Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001520 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001520
Unique NameTCONS_00001520
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1090

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001520 ID=TCONS_00001520|Name=TCONS_00001520|organism=Clytia hemisphaerica|type=transcript|length=1090bp
AAcacccaaaacaaaacaagaaactaGGGTCAGCAGCATtatatatttct
attttcattaaaaaatcatgaaaataataaatttcCAATATTCTACTATC
TTCTTCTTTTCTTACCACTACTTCCACCAGAGATTTTCTTCTTGAATTTA
TCTTTTTTACCTTTACCTTTCTTCTTCTTTGGATTATACCGGTCATCACC
CATATCACTATCACTGTCATCATCACCAGCACCGTGGAATGAATCCAGTT
TCACCACAGTATCCAAATCATTTAATTTCCTTTTCATCAAACGGTCTTTC
TTAGTCACAGTTAACCGCCTGAAATTATCTTCTTCAAACCGTTGtcgttc
ttcttctttcttttgtagCTTAGCACGCATATTACCATTTCTCCCTGACC
TGATTTCCTCAGGTGCCTCACTATACTCATTCCTCAAATCTTGCAATAAA
GCATTATTCAAAGATTTTTGACGTgctttttccattttctttttctgttt
atcttcttcttcatcataAGGAACAGCAGTAACACGTGGTGGAACATAAA
CTTCATCTTTCTTGTGCCCATCTTCCTCTTCGGAGCCTTCACTATCTTCC
TCATCCTTGTTCACCAAATTATTCAAATTAGGTTTAAAGCTCAATGGATT
AGCTTGTCCTTCAACAGCTTCTGATGCCATTTTAATCAATTTATCAACTT
GGTACGACAACTTTTTATTGATTGGTCGTATCTTTTCCAAAACAGTTCGT
ATTTCAACTAACCTATCAATACATGGTTGTTCAACTAAACTTTTACCATT
GATTTTCAAGATCATTGTGAAAGTTAAATTGATCAGATAAtccaaaacga
gatgaaatttcaTTTCCAAGAAGCTTAATCCATCATTTCTATCTTCCTCA
CTTGTAGATATTTTCTCCATTAATCCTTTGATATGAGCGTCTGAATCCTT
CGTTATGGTTTTCAAAGAATTCATAGCTGATAAAAACAATGGGATgtctt
ttgctatattttccTCTGACATTTTTATAACTTTTGCTATAATATAATGG
AAAATGAAACTGGTATTATTTcatagaaaaaataattaga
Run BLAST on NCBI

protein sequence of TCONS_00001520-protein

>TCONS_00001520-protein ID=TCONS_00001520-protein|Name=TCONS_00001520-protein|organism=Clytia hemisphaerica|type=polypeptide|length=308bp
MSEENIAKDIPLFLSAMNSLKTITKDSDAHIKGLMEKISTSEEDRNDGLS
FLEMKFHLVLDYLINLTFTMILKINGKSLVEQPCIDRLVEIRTVLEKIRP
INKKLSYQVDKLIKMASEAVEGQANPLSFKPNLNNLVNKDEEDSEGSEEE
DGHKKDEVYVPPRVTAVPYDEEEDKQKKKMEKARQKSLNNALLQDLRNEY
SEAPEEIRSGRNGNMRAKLQKKEEERQRFEEDNFRRLTVTKKDRLMKRKL
NDLDTVVKLDSFHGAGDDDSDSDMGDDRYNPKKKKGKGKKDKFKKKISGG
SSGKKRRR
Run BLAST on NCBI

transcript from alignment at sc0000010:19818..20907

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001520 ID=TCONS_00001520|Name=TCONS_00001520|organism=Clytia hemisphaerica|type=transcript|length=1090bp|location=Sequence derived from alignment at sc0000010:19818..20907 (Clytia hemisphaerica)
tctaattattttttctatgAAATAATACCAGTTTCATTTTCCATTATATT ATAGCAAAAGTTATAAAAATGTCAGAggaaaatatagcaaaagacATCCC ATTGTTTTTATCAGCTATGAATTCTTTGAAAACCATAACGAAGGATTCAG ACGCTCATATCAAAGGATTAATGGAGAAAATATCTACAAGTGAGGAAGAT AGAAATGATGGATTAAGCTTCTTGGAAAtgaaatttcatctcgttttgga TTATCTGATCAATTTAACTTTCACAATGATCTTGAAAATCAATGGTAAAA GTTTAGTTGAACAACCATGTATTGATAGGTTAGTTGAAATACGAACTGTT TTGGAAAAGATACGACCAATCAATAAAAAGTTGTCGTACCAAGTTGATAA ATTGATTAAAATGGCATCAGAAGCTGTTGAAGGACAAGCTAATCCATTGA GCTTTAAACCTAATTTGAATAATTTGGTGAACAAGGATGAGGAAGATAGT GAAGGCTCCGAAGAGGAAGATGGGCACAAGAAAGATGAAGTTTATGTTCC ACCACGTGTTACTGCTGTTCCTtatgatgaagaagaagataaacagaaaa agaaaatggaaaaagcACGTCAAAAATCTTTGAATAATGCTTTATTGCAA GATTTGAGGAATGAGTATAGTGAGGCACCTGAGGAAATCAGGTCAGGGAG AAATGGTAATATGCGTGCTAAGctacaaaagaaagaagaagaacgaCAAC GGTTTGAAGAAGATAATTTCAGGCGGTTAACTGTGACTAAGAAAGACCGT TTGATGAAAAGGAAATTAAATGATTTGGATACTGTGGTGAAACTGGATTC ATTCCACGGTGCTGGTGATGATGACAGTGATAGTGATATGGGTGATGACC GGTATAATCCAAAGAAGAAGAAAGGTAAAGGTAAAAAAGATAAATTCAAG AAGAAAATCTCTGGTGGAAGTAGTGGTAAGAAAAGAAGAAGATAGTAGAA TATTGgaaatttattattttcatgattttttaatgaaaatagaaatatat aATGCTGCTGACCCtagtttcttgttttgttttgggtgTT

Coding sequence (CDS) from alignment at sc0000010:19818..20907

>TCONS_00001520 ID=TCONS_00001520|Name=TCONS_00001520|organism=Clytia hemisphaerica|type=CDS|length=927bp|location=Sequence derived from alignment at sc0000010:19818..20907 (Clytia hemisphaerica)
ATGTCAGAggaaaatatagcaaaagacATCCCATTGTTTTTATCAGCTAT
GAATTCTTTGAAAACCATAACGAAGGATTCAGACGCTCATATCAAAGGAT
TAATGGAGAAAATATCTACAAGTGAGGAAGATAGAAATGATGGATTAAGC
TTCTTGGAAAtgaaatttcatctcgttttggaTTATCTGATCAATTTAAC
TTTCACAATGATCTTGAAAATCAATGGTAAAAGTTTAGTTGAACAACCAT
GTATTGATAGGTTAGTTGAAATACGAACTGTTTTGGAAAAGATACGACCA
ATCAATAAAAAGTTGTCGTACCAAGTTGATAAATTGATTAAAATGGCATC
AGAAGCTGTTGAAGGACAAGCTAATCCATTGAGCTTTAAACCTAATTTGA
ATAATTTGGTGAACAAGGATGAGGAAGATAGTGAAGGCTCCGAAGAGGAA
GATGGGCACAAGAAAGATGAAGTTTATGTTCCACCACGTGTTACTGCTGT
TCCTtatgatgaagaagaagataaacagaaaaagaaaatggaaaaagcAC
GTCAAAAATCTTTGAATAATGCTTTATTGCAAGATTTGAGGAATGAGTAT
AGTGAGGCACCTGAGGAAATCAGGTCAGGGAGAAATGGTAATATGCGTGC
TAAGctacaaaagaaagaagaagaacgaCAACGGTTTGAAGAAGATAATT
TCAGGCGGTTAACTGTGACTAAGAAAGACCGTTTGATGAAAAGGAAATTA
AATGATTTGGATACTGTGGTGAAACTGGATTCATTCCACGGTGCTGGTGA
TGATGACAGTGATAGTGATATGGGTGATGACCGGTATAATCCAAAGAAGA
AGAAAGGTAAAGGTAAAAAAGATAAATTCAAGAAGAAAATCTCTGGTGGA
AGTAGTGGTAAGAAAAGAAGAAGATAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000779XLOC_000779Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001520-proteinTCONS_00001520-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001520-exon-sc0000010-1491911889:19818..20907TCONS_00001520-exon-sc0000010-1491911889:19818..20907Clytia hemisphaericaexon
TCONS_00001520-exon-sc0000010-1510915933:19818..20907TCONS_00001520-exon-sc0000010-1510915933:19818..20907Clytia hemisphaericaexon
TCONS_00001520-exon-sc0000010-1575043694:19818..20907TCONS_00001520-exon-sc0000010-1575043694:19818..20907Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000010supercontigsc0000010:19818..20907 .
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
31.7729 29.5306 19.7885 18.3786 41.1641 30.1252 35.7753 30.8266 26.5708 26.4811 28.8855 20.7047 21.1312 25.5885 21.7004 26.5761 21.4938 21.7206 10.6591 8.10794 26.7485 21.7639 46.5882 41.264 34.5455 28.9789 12.3688 13.8486 30.6617 36.3398
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR007146Sas10/Utp3/C1D
Blast
BLAST of TCONS_00001520 vs. Swiss-Prot (Human)
Match: NGDN (Neuroguidin OS=Homo sapiens GN=NGDN PE=1 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 3.296e-31
Identity = 80/219 (36.53%), Postives = 140/219 (63.93%), Query Frame = -3
Query:  378 DIPLFLSAMNSLKTITKDSDAHIKGLMEKISTSEEDRNDGLSFLEMKFHLVLDYLINLTFTMILKINGKSLVEQPCIDRLVEIRTVLEKIRPINKKLSYQVDKLIKMASEAVEGQANPLSFKPNLNNLVNX-----------XXXXXXXXXXXXXXXXXEVYVPPRVTAVPY-XXXXXXXXXXXXKARQKSLNNALLQDLRNEYSEAPEEIRSGRNGNM 998
            D+P  ++ + +L+       A +K L +K+         GLSFLE+K  L+L YL++LT  ++ K +G SL     + RLVEIRTVLEK+RP+++KL YQ+DKLIK A      + +PL FKP+ +N+++K           +++ SE S ++      + YVPPR+  V Y + E +++KK++E+A++++L+++++++L+ +YS+APEEIR  R+ ++
Sbjct:   10 DLPSAVTLLKNLQEQVMAVTAQVKSLTQKVQAGAYPTEKGLSFLEVKDQLLLMYLMDLTHLILDKASGGSLQGHDAVLRLVEIRTVLEKLRPLDQKLKYQIDKLIKTAVTGSLSENDPLRFKPHPSNMMSKLSSEDEEEDEAEDDQSEASGKKSVKGVSKKYVPPRLVPVHYDETEAEREKKRLERAKRRALSSSVIRELKEQYSDAPEEIRDARHPHV 228          
The following BLAST results are available for this feature:
BLAST of TCONS_00001520 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
NGDN3.296e-3136.53Neuroguidin OS=Homo sapiens GN=NGDN PE=1 SV=1[more]
back to top