Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001521 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001521
Unique NameTCONS_00001521
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2935

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001521 ID=TCONS_00001521|Name=TCONS_00001521|organism=Clytia hemisphaerica|type=transcript|length=2935bp
CCTCGCCATAAAGTaaacaaaattaaagaaatcCACATTTCGTCAAGGCT
AACATTAGCAtagcaaatagaaaaaaacacttCATCATTTCCTTTATACA
ATCTGCCAAGGTTCCGAATCCTAGTGAAAAGTGTGCAAATCATgttttat
tcaaattaaaaatcaaaaccaaacctacacaagtacaatttttgaaatca
aCTAGGAAAATGGCGAATCATttttaaggctccagtgaaagAAAGAAAGG
TTATGGGTCAGCATTTTTAACATAAAGacctaaatattaaaaaaattaaa
aaattacatgTCGATACAACAATATacttcaaaaagtttcaataaatttt
cttcCAATTACCTCCACACAGGCAATTATCATTCCAACTATTAGCCCATA
GTTCATTAAAAGATCGTGTCTGATGGCAATTATAAATGGTCAAAACTGCA
CATCTACAACATTGCTTTACACTTTCGTTTGCAACTAAAGAAGTCGGTGA
CAAACGGATACCATCGTAAATTTGTTTCTTTTGGGTGTAAATATCATGGG
CACCCATGATTAAAGGATTTTTGAGAGCTGTCTCATGGACAGTTTGCCAG
TCATCAACGGTGAGTTGAATATCATAATGATTGAAACTGCTATTACCCAT
TGCGTTAAAACTTGTCGTTGAGAGAACAGTTCCTCTTGGATCCTGTGTTG
GATAATTCAGATACATTAAAGGTAAACTGCTGAACGGAAGTTCACTTAGG
AGTGCGTCCCCCGATTGCGGGTCACCGAGGCATGCTGCATACAGCTTGGA
TATCATTTTGAAGAGTTGGAGGAGGACTTCAGTGGAGTTCACCATGGTAA
CATAGACGGGTTGAATGTTTGGATTCTTTTGGAATAAGATGTAAAACAAA
ATGCAAGTTTTACGAAGGATAAAGAAGGTGCTGGCATCAAAGTATTGAAG
AACTATCTTCCAGTCGTTATGATGGTGGCTTGTTGCTAAGAGCAACCGGA
CAAGATGGAGCATGTAATCGGTGAGCCATTGGATGATTGGTTTGGTTGAT
AAGTTGCTTAATCCGGAAAAAGTAACATCTTTGGTGTCCAGGAGGGGTAC
GATTTTGGTCATTTCGAATTCCTTTTTGTTGGCAAGACAAATATTATGGA
TTTTTTCTAATAGGTTGATTTCCTTTTCGTTTTGTAGTAATGCTGTTAAA
TGGTAATAGATGTTGTGTAGGAATGTTTGATTGTAGCTCTCAAATACCCC
TTTGTAATCTTTGAGTATGGCAAAGATAAGAGCTTTGAAGTGGCTGAAAC
TTTGTCGAAACAAGCTTTGGGTGTTGCCATCATTTTCGTTGAATTCAGAA
ACAAATTGTTGAAGACATTGATCAATAAATGGTTTCTCGTAGGTTGAAAT
GTGAAGCATAATATCCCAAGGTGACCGTGATTCAGCCAAACAACACTGCA
ACATTGTGACAATACTCTTggctttgtttttatcttgagAATTCAACTGG
TTAGAAAAAGTAAGCAAAGTTAATTTGGCATTTCTAGACACTGAAAACAT
TGCATGGTCAGTTGGTGCAAAACTTGTAGAATCGAAAGGATCGTTTTTCA
ATTCTGGAAAGCTTGATGGTTGAGCAATTTGCTGGAGATTGTACATGGAG
TACAAATGGACTGCACCTTGATTATCAAGAACAAGCAGCTTCGGTAACAA
CGTTTGACTTGTGATTTGAGAAGTATGAGCAGCAGATAATTGTAAACTAG
TTATCGAAATATGCTCAATTTGTACATCTGGATATTGGATGGTTAATAAA
CAATTCACAGTGTCTGTTGGTTGACCTGTTTGACCTTGTGATTGAAACCG
AGAATGCAGCCTGACTATTTCCTTCCTGATTTCATAGATCTTGACAGAAG
ATGCTGTAGCACTCTTGGATGACACAGCGACTAGATCACTGCTGAAATTT
GGATTGCATTTTTTAACACATTTGACATCTGTGATTTCGTACTCATCAAA
ATCGGGTTCACCAGTAACGTAAGGTACAATACACGGAAAGACTTCTTCAC
TGATGTCCAAGCCATTAGGACCATCCATGAAAGTGACCGAAAACAATTCA
ACCATACATGGCTCAGTCACTGCAGCAACAAAGAGCTTCCCTGCGTCACT
GATAACAAAATCTGAAGAAATAATCTCAGATTTCAATGTCCCTAAACGGT
CAGAATAGACCTGTTTGCTAAGCTTGTTGCTGGGGTTTAAAAAATGGACT
TTGACCAAACGTTCAGCAGTGATCATAACAAAGCCAACATTGTTTTCTTT
GTAAGATGTTAATAACAAATCAGATTGGTTTTGGTTGAACCGATGAAACC
ATTCTTTCATGGTTCCAGATTTATCAAAATCTGGCAAATAACGATGTGCT
GTACTATTTAACCAGGCAATCTTACATATTCGACCACCATTATTCAAATC
AATGGTACAATTCTCAAGACAAGTCCAATTGTTAATCAATGATTTTTCTT
GATTCCAAATTTTGCCCATCCCTGTATTATCAACTGTTAATAGATAATCA
CCACTTGCGTCCCACTCTAGATGCTCAATCAACCCTTGATGACCAGTATT
TATGGGGAAATTTTCCCAAGGCATATCTGGATTCAAAATGTAAACAGTGT
TGACATCCAACGATGAGTTTCCATTTTCATAACCAGTAGAATAAGCAATC
CAATTCTTAGATGACCAGGAACAAATTGATTTAGTAATCTTTTGTTCTGG
CAGGGAATCTTCAGGCCAATGGCATTGATAAGCTGGCAACATCTTTTGCT
TTATTATTATACTTTTATATTGTTATTTTATTGCGTAGTATTtatctgaa
aataaaatatgaaagaaaGTAAAATTGATTAATACAACTTGTTGCTATTT
TGTTTTAATAGCTAAAGATATAAGAAAGCTTTGAG
Run BLAST on NCBI

protein sequence of TCONS_00001521-protein

>TCONS_00001521-protein ID=TCONS_00001521-protein|Name=TCONS_00001521-protein|organism=Clytia hemisphaerica|type=polypeptide|length=817bp
MLPAYQCHWPEDSLPEQKITKSICSWSSKNWIAYSTGYENGNSSLDVNTV
YILNPDMPWENFPINTGHQGLIEHLEWDASGDYLLTVDNTGMGKIWNQEK
SLINNWTCLENCTIDLNNGGRICKIAWLNSTAHRYLPDFDKSGTMKEWFH
RFNQNQSDLLLTSYKENNVGFVMITAERLVKVHFLNPSNKLSKQVYSDRL
GTLKSEIISSDFVISDAGKLFVAAVTEPCMVELFSVTFMDGPNGLDISEE
VFPCIVPYVTGEPDFDEYEITDVKCVKKCNPNFSSDLVAVSSKSATASSV
KIYEIRKEIVRLHSRFQSQGQTGQPTDTVNCLLTIQYPDVQIEHISITSL
QLSAAHTSQITSQTLLPKLLVLDNQGAVHLYSMYNLQQIAQPSSFPELKN
DPFDSTSFAPTDHAMFSVSRNAKLTLLTFSNQLNSQDKNKAKSIVTMLQC
CLAESRSPWDIMLHISTYEKPFIDQCLQQFVSEFNENDGNTQSLFRQSFS
HFKALIFAILKDYKGVFESYNQTFLHNIYYHLTALLQNEKEINLLEKIHN
ICLANKKEFEMTKIVPLLDTKDVTFSGLSNLSTKPIIQWLTDYMLHLVRL
LLATSHHHNDWKIVLQYFDASTFFILRKTCILFYILFQKNPNIQPVYVTM
VNSTEVLLQLFKMISKLYAACLGDPQSGDALLSELPFSSLPLMYLNYPTQ
DPRGTVLSTTSFNAMGNSSFNHYDIQLTVDDWQTVHETALKNPLIMGAHD
IYTQKKQIYDGIRLSPTSLVANESVKQCCRCAVLTIYNCHQTRSFNELWA
NSWNDNCLCGGNWKKIY
Run BLAST on NCBI

transcript from alignment at sc0000010:21179..24113

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001521 ID=TCONS_00001521|Name=TCONS_00001521|organism=Clytia hemisphaerica|type=transcript|length=2935bp|location=Sequence derived from alignment at sc0000010:21179..24113 (Clytia hemisphaerica)
CTCAAAGCTTTCTTATATCTTTAGCTATTAAAACAAAATAGCAACAAGTT GTATTAATCAATTTTACtttctttcatattttattttcagataAATACTA CGCAATAAAATAACAATATAAAAGTATAATAATAAAGCAAAAGATGTTGC CAGCTTATCAATGCCATTGGCCTGAAGATTCCCTGCCAGAACAAAAGATT ACTAAATCAATTTGTTCCTGGTCATCTAAGAATTGGATTGCTTATTCTAC TGGTTATGAAAATGGAAACTCATCGTTGGATGTCAACACTGTTTACATTT TGAATCCAGATATGCCTTGGGAAAATTTCCCCATAAATACTGGTCATCAA GGGTTGATTGAGCATCTAGAGTGGGACGCAAGTGGTGATTATCTATTAAC AGTTGATAATACAGGGATGGGCAAAATTTGGAATCAAGAAAAATCATTGA TTAACAATTGGACTTGTCTTGAGAATTGTACCATTGATTTGAATAATGGT GGTCGAATATGTAAGATTGCCTGGTTAAATAGTACAGCACATCGTTATTT GCCAGATTTTGATAAATCTGGAACCATGAAAGAATGGTTTCATCGGTTCA ACCAAAACCAATCTGATTTGTTATTAACATCTTACAAAGAAAACAATGTT GGCTTTGTTATGATCACTGCTGAACGTTTGGTCAAAGTCCATTTTTTAAA CCCCAGCAACAAGCTTAGCAAACAGGTCTATTCTGACCGTTTAGGGACAT TGAAATCTGAGATTATTTCTTCAGATTTTGTTATCAGTGACGCAGGGAAG CTCTTTGTTGCTGCAGTGACTGAGCCATGTATGGTTGAATTGTTTTCGGT CACTTTCATGGATGGTCCTAATGGCTTGGACATCAGTGAAGAAGTCTTTC CGTGTATTGTACCTTACGTTACTGGTGAACCCGATTTTGATGAGTACGAA ATCACAGATGTCAAATGTGTTAAAAAATGCAATCCAAATTTCAGCAGTGA TCTAGTCGCTGTGTCATCCAAGAGTGCTACAGCATCTTCTGTCAAGATCT ATGAAATCAGGAAGGAAATAGTCAGGCTGCATTCTCGGTTTCAATCACAA GGTCAAACAGGTCAACCAACAGACACTGTGAATTGTTTATTAACCATCCA ATATCCAGATGTACAAATTGAGCATATTTCGATAACTAGTTTACAATTAT CTGCTGCTCATACTTCTCAAATCACAAGTCAAACGTTGTTACCGAAGCTG CTTGTTCTTGATAATCAAGGTGCAGTCCATTTGTACTCCATGTACAATCT CCAGCAAATTGCTCAACCATCAAGCTTTCCAGAATTGAAAAACGATCCTT TCGATTCTACAAGTTTTGCACCAACTGACCATGCAATGTTTTCAGTGTCT AGAAATGCCAAATTAACTTTGCTTACTTTTTCTAACCAGTTGAATTctca agataaaaacaaagccAAGAGTATTGTCACAATGTTGCAGTGTTGTTTGG CTGAATCACGGTCACCTTGGGATATTATGCTTCACATTTCAACCTACGAG AAACCATTTATTGATCAATGTCTTCAACAATTTGTTTCTGAATTCAACGA AAATGATGGCAACACCCAAAGCTTGTTTCGACAAAGTTTCAGCCACTTCA AAGCTCTTATCTTTGCCATACTCAAAGATTACAAAGGGGTATTTGAGAGC TACAATCAAACATTCCTACACAACATCTATTACCATTTAACAGCATTACT ACAAAACGAAAAGGAAATCAACCTATTAGAAAAAATCCATAATATTTGTC TTGCCAACAAAAAGGAATTCGAAATGACCAAAATCGTACCCCTCCTGGAC ACCAAAGATGTTACTTTTTCCGGATTAAGCAACTTATCAACCAAACCAAT CATCCAATGGCTCACCGATTACATGCTCCATCTTGTCCGGTTGCTCTTAG CAACAAGCCACCATCATAACGACTGGAAGATAGTTCTTCAATACTTTGAT GCCAGCACCTTCTTTATCCTTCGTAAAACTTGCATTTTGTTTTACATCTT ATTCCAAAAGAATCCAAACATTCAACCCGTCTATGTTACCATGGTGAACT CCACTGAAGTCCTCCTCCAACTCTTCAAAATGATATCCAAGCTGTATGCA GCATGCCTCGGTGACCCGCAATCGGGGGACGCACTCCTAAGTGAACTTCC GTTCAGCAGTTTACCTTTAATGTATCTGAATTATCCAACACAGGATCCAA GAGGAACTGTTCTCTCAACGACAAGTTTTAACGCAATGGGTAATAGCAGT TTCAATCATTATGATATTCAACTCACCGTTGATGACTGGCAAACTGTCCA TGAGACAGCTCTCAAAAATCCTTTAATCATGGGTGCCCATGATATTTACA CCCAAAAGAAACAAATTTACGATGGTATCCGTTTGTCACCGACTTCTTTA GTTGCAAACGAAAGTGTAAAGCAATGTTGTAGATGTGCAGTTTTGACCAT TTATAATTGCCATCAGACACGATCTTTTAATGAACTATGGGCTAATAGTT GGAATGATAATTGCCTGTGTGGAGGTAATTGgaagaaaatttattgaaac tttttgaagtATATTGTTGTATCGAcatgtaattttttaatttttttaat atttaggtCTTTATGTTAAAAATGCTGACCCATAACCTTTCTTTctttca ctggagccttaaaaATGATTCGCCATTTTCCTAGttgatttcaaaaattg tacttgtgtaggtttggttttgatttttaatttgaataaaacATGATTTG CACACTTTTCACTAGGATTCGGAACCTTGGCAGATTGTATAAAGGAAATG ATGaagtgtttttttctatttgctaTGCTAATGTTAGCCTTGACGAAATG TGgatttctttaattttgtttACTTTATGGCGAGG

Coding sequence (CDS) from alignment at sc0000010:21179..24113

>TCONS_00001521 ID=TCONS_00001521|Name=TCONS_00001521|organism=Clytia hemisphaerica|type=CDS|length=2454bp|location=Sequence derived from alignment at sc0000010:21179..24113 (Clytia hemisphaerica)
ATGTTGCCAGCTTATCAATGCCATTGGCCTGAAGATTCCCTGCCAGAACA
AAAGATTACTAAATCAATTTGTTCCTGGTCATCTAAGAATTGGATTGCTT
ATTCTACTGGTTATGAAAATGGAAACTCATCGTTGGATGTCAACACTGTT
TACATTTTGAATCCAGATATGCCTTGGGAAAATTTCCCCATAAATACTGG
TCATCAAGGGTTGATTGAGCATCTAGAGTGGGACGCAAGTGGTGATTATC
TATTAACAGTTGATAATACAGGGATGGGCAAAATTTGGAATCAAGAAAAA
TCATTGATTAACAATTGGACTTGTCTTGAGAATTGTACCATTGATTTGAA
TAATGGTGGTCGAATATGTAAGATTGCCTGGTTAAATAGTACAGCACATC
GTTATTTGCCAGATTTTGATAAATCTGGAACCATGAAAGAATGGTTTCAT
CGGTTCAACCAAAACCAATCTGATTTGTTATTAACATCTTACAAAGAAAA
CAATGTTGGCTTTGTTATGATCACTGCTGAACGTTTGGTCAAAGTCCATT
TTTTAAACCCCAGCAACAAGCTTAGCAAACAGGTCTATTCTGACCGTTTA
GGGACATTGAAATCTGAGATTATTTCTTCAGATTTTGTTATCAGTGACGC
AGGGAAGCTCTTTGTTGCTGCAGTGACTGAGCCATGTATGGTTGAATTGT
TTTCGGTCACTTTCATGGATGGTCCTAATGGCTTGGACATCAGTGAAGAA
GTCTTTCCGTGTATTGTACCTTACGTTACTGGTGAACCCGATTTTGATGA
GTACGAAATCACAGATGTCAAATGTGTTAAAAAATGCAATCCAAATTTCA
GCAGTGATCTAGTCGCTGTGTCATCCAAGAGTGCTACAGCATCTTCTGTC
AAGATCTATGAAATCAGGAAGGAAATAGTCAGGCTGCATTCTCGGTTTCA
ATCACAAGGTCAAACAGGTCAACCAACAGACACTGTGAATTGTTTATTAA
CCATCCAATATCCAGATGTACAAATTGAGCATATTTCGATAACTAGTTTA
CAATTATCTGCTGCTCATACTTCTCAAATCACAAGTCAAACGTTGTTACC
GAAGCTGCTTGTTCTTGATAATCAAGGTGCAGTCCATTTGTACTCCATGT
ACAATCTCCAGCAAATTGCTCAACCATCAAGCTTTCCAGAATTGAAAAAC
GATCCTTTCGATTCTACAAGTTTTGCACCAACTGACCATGCAATGTTTTC
AGTGTCTAGAAATGCCAAATTAACTTTGCTTACTTTTTCTAACCAGTTGA
ATTctcaagataaaaacaaagccAAGAGTATTGTCACAATGTTGCAGTGT
TGTTTGGCTGAATCACGGTCACCTTGGGATATTATGCTTCACATTTCAAC
CTACGAGAAACCATTTATTGATCAATGTCTTCAACAATTTGTTTCTGAAT
TCAACGAAAATGATGGCAACACCCAAAGCTTGTTTCGACAAAGTTTCAGC
CACTTCAAAGCTCTTATCTTTGCCATACTCAAAGATTACAAAGGGGTATT
TGAGAGCTACAATCAAACATTCCTACACAACATCTATTACCATTTAACAG
CATTACTACAAAACGAAAAGGAAATCAACCTATTAGAAAAAATCCATAAT
ATTTGTCTTGCCAACAAAAAGGAATTCGAAATGACCAAAATCGTACCCCT
CCTGGACACCAAAGATGTTACTTTTTCCGGATTAAGCAACTTATCAACCA
AACCAATCATCCAATGGCTCACCGATTACATGCTCCATCTTGTCCGGTTG
CTCTTAGCAACAAGCCACCATCATAACGACTGGAAGATAGTTCTTCAATA
CTTTGATGCCAGCACCTTCTTTATCCTTCGTAAAACTTGCATTTTGTTTT
ACATCTTATTCCAAAAGAATCCAAACATTCAACCCGTCTATGTTACCATG
GTGAACTCCACTGAAGTCCTCCTCCAACTCTTCAAAATGATATCCAAGCT
GTATGCAGCATGCCTCGGTGACCCGCAATCGGGGGACGCACTCCTAAGTG
AACTTCCGTTCAGCAGTTTACCTTTAATGTATCTGAATTATCCAACACAG
GATCCAAGAGGAACTGTTCTCTCAACGACAAGTTTTAACGCAATGGGTAA
TAGCAGTTTCAATCATTATGATATTCAACTCACCGTTGATGACTGGCAAA
CTGTCCATGAGACAGCTCTCAAAAATCCTTTAATCATGGGTGCCCATGAT
ATTTACACCCAAAAGAAACAAATTTACGATGGTATCCGTTTGTCACCGAC
TTCTTTAGTTGCAAACGAAAGTGTAAAGCAATGTTGTAGATGTGCAGTTT
TGACCATTTATAATTGCCATCAGACACGATCTTTTAATGAACTATGGGCT
AATAGTTGGAATGATAATTGCCTGTGTGGAGGTAATTGgaagaaaattta
ttga
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000780XLOC_000780Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001521-proteinTCONS_00001521-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001521-exon-sc0000010-1491911889:21179..24113TCONS_00001521-exon-sc0000010-1491911889:21179..24113Clytia hemisphaericaexon
TCONS_00001521-exon-sc0000010-1510915933:21179..24113TCONS_00001521-exon-sc0000010-1510915933:21179..24113Clytia hemisphaericaexon
TCONS_00001521-exon-sc0000010-1575043694:21179..24113TCONS_00001521-exon-sc0000010-1575043694:21179..24113Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000010supercontigsc0000010:21179..24113 .
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
28.1896 27.6035 10.8603 9.80332 14.304 12.0244 13.8711 14.5524 7.55636 10.1477 7.81901 5.82465 6.24068 5.1866 7.22014 8.66034 9.8677 10.1541 3.19584 3.0981 7.14728 7.16265 22.0849 21.1637 9.75328 8.77939 4.88969 3.46624 15.7163 17.1163
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR021665Mediator_Med16
IPR015943WD40/YVTN_repeat-like_dom
IPR017986WD40_repeat_dom
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005515 protein binding
Blast
BLAST of TCONS_00001521 vs. Swiss-Prot (Human)
Match: MED16 (Mediator of RNA polymerase II transcription subunit 16 OS=Homo sapiens GN=MED16 PE=1 SV=2)

HSP 1 Score: 115.161 bits (287), Expect = 5.631e-26
Identity = 181/852 (21.24%), Postives = 345/852 (40.49%), Query Frame = -3
Query:  369 AYQCHWPEDSLPEQKITKSI--------CSWSSKNWIAYSTGYENGNSSLDVNTVYILNPDMPWENFPINTGHQGLIEHLEWDASGDYLLTVDNTGMGKIWNQEKSLINNWTCLENCTIDLNNGGRICKIAWLNSTAHRYLPDFDKSG--TMKEWFHRFNQNQSDLLLTSYKENNV-GFVMITAERLVKVHFLNPSNKLSKQVYSDRLGTLKSEIISSDFVISDAGKLFVAAV--TEPCMVELFSVTFMDGPNGLDISEEVFPCIVPYVTGEPDFDEY--EITDVKCVKKCNPNFSSDLXXXXXXXXXXXXXKIYE---IRKEIVRLHSRFQSQGQT---GQPTDTVNCLLTIQYPDVQIEHISITSLQLSAAHTS-QITSQT-LLPKL-LVLD-NQGAVHLYSMYNLQQIA--------QPSSFPELKNDP-------FDSTSFAPTDHAMFSVSRNAKLTLLTFSNQLNS--QDKNKAKSIVTMLQCCLAESRSPWDIMLHISTYEKPFIDQCLQQFVSEFNENDGNTQSLFRQSFSHFKALIFAILK-DYKGVFESYNQTFLHNIYYHLTALLQ----NEKEINLLEKIHNICLANKKEFEMTKIVPLLDTKDVTFSGLSNLSTKPIIQWLTDYMLHLVRLLLATSHHHNDWKIVLQYFDASTFFILRKTCILFYILFQKNPNIQPVYVTMVNSTEVLLQLFKMISKLYAACLGDPQSGDAXXXXXXXXXXXLMYLNYPTQDPRGTVLSTTSFNAMGNSSFNHYDIQLTVDDWQTVHETALKNPLIMGAHDIYTQKKQIYDGIRLSPTSLVANESVKQCCRCAVLTIYNCHQTRSFNELWANSWNDNCL 2783
            AY C W       +K +KS         C+WS +N IA++    + +  L    ++IL+ + PW+   I + H   I  LEWD SG  LL+ D  G  K W+    L N+W   E+    L  G  I  ++WL++     L   +KSG  +  E F R   + S   LT +    + G++ +T   LV V  L PS ++     S  L  L+  +  +D   +  G + VA    +    V+ + V          I  E+ P +    T + +  +    IT +K + +       D+       A++ +  I E   +RKE + +++ FQ         QPT     +L+      ++  +++  L +S  +T  ++ S T   P L L L  + G+VH+    +LQ +A        +P   P +K            +   + T  A+  +  + KL++L  S  +    +     + ++ +L+ C+      WDI+LH+   +   +   +++   E+       Q +        KA +  +       V + + + FL  I   L +LL+    N  + +  +++  IC     + ++ K++  L T++      +  + + ++QW+ D++L+L+  L             L+  D ++  +LR+  ++  I     P+  PVY    ++ + +  LF++++KL+  C  +  + +   + +    L    L  P+ D         + + + +       ++L      T+  +A    L  G      Q K   D +R         E  K C RC  +T+       +  + W   W  NCL
Sbjct:   16 AYVCEW-------EKWSKSTHCPSVPLACAWSCRNLIAFTMDLRSDDQDL-TRMIHILDTEHPWDLHSIPSEHHEAITCLEWDQSGSRLLSADADGQIKCWSMADHLANSW---ESSVGSLVEGDPIVALSWLHNGVKLAL-HVEKSGASSFGEKFSRVKFSPS---LTLFGGKPMEGWIAVTVSGLVTVSLLKPSGQVLTSTES--LCRLRGRVALADIAFTGGGNIVVATADGSSASPVQFYKVCVSVVSEKCRIDTEILPSLFMRCTTDLNRKDKFPAITHLKFLAR-------DMSEQVLLCASSQTSSIVECWSLRKEGLPVNNIFQQISPVVGDKQPTILKWRILSATNDLDRVSAVALPKLPISLTNTDLKVASDTQFYPGLGLALAFHDGSVHIVHRLSLQTMAVFYSSAAPRPVDEPAMKRPRTAGPAVHLKAMQLSWTSLALVGIDSHGKLSVLRLSPSMGHPLEVGLALRHLLFLLEYCMVTGYDWWDILLHV---QPSMVQSLVEKLHEEYTRQTAALQQVLSTRILAMKASLCKLSPCTVTRVCDYHTKLFLIAISSTLKSLLRPHFLNTPDKSPGDRLTEIC-TKITDVDIDKVMINLKTEEFVLDMNTLQALQQLLQWVGDFVLYLLASLPNQGSLLRPGHSFLR--DGTSLGMLRELMVVIRIWGLLKPSCLPVYTATSDTQDSMSLLFRLLTKLWICCRDEGPASEPDEALVDECCLLPSQLLIPSLD------WLPASDGLVSRLQPKQPLRLQFGRAPTLPGSAATLQLD-GLARAPGQPK--IDHLRRLHLGACPTEECKACTRCGCVTMLKSPNRTTAVKQWEQRWIKNCL 828          
The following BLAST results are available for this feature:
BLAST of TCONS_00001521 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
MED165.631e-2621.24Mediator of RNA polymerase II transcription subuni... [more]
back to top