSHDRRAVPSRGWDHPVRVCFNCNKKPGDL 777          
The following BLAST results are available for this feature:
BLAST of TCONS_00001570 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
ZFYV10.000e+052.39Zinc finger FYVE domain-containing protein 1 OS=Ho... [more]
back to top