Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001557 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001557
Unique NameTCONS_00001557
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1957

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001557 ID=TCONS_00001557|Name=TCONS_00001557|organism=Clytia hemisphaerica|type=transcript|length=1957bp
CCGACTCAAACCACCGCCCGTTCACTGAGCGAAGGAATACATTTTTTGGT
ATTGTGGATGCAGTGCCCAAGAATTTCAGTAAACTAAATAATAAAATGCA
GACCATCAAATGCGTGGTCGTTGGTGATGGTGCCGTAGGAAAAACCTGTT
TACTGATTTCTTATACAACAAATAAATTCCCCAGTGAATATGTACCGACA
GTATTTGACAACTATGCTGTAACGGTCATGATAGGAGGAGAACCATATAC
GTTAGGTCTCTTCGATACAGCTGGTCAAGAAGATTACGATCGTCTCAGGC
CGTTATCATACCCACAAACAGATGTTTTCTTAGTCTGCTTCTCTGTTGTC
GCCCCTGCATCATTCGAAAACGTAAAAGAAAAGtgGGTTCCAGAAATTAC
ACATCATTGTCCTAAAACACCATTTTTACTAGTCGGTACACAAGTCGATT
TACGAGATGATGCCGCCATCGTTGAAAAACTCGCCAAAACGAAACAAAAG
CCAATCTCTTTCGAACAAGGAGAAAAATTAGCACGAGAATTGAAAGCAGT
AAAATATGTCGAATGCTCCGCTTTAACGCAAAAAGGATTAAAGAACGTTT
TTGACGAAGCCATTTTGGCTGCATTGGAGCCCCCAGAGcaaccaaagaaa
aagaaatgtgtTTTACTCTAACTttggttaaaaaattaattttttgttga
aacGACCTTAATATAAAAATTCCACTCGCTTCCGTCGATCAATAATGCAC
ACTGCGCTTATCGATAGAGAGAATCTGCCAGTGGAATGAATTGTACAGCT
TTGCTTATATGCCAAGAGAGGTGAATTCATCATAACATAAAAGTGTGGAA
TACCTTTCAAAGGTTTTGCGAGGGAAACTGTTCATTGTATCGTTAAAAAC
CAACATCAAAATAAACCTCTATTTtatagtttaaaaaaaagtttagaaac
ataaAATTAAATGAATTAAAATATTGTTACCCAGGTTTTTTCTATAAATT
AAGGGCTGGGTTTATGTACTATATCTGGATATGCAACTTTTTTTGTATGT
ATTCTTATGTACCTCTTTCGAAAAAATAGTAATTTTTAAGACTTCTCATA
ATGAATGCCCTGATTGAGCTCAAttcaacttttaatttttttgtttattt
attgtgCTGATTTTTTTCCTTCGTTGCTTTTCAGGGGATATTCATTTTTG
TTTCAATCACTCAAAcgattttttaaatatggcCAAAGTCTTCAGTTTTT
ATTCTTTGCTCAATCAGGGTGTACACCGAGAAACTATGTCACATTTTTTA
TAGTTGATTTCTCATGAATGAATTATGGGACCAACCCCCTtctatatttt
gttttaaaagaaaactaaaTTGGCCACACGATTTGTACTTATCTATCTGA
TTTTATACTTGTGAAAATATCAACTGTCTAGAACTTTAAACACATCTTGC
TCAGATTTGTTCTTCTTTTAAGAAATATCAGGGCAGAGTTCCAAATTATA
TACTTGTCAACTTATCAAAACTATTCAAATCGTTTATCTTGTATAATGTT
CGTCAGCAAATAGATTGTTAGTTTTGACTCTTTTTGACTATTTTGATTTT
GTAGGATTATAAACTATATTTTTTTCGTCCCCTATGTGTTgtctgtattt
ttgaaaaacaatgttCAATATacagacaatttaaaaaatttgcctGTAAT
TTACTTCAATACTTCATGTCCTCCTTTATCTCCATCCCCTTCTTGTCCGA
AGGAACTTTACAATTCTTAATAACCGAGTTCCAAAAGCGAAGTGGAtcat
gtggtgtgtttggggcattaaggctcttacgaacCTGTCTCCATAGCGGC
TTttttattagagggatttttagagtgtctcttattttgctagcaacttg
cgaattgaggtggagtctagatcgcttcgcaacccttatacaatacggct
agtagTG
Run BLAST on NCBI

protein sequence of TCONS_00001557-protein

>TCONS_00001557-protein ID=TCONS_00001557-protein|Name=TCONS_00001557-protein|organism=Clytia hemisphaerica|type=polypeptide|length=222bp
DSNHRPFTERRNTFFGIVDAVPKNFSKLNNKMQTIKCVVVGDGAVGKTCL
LISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRP
LSYPQTDVFLVCFSVVAPASFENVKEKWVPEITHHCPKTPFLLVGTQVDL
RDDAAIVEKLAKTKQKPISFEQGEKLARELKAVKYVECSALTQKGLKNVF
DEAILAALEPPEQPKKKKCVLL
Run BLAST on NCBI

transcript from alignment at sc0000011:4393..18431+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001557 ID=TCONS_00001557|Name=TCONS_00001557|organism=Clytia hemisphaerica|type=transcript|length=14039bp|location=Sequence derived from alignment at sc0000011:4393..18431+ (Clytia hemisphaerica)
CCGACTCAAACCACCGCCCGTTCACTGAGCGAAGGAATACATTTTTTGGT ATTGTGGATGCAGTGCCCAAGGTAGTTTCTTATTGTGTGATAGATTATAC AATAGTGTGCTTCATATCTGTAAGAGAGACTTTATTTGTTTTCAGTTTGA CAGTAAAGATGGTTCTTCTTGTTACACAAATTACTCAGAGTGATTTTAAT AGTCTTGACAAACAGAGAATAATTTTCAAGTTTGTCAAGTTCCTTATTGA TCTATTTGGTATATAATCTAACCACCTTCGACTTCGCAGGTACTAGAGTC AAGGCTATGAATCAGGATTCTCAATTTATCATTTGATAGGTCCATTTTAG GGTTTGTTTCGGTTTGTGACCATCAGacaacgaccctgcctatgccccgg acagtccggggcaaatgtctggggtctgaaaaaaataactttttccccgg acctacgtccggggctccNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNCCCGGACGTATATCGCCGAGCACACTTTAAA CCCCCGGACATTTTATCCAGGTCTAAAACTCACCCCCTCACGCCCAAATT CCGAgattatgtatgtgtgtttttaggaccctgtcgacgcaccggactgt ccggtgtaccgtagagtcgtttaatctcgacatacgtcttgcaatctcga catagctgtaggctggtcttcgaaataaaaaatcaaacataaacNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNCAAATTACTCAGAGTGATTTTAAT AGTCTTGACAAACAGAGAATAATTTTCAAGTTTGTCAAGTTCCTTATTGA TCTATTTGGTATATAATTACAGGATAACTCACAATTTTGGAAGAATAGGA GCTCtatcagtatagacttaaactcgtatatcacAAGATTACGGTAGGGC GGTCGGAAGTCGCGTATTTTCCCGTGTGACAAAAGACGACGCGGAAACAA AAGaaggataaaaataaaattcagagTTAAATATCTAAATGATAAACATG GTTTCATCCATGATTTCAGTCCCCCCTTAAAACAGAAATTTACCCCTTAT CCATTTTCCCCCCCTTATCTTCCAAAATTTATTAAAGCTGCCCCTTAAAA GGTACTCCCCCCTTAATTTTCACTCCAATATTTTAATGTCCCCCCTTAAA TTTTAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNttattagtttttttaaaaaagtttgttatcatacta aaaaaaacagattacataaaagaataaaaaagaagtCATTTGTCATCTAA TTTAAAAAACACTCAAATTGCAAACCGTGTGAAGTAGACAAGACGAACAA GACAAACTAGAGTAGCAAtgcaaaaaacaacaatttttcatcttttttac cAACAGCAAACATAACTTGTAAACCTTGATAAGAATCTTATGAGCAGCTA AAAAAgtttattagattttgcaatttttctacaccatatttgtaaatatt tctCCATAACATAAATCTGACAAANNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNcaaaggtttgtttttaaagagatcattttttca atttcaggaaacattcgatttttagaaaacattcgattttagaaaacatt cgattttagaaaacatttgattttagaaaacattcgattttacaAGATAT TCGATTAgattttagaaacatttgaatttgaaaaaaaatccaattttaat GCATTTGGCTGAAATACAGATTCTTGAGAAAAGAATTGAGTCTGAAATAA GAACAGGAAATTCTTCTCAACTGTCAAAAATTACTCCCCCCTCAGATAat atttatttgtttctttgGTGCCCTTAAGCCCTAGCCCCCCCTtacttcag attttccaaaaatttgaccccttaaagcttttttcaaaaatttaagtccc cccttattttaagggggggcTGGCTGAAACCATGATAAAGAAAGATATCT GCATGATTTTTTGttccaaaatgaaaagaatttatTCACCTTTACAGTGC AAAAAACCAGTCTTTAACGTTCTTCCTTCATTTGTACTGTAATCTTCGAT TTTCAGAGCTTGGGTTGCCCTATTTGTTGTGAACAAGATTACGGCACCGC AAATTTGGAAAAACCATGGATACTTTTGTTAAGATCACGAAGGAGCAGAT CGGTCCCGTAACAAATGGTTTTTTGTGTTTGAAAGATGGTAGATCAAGCT TTCTTTTGAAACCGTTCGTTNTTTTTGTGTTTGAAAGATGGTAGATTAAG CTTTCTTTTGAAACCGTTCGTTCTGTAGGGTCGTGCATTGTCTTCAAGCA AATGTAAATCAAAGaattaaatccaaaattttttgaagaatctGTCAAAT TTTTATGTTGCGAAAGGTAACAGCAAAGAGCTTAGACCTTCCTCTTTCAT GCTGTGCAATTATCTTTTGTGTATCTATATCTGCTCCATTGTAAGGGAAG TTTCTCTCGCCCCAAACTTCCTGCgcagatttttttgtaaaacactttcg atttcagtgcCGTGGACATGTTACAAGATGGTAGGaggtttttgtatttt ttgaacaggaatcttaaaaaaaatggaacttcaaaatggaatatctgaAA AACTACTAAAGGTTGAAAGataagtgacccctcattttttttctgaggat aagggcttttcattaaacttggtttgacattatgaaaatgattttgaaat ttcgactgacCCCCCTaattacgggatttcgagtacgggccaattttact tttgttttgagtggtttcatcaggccatttttcatgcccttttattgccg gttatcggacgctgcccctcttgaaattactaaaatattggtaaaaacag ccttttttgtggaaaaacactgaaaaaagtgccctttttgaccaccaacg gacgctgccttgcctttctaaaataggGCCTGTTcaatcattttcgattt caagcaaacatcttagcaacggggtgctcgcccatagttacaggggtttg tgcaaaaaactaaaaataaaaaattttccaaatcccttatttcgattaat gcaatgaaaaatgaaacttttctatgtttcacttttttgcacctaatctt caaaatgaaaatatttaagatttaagttcttcttttattcaatgattttt tacggcactttgttgacaatctaactctcccatcaaattcccgctttctt aaccttttccggacgcacgggccactgggtggcccattaatcgtgttcct atatgacgcacgggccatcgggtggcccatagctttgtaaaagattttaa cagttttcgcgccaaaatacaataacatggttttgaataatgattttgag ataaatttcccgtaacctgNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCTTGT TTACAacaagaattataaattttcaatgtttgttgcaaatttactcaggc taaatctgtaagggaaaaattgctcaaaaatttggacaaaaaatcaccat actcagattcttggaaagcttatgacatgaaattttttttacctggtCAC TAATTCAACTTTCTAAATCATATTCcaagttcaaggcgtaaagcaatTGC CTTTATTCTACTTCTTTATtcaagtcaaaatttttgcctttgcgaaaaaa aaatctgcagatttttcggtcacgtgaccaggtgtcagccatatttaaaa tttttttttggtatttcaaaacccctattacatgtggaaaaaatgaggta ttacttatcgtgatatctttaatcaatcactttctattgcaattttagtg aaaccagtcaaaaatagaatttttgtttGTGTCATATAGCCatgaaatca tgcgtccggaaagggttaagtaAATTGAAGATGGGAAAAACcctaagcca cggatcacggattgaaacaaatatatgaagggtgggattttacagccgcc cgtcatgcaaggcactgaaaggccacgggtgccaaaaagaagggccattt gaaatgtggcaacctcattggtagaaatttgataaacagctgcgaaggag cgctggaaagcaatcagtagaagagacctctttcgtttttgttgcagatt ttttataaaaacttctctcagggattacttgtcaatgtacatgtacacat gtgttgtgtcaacttgtcagcattgtattgttgtaaaggaaaagataaaa gaggtaagactagcctagtttctaatcctgatataggagtttaagtttag actgtctATTATTACAGTAGTCAGAAGTTTGATCAGTTTAATTATTCCAG CAATCTTCACCTCTTCCTTCAAAAATTGTATCACCGCATTTGACATTCTT TGAAAGTGTAAGGTACAAACCTCCAGGATGGGAATtaactttctttctat tttttctatctTTACTCACTTCCCTGGTATGTTTAAACTAACTGAGACTT ATTTTTGAGTTTATTGTAATTGTTCCATCAAGCTGTTAATCATCTTTCTA CAAATTAAACTATTGCACTGGATAAGATTCTAACCATCACCAAAAACAAC CCTAACTGGTAATGACCCAATATCCCTGAAGGGTGGAATGGGTATTGgtt caaatttgctcaaattggCATGCTAACATTCTCCTGAATTAGCATGCAAA AACGCTGCAAAATCTTCCTGTGCAATGTCCCAAAAAGTATTAGCTTGAGT ATTAcaggcatcgaaataagggatagaaagtgcatcgcaatttttggata agcatgattttgcatcctaaaatggatcaattttcaattcttaGCTTGTA ATTAATCTAAAAACGCATTGCGAAATGCGATacgctaattcgatccctgT ATTAGGGTTTTATTTTCGTAATACAAAGCAGATGATTTCCAGAATGAAAA AGTGAAGTAATTAAAAATGCAGAACAGTCCATAGCTCCTCCCGTTCTCCC AAACGACTTGCCATAGAAAAAGTTGATGGAAGTTTTCTCTATGAACCCCC AACTCCTTCGATGTGGCAATAAAGTTTTTAAATGTTGAAATCTCAAGATA TTCAACCCTTCATCGCTGTTTCATTATGTagttgttggacctaccccggt ggaggtcctataaattaacctttgtccgttcgttcttCTGTTCgccgtct gttcgttcgtctgttcgttattagctttcctcatgattggctcgttagtt ttttctgattttttgcacaaagatgcataactataaaccctcgaatgtga cggagcccgattttcaaaaaaaaaaaattttggacaaatttgggccaaaa aacaactaaaaaacaggttttttggactttgtgaaaaattaggtcgttaa ttgtttctgattttttgcatgaaagtagggtaccatcgtaggtaaaagat ggcttaagcaaatttttgcaaaagaatattgttggctcaaaaaacgcatg tttatctataagaatcactattaataagcatacatcaatgttcttagtca aattactcaatttttttattagatagatgttttttttgcccatgagggct tacttttaaagaatatatgtgtttagacatgaaattttggttgtttggtt tgtttttatagaaaaactggccaaattcgatatttttttataagcacact atcaattacttaggtattagcgtttctcgagattggctctttcattcttt atgattttttgcacaaggatgcataactataaaccctcgaatgtgacgga gctagatttttggggaaaaaattttggggtaaatttcagctaaaaaacgg ataaaaaaagggttttttggacttgttatttttctgactttttgcatgaa agtaggtaaaagatggcttcagcagattttcgtaaaaaaagaatttttca gctcaaaaaacgcatatttatctataagaNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNgaatt cttcaagagtatgaaattttggtttctaaacgtgttttttataagaaaca aacgactaattttaatagatcatcactatttgtgttctgaatgattgttt aatggtcacgcttatgtagatatcaattatatatgtgttaaatgcataac cagttgggtccataaaagtatcacttgttatcttTACTTTTACTATGGTT TGCATGTCTTTTAAGTTTATTATTCGAAAATAATGattaagaaataaaaa cttcCACTCCCTCAAAGTTATCCtgttttcaaatcaaagatTAGTACTTT TAAAGAACAAGCATCCAACCTCCACCAGCTAAAAATGATATTAAAATACA GAACCTAAAATGACCCGTAATTGtagtctttttcttttggtgTGGTCTGA AATTGGCTAAATCATTGATAGTCTTTTACTTATCACTTGTGAgctggaaa aaaataaatttcactAATGAAAAGCTAGAATCCTTAGCTTTGCATTGATA GTTTtgatgaaacttttgaaaatattgagaaaaaaaactaaatttctgAT TTAAAGACAGCTCATAGATTTTAGTAATGGCAACCATGTGACAAACTGAA GTACTATCTTTCCCatgttaagaaaaaaattgaaaggttaAATCTCATTC AGCCCATTAGGGACCTGAAAGATAGCTAAAAGAATGGTTGAGAATGATCC TAATGtgctttttttggtaaaagctttGGAATTTATTTTAAGATTTCTAG AAAGCCTTTGGTAGGTCATTGTAAATAAACTTTTTATTCGAAAGTGATTG CTTATGAAATAAAAAGCAGTCAATTCTTTCAGGGCTAAAATGGTCtgtca aaatatatttcttatTTCCAATTTTCAATTAAGGCGaaaccaatttgatt agttgtttaaCAGGCCCGGCCAccttgaaattccaaaaatccaaaaaaaa ataaaattgattttggtagtacatttttatttttatgaccTTATTGAcgg ccaaaatttcaaatttttggtagttttgagaatttcatgttcaatttttc atttcatccatGGATTTGagctttttgtctttttattttctatttcccAT TTTGGCCAAgatatactttaatcgtagaaattttagctaGGCTAAtttta gcgagtcaggaaaatcttgattttttttggatttattttagcaaatcacg atctcaaaaagttttgcgcggataaattttagcgaatattcgtattacat tattgactgagttccttttctagcatttctcagatcacttttatcaaccc gctttctttgtaacttttaagggtgtttctaaaattacttttgtcaactt gctttctttgtaaccttctttgttttgaaaatcacttttattggcttgct ttcttcataactttcaagagtgtttctaagatcacttttatcaattcgct tacTTCACAACTTCCAAGAgcgtttctaagatcacttttatcggcttgct tacttcataactttcaagagtgtttctaagatcactttttgctccggcct aggagccttaaattctctctcgtccgacgacgacgacgctcaagacattt tttgtttgtttatctaatccgatgatctattccNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNATCAATTcgcttacttcataactttc aagagtgtttctaagttaacttttatcaactcgctttctttgtaactttc aagagtgtttctaagttaacttttatcaactcgctttcttcttaactttc aagggtgtgaCAGGATTTCACTTCTGTCTGACATGATGTtcgattgacta aaaatatttatttgcagccctgtatACAAAGAAAAATCGTGATTCAAACG AATCAAAGATTTAAGAAGAAAAGTGTGTAGTAATGTGTACAAAAGTAAGC AAAAGTCTCCAACTTGACAAAGATAATTGCTAATCGAACAACGATTTTTC TCCTGACTGACAACGAAAGAAATTTTCACCCGGCCAATGGACCAGGTGCT TTTAACCAGGTCGACTAGCTTTGTCAGGCAACCCAGCATCCTAATACAAA CTTCTAGCAACTTGTTGTGTATTTAGAAATGTTTGGATTTAGTTTAGTTG AATTTAGTGACAGTTATCTTTTAATAAAGTTACAAGctatttttttgaga aaagaaaTTAAGTTAAGAGAAGTAAAATTCAACAATTACTTTCAACAACT GTCTAAATGTCATAATCTCTTTTGGCTAAGGTTAGGATGGGGAAATAATG GGTATTTGCTTTTTTGATGATAAACCTCAATAGTTAAAGATATTATATAG ATATTATCATCATAATCCAAAGCAGGAACTTGTAATTGTAGGATTTCAGT TTTGTCTGGTGTTTCTGACAGGAAAATTATGTAATAAAATTCAGGTTATC TTGACTTTAATATTTGAGGAATTTGACTCCTGGAATTTGTCTAgtgaaac tgaaaaatttaataaaacaaTATTTTCCCTTTAGAATTTCAGTAAACTAA ATAATAAAATGCAGACCATCAAATGCGTGGTCGTTGGTGATGGTGCCGTA GGAAAAACCTGTTTACTGATTTCTTATACAACAAATAAATTCCCCAGTGA ATATGTACCGACAGTAAGTAAATATTTATTCTTTTCTATACTGGACAATA GAGTATACCTTTGGAAATGCAGCTTTTATGCATACAAGgctttcaattaa aaatgattttgtttttattttttctcaagGTATTTGACAACTATGCTGTA ACGGTCATGATAGGAGGAGAACCATATACGTTAGGTCTCTTCGATACAGC TGGTATGTATATTTGAATCATGTTTTTATTAGTatatcaaaaaagatttt ttgtccaCCTTTTCCATTTTCCAGATTGATTGAGAACTTGGACTAAAAAG CTTTTGACATCTTTCTTTGTGTTAAAGCAGTATCGTAATTCTTCCATCTG TCGAAAGAAATCCATCCAGTTGAGATTTTTCACTTAGATTTCCGTCCCAA TAGCACACGAATCTAAAAGTAGTAACAAATCTGCATAACTATTTGTTTGT ATAACTTGCGATCTCGTCCTCCTTTGCGTTAACTGCTCTTGCACATTAGT CAATTACAATATTAGAGGTAATAACTTTCATGGTTTTACAATCATTTCAA AATGAACTGTGGGATTGGAACTCTACAAATTTctagttgaaataattatg acgtGTTAGATACGAAGGGCTATTGCAAGCCTTTGAAGCTTTCGTCTAAT TTTGAACCTTCTATCCAGAAAACCAAAATAGTTGCGAAACTGGTACTTGA TTTAAAATCCTATTTATCACTTTGTTATTACCAGGTCAAGAAGATTACGA TCGTCTCAGGCCGTTATCATACCCACAAACAGATGTTTTCTTAGTCTGCT TCTCTGTTGTCGCCCCTGCATCATTCGAAAACGTAAAAGAAAAGGTACGT TTTACTAGTTTAAGATCTATTGTGATATTTTTAACTTATGATCCTCAAAT GTTTCTGTGTTGTTCCATAATGAGCAACCaagaaagaatttcaaaaattg aataatcGCTCTAACAGGCCATTGGTTACTGCCCACTTAGTGTGAAATAG TTTTAAATTCTTGATAATTCCCAAAAAGTAATTGATTTTATAacaagttt ttcttttcttttcagtgGGTTCCAGAAATTACACATCATTGTCCTAAAAC ACCATTTTTACTAGTCGGTACACAAGTCGATTTACGAGATGATGCCGCCA TCGTTGAAAAACTCGCCAAAACGAAACAAAAGCCAATCTCTTTCGAACAA GGAGAAAAATTAGCACGAGAATTGAAAGCAGTAAAATATGTCGAATGCTC CGCTTTAACGCAAAAAGGATTAAAGAACGTTTTTGACGAAGCCATTTTGG CTGCATTGGAGCCCCCAGAGcaaccaaagaaaaagaaatgtgtTTTACTC TAACTttggttaaaaaattaattttttgttgaaacGACCTTAATATAAAA ATTCCACTCGCTTCCGTCGATCAATAATGCACACTGCGCTTATCGATAGA GAGAATCTGCCAGTGGAATGAATTGTACAGCTTTGCTTATATGCCAAGAG AGGTGAATTCATCATAACATAAAAGTGTGGAATACCTTTCAAAGGTTTTG CGAGGGAAACTGTTCATTGTATCGTTAAAAACCAACATCAAAATAAACCT CTATTTtatagtttaaaaaaaagtttagaaacataaAATTAAATGAATTA AAATATTGTTACCCAGGTTTTTTCTATAAATTAAGGGCTGGGTTTATGTA CTATATCTGGATATGCAACTTTTTTTGTATGTATTCTTATGTACCTCTTT CGAAAAAATAGTAATTTTTAAGACTTCTCATAATGAATGCCCTGATTGAG CTCAAttcaacttttaatttttttgtttatttattgtgCTGATTTTTTTC CTTCGTTGCTTTTCAGGGGATATTCATTTTTGTTTCAATCACTCAAAcga ttttttaaatatggcCAAAGTCTTCAGTTTTTATTCTTTGCTCAATCAGG GTGTACACCGAGAAACTATGTCACATTTTTTATAGTTGATTTCTCATGAA TGAATTATGGGACCAACCCCCTtctatattttgttttaaaagaaaactaa aTTGGCCACACGATTTGTACTTATCTATCTGATTTTATACTTGTGAAAAT ATCAACTGTCTAGAACTTTAAACACATCTTGCTCAGATTTGTTCTTCTTT TAAGAAATATCAGGGCAGAGTTCCAAATTATATACTTGTCAACTTATCAA AACTATTCAAATCGTTTATCTTGTATAATGTTCGTCAGCAAATAGATTGT TAGTTTTGACTCTTTTTGACTATTTTGATTTTGTAGGATTATAAACTATA TTTTTTTCGTCCCCTATGTGTTgtctgtatttttgaaaaacaatgttCAA TATacagacaatttaaaaaatttgcctGTAATTTACTTCAATACTTCATG TCCTCCTTTATCTCCATCCCCTTCTTGTCCGAAGGAACTTTACAATTCTT AATAACCGAGTTCCAAAAGCGAAGTGGAtcatgtggtgtgtttggggcat taaggctcttacgaacCTGTCTCCATAGCGGCTTttttattagagggatt tttagagtgtctcttattttgctagcaacttgcgaattgaggtggagtct agatcgcttcgcaacccttatacaatacggctagtagTG

Coding sequence (CDS) from alignment at sc0000011:4393..18431+

>TCONS_00001557 ID=TCONS_00001557|Name=TCONS_00001557|organism=Clytia hemisphaerica|type=CDS|length=3345bp|location=Sequence derived from alignment at sc0000011:4393..18431+ (Clytia hemisphaerica)
GACTCAAACCACCGCCCGTTCACTGAGCGAAGGAATACATTTTTTGGTAT
TGTGGATGCAGTGCCCAAGAATTTCAGTAAACTAAATAATAAAATGCAGA
CCATCAAATGCGTGGTCGTTGGTGATGGTGCCGTAGGAAAAACCTGTTTA
CTGATTTCTTATACAACAAATAAATTCCCCAGTGAATATGTACCGACAGT
ATTTGACAACTATGCTGTAACGGTCATGATAGGAGGAGAACCATATACGT
TAGGTCTCTTCGATACAGCTGGTCAAGAAGATTACGATCGTCTCAGGCCG
TTATCATACCCACAAACAGATGTTTTCTTAGTCTGCTTCTCTGTTGTCGC
CCCTGCATCATTCGAAAACGTAAAAGAAAAGtgGGTTCCAGAAATTACAC
ATCATTGTCCTAAAACACCATTTTTACTAGTCGGTACACAAGTCGATTTA
CGAGATGATGCCGCCATCGTTGAAAAACTCGCCAAAACGAAACAAAAGCC
AATCTCTTTCGAACAAGGAGAAAAATTAGCACGAGAATTGAAAGCAGTAA
AATATGTCGAATGCTCCGCTTTAACGCAAAAAGGATTAAAGAACGTTTTT
GACGAAGCCATTTTGGCTGCATTGGAGCCCCCAGAGcaaccaaagaaaaa
gaaatgtgtTTTACTCTAAGACTCAAACCACCGCCCGTTCACTGAGCGAA
GGAATACATTTTTTGGTATTGTGGATGCAGTGCCCAAGAATTTCAGTAAA
CTAAATAATAAAATGCAGACCATCAAATGCGTGGTCGTTGGTGATGGTGC
CGTAGGAAAAACCTGTTTACTGATTTCTTATACAACAAATAAATTCCCCA
GTGAATATGTACCGACAGTATTTGACAACTATGCTGTAACGGTCATGATA
GGAGGAGAACCATATACGTTAGGTCTCTTCGATACAGCTGGTCAAGAAGA
TTACGATCGTCTCAGGCCGTTATCATACCCACAAACAGATGTTTTCTTAG
TCTGCTTCTCTGTTGTCGCCCCTGCATCATTCGAAAACGTAAAAGAAAAG
tgGGTTCCAGAAATTACACATCATTGTCCTAAAACACCATTTTTACTAGT
CGGTACACAAGTCGATTTACGAGATGATGCCGCCATCGTTGAAAAACTCG
CCAAAACGAAACAAAAGCCAATCTCTTTCGAACAAGGAGAAAAATTAGCA
CGAGAATTGAAAGCAGTAAAATATGTCGAATGCTCCGCTTTAACGCAAAA
AGGATTAAAGAACGTTTTTGACGAAGCCATTTTGGCTGCATTGGAGCCCC
CAGAGcaaccaaagaaaaagaaatgtgtTTTACTCTAAGACTCAAACCAC
CGCCCGTTCACTGAGCGAAGGAATACATTTTTTGGTATTGTGGATGCAGT
GCCCAAGAATTTCAGTAAACTAAATAATAAAATGCAGACCATCAAATGCG
TGGTCGTTGGTGATGGTGCCGTAGGAAAAACCTGTTTACTGATTTCTTAT
ACAACAAATAAATTCCCCAGTGAATATGTACCGACAGTATTTGACAACTA
TGCTGTAACGGTCATGATAGGAGGAGAACCATATACGTTAGGTCTCTTCG
ATACAGCTGGTCAAGAAGATTACGATCGTCTCAGGCCGTTATCATACCCA
CAAACAGATGTTTTCTTAGTCTGCTTCTCTGTTGTCGCCCCTGCATCATT
CGAAAACGTAAAAGAAAAGtgGGTTCCAGAAATTACACATCATTGTCCTA
AAACACCATTTTTACTAGTCGGTACACAAGTCGATTTACGAGATGATGCC
GCCATCGTTGAAAAACTCGCCAAAACGAAACAAAAGCCAATCTCTTTCGA
ACAAGGAGAAAAATTAGCACGAGAATTGAAAGCAGTAAAATATGTCGAAT
GCTCCGCTTTAACGCAAAAAGGATTAAAGAACGTTTTTGACGAAGCCATT
TTGGCTGCATTGGAGCCCCCAGAGcaaccaaagaaaaagaaatgtgtTTT
ACTCTAAGACTCAAACCACCGCCCGTTCACTGAGCGAAGGAATACATTTT
TTGGTATTGTGGATGCAGTGCCCAAGAATTTCAGTAAACTAAATAATAAA
ATGCAGACCATCAAATGCGTGGTCGTTGGTGATGGTGCCGTAGGAAAAAC
CTGTTTACTGATTTCTTATACAACAAATAAATTCCCCAGTGAATATGTAC
CGACAGTATTTGACAACTATGCTGTAACGGTCATGATAGGAGGAGAACCA
TATACGTTAGGTCTCTTCGATACAGCTGGTCAAGAAGATTACGATCGTCT
CAGGCCGTTATCATACCCACAAACAGATGTTTTCTTAGTCTGCTTCTCTG
TTGTCGCCCCTGCATCATTCGAAAACGTAAAAGAAAAGtgGGTTCCAGAA
ATTACACATCATTGTCCTAAAACACCATTTTTACTAGTCGGTACACAAGT
CGATTTACGAGATGATGCCGCCATCGTTGAAAAACTCGCCAAAACGAAAC
AAAAGCCAATCTCTTTCGAACAAGGAGAAAAATTAGCACGAGAATTGAAA
GCAGTAAAATATGTCGAATGCTCCGCTTTAACGCAAAAAGGATTAAAGAA
CGTTTTTGACGAAGCCATTTTGGCTGCATTGGAGCCCCCAGAGcaaccaa
agaaaaagaaatgtgtTTTACTCTAAGACTCAAACCACCGCCCGTTCACT
GAGCGAAGGAATACATTTTTTGGTATTGTGGATGCAGTGCCCAAGAATTT
CAGTAAACTAAATAATAAAATGCAGACCATCAAATGCGTGGTCGTTGGTG
ATGGTGCCGTAGGAAAAACCTGTTTACTGATTTCTTATACAACAAATAAA
TTCCCCAGTGAATATGTACCGACAGTATTTGACAACTATGCTGTAACGGT
CATGATAGGAGGAGAACCATATACGTTAGGTCTCTTCGATACAGCTGGTC
AAGAAGATTACGATCGTCTCAGGCCGTTATCATACCCACAAACAGATGTT
TTCTTAGTCTGCTTCTCTGTTGTCGCCCCTGCATCATTCGAAAACGTAAA
AGAAAAGtgGGTTCCAGAAATTACACATCATTGTCCTAAAACACCATTTT
TACTAGTCGGTACACAAGTCGATTTACGAGATGATGCCGCCATCGTTGAA
AAACTCGCCAAAACGAAACAAAAGCCAATCTCTTTCGAACAAGGAGAAAA
ATTAGCACGAGAATTGAAAGCAGTAAAATATGTCGAATGCTCCGCTTTAA
CGCAAAAAGGATTAAAGAACGTTTTTGACGAAGCCATTTTGGCTGCATTG
GAGCCCCCAGAGcaaccaaagaaaaagaaatgtgtTTTACTCTAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000816XLOC_000816Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001557-exon-sc0000011-1491911889:4393..4463TCONS_00001557-exon-sc0000011-1491911889:4393..4463Clytia hemisphaericaexon
TCONS_00001557-exon-sc0000011-1510915933:4393..4463TCONS_00001557-exon-sc0000011-1510915933:4393..4463Clytia hemisphaericaexon
TCONS_00001557-exon-sc0000011-1575043694:4393..4463TCONS_00001557-exon-sc0000011-1575043694:4393..4463Clytia hemisphaericaexon
TCONS_00001557-exon-sc0000011-1491911889:15677..15805TCONS_00001557-exon-sc0000011-1491911889:15677..15805Clytia hemisphaericaexon
TCONS_00001557-exon-sc0000011-1510915933:15677..15805TCONS_00001557-exon-sc0000011-1510915933:15677..15805Clytia hemisphaericaexon
TCONS_00001557-exon-sc0000011-1575043694:15677..15805TCONS_00001557-exon-sc0000011-1575043694:15677..15805Clytia hemisphaericaexon
TCONS_00001557-exon-sc0000011-1491911889:15922..15994TCONS_00001557-exon-sc0000011-1491911889:15922..15994Clytia hemisphaericaexon
TCONS_00001557-exon-sc0000011-1510915933:15922..15994TCONS_00001557-exon-sc0000011-1510915933:15922..15994Clytia hemisphaericaexon
TCONS_00001557-exon-sc0000011-1575043694:15922..15994TCONS_00001557-exon-sc0000011-1575043694:15922..15994Clytia hemisphaericaexon
TCONS_00001557-exon-sc0000011-1491911889:16527..16636TCONS_00001557-exon-sc0000011-1491911889:16527..16636Clytia hemisphaericaexon
TCONS_00001557-exon-sc0000011-1510915933:16527..16636TCONS_00001557-exon-sc0000011-1510915933:16527..16636Clytia hemisphaericaexon
TCONS_00001557-exon-sc0000011-1575043694:16527..16636TCONS_00001557-exon-sc0000011-1575043694:16527..16636Clytia hemisphaericaexon
TCONS_00001557-exon-sc0000011-1491911889:16858..18431TCONS_00001557-exon-sc0000011-1491911889:16858..18431Clytia hemisphaericaexon
TCONS_00001557-exon-sc0000011-1510915933:16858..18431TCONS_00001557-exon-sc0000011-1510915933:16858..18431Clytia hemisphaericaexon
TCONS_00001557-exon-sc0000011-1575043694:16858..18431TCONS_00001557-exon-sc0000011-1575043694:16858..18431Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001557-proteinTCONS_00001557-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000011supercontigsc0000011:4393..18431 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
326.594 331.834 388.596 381.286 303.019 218.562 321.918 330.774 270.949 306.831 322.722 256.478 310.321 330.055 308.067 292.434 335.851 359.056 362.886 307.361 469.747 460.062 348.547 352.362 187.443 225.818 342.079 302.377 277.517 276.365
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001806Small_GTPase
IPR005225Small_GTP-bd_dom
IPR003578Small_GTPase_Rho
IPR027417P-loop_NTPase
Vocabulary: Molecular Function
TermDefinition
GO:0005525GTP binding
GO:0003924GTPase activity
Vocabulary: Cellular Component
TermDefinition
GO:0005622intracellular
Vocabulary: Biological Process
TermDefinition
GO:0007264small GTPase mediated signal transduction
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0007264 small GTPase mediated signal transduction
cellular_component GO:0005622 intracellular
molecular_function GO:0003924 GTPase activity
molecular_function GO:0005525 GTP binding
Blast
BLAST of TCONS_00001557 vs. Swiss-Prot (Human)
Match: CDC42 (Cell division control protein 42 homolog OS=Homo sapiens GN=CDC42 PE=1 SV=2)

HSP 1 Score: 351.673 bits (901), Expect = 4.261e-117
Identity = 168/181 (92.82%), Postives = 175/181 (96.69%), Query Frame = 3
Query:   96 MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVAPASFENVKEKWVPEITHHCPKTPFLLVGTQVDLRDDAAIVEKLAKTKQKPISFEQGEKLARELKAVKYVECSALTQKGLKNVFDEAILAALEPPE 638
            MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVV+P+SFENVKEKWVPEITHHCPKTPFLLVGTQ+DLRDD + +EKLAK KQKPI+ E  EKLAR+LKAVKYVECSALTQKGLKNVFDEAILAALEPPE
Sbjct:    1 MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPE 181          
The following BLAST results are available for this feature:
BLAST of TCONS_00001557 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
CDC424.261e-11792.82Cell division control protein 42 homolog OS=Homo s... [more]
back to top