Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001516 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001516
Unique NameTCONS_00001516
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1889

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001516 ID=TCONS_00001516|Name=TCONS_00001516|organism=Clytia hemisphaerica|type=transcript|length=1889bp
TTTTGAACGATCAGTTTTGAGAATAAACATTGACTGGGTTTGTCTCACCA
GATAATTTTCCAGATTCGCGAAGAAGTTTACAATGTCTGGCAACGAAACT
CTGTATTCGAGCAAAGAGAAGATAACAAGTCCAGTGAACAGCCTTTTACT
TCAACAACAGCAATGTTACCAGAAAGATGCTGGAGATGATGAAGAATCAA
CTCTGGAGAAAAATGAGCACAGTGAAGCAAATGAAAGCTCTTTGAGCTGG
GATCATCTCCATAAGGTCTTTGATCAAGGATCTGAAAAAATGAAGCATTT
GTTCGGGGAAACGGTAAACTCtctaaaagaaaaatacaataaaaccaAGT
CGAAATTAAAGCCTCGGAAAGATGCAGAAATCCCGGAGACTGATGCAGAG
GGAAATAAGAAACAGAAAGATATTCCATTGCTACAAAAGATGAAAGAGAA
ACTATCGAAACAAACACCAAAAGAATCAAAACCACGTATCTTCGTCACCA
GATCATCCAAAGAATTTGCTCAAATCCAGATCCAAGAACAGTTTGCAAAT
CTGAAGACAACCTCACAATACATTATACCTTTGTTGGGACCCTGTATCGT
TGCATTACCATATGCATTGAAACAATCTGGTTTGATTCTTGGAGTATTGC
TGATATTCTTAATCTCAATGTCCATGGACTATGCTGAATGTTTGATGAAG
CAATGTATGTCATCAACCATTGATAAACAAAACAATATTGCAATGCTTGG
CAAACAATTTTTCGGACGTTTTGGATACTTCGTCTACTTTGGAGCACCTT
ATTTACTTCATTTCTGTATCCTCTTCGCTTATTTGATCATCCTTGATTAA
AAGTGAGAAGCTGATTTCGAAGATTTCTTCCTTGGCCATTGTTCCAGGTA
CTGTCCTTATGATATTGATTGTTCTCCGAGTGTTCACGCTGGGCGAAAAG
ATTCCACACGTGTCCGAAATCTATCATCCGTTCAAATACCTGGGCACGAA
TATTATCCAATCAATTGCCGTGGTCACTTTCACCTTCATATGTCAACACA
ATATTCGTGCGACTTACATGCAGCCACACGTAACCAACAATTATGACGTC
AGCAAGCCAGTAGATATGGTTGCCTCGTTTACTTTGGTTGTAAACCTTTT
AATCTCAGGTGCAGGATATACCACGTTCAATGTTTTCACACAGGGAAACA
TTCTCGAAAATTATTGTGAGGAAGATTTTATAGCTggtttaactaaaaca
tttttcatgatattcatcATATTTCTATTCCCTATTGAATGTTTTAACAT
TCGTTTGATGACAGATGAGCTAATCATAGTGCATCAcagatttaaaaaca
ttttccatttTGTTGCAACTTTTGTGATTCTATTGCCAATCTTCATTGGT
TCCCTTTTCATAGACTGTCTACCACTTATTCTTGAGATGGCTGGAGTTGT
ATTGGCAATTCCTCTGATCTTCATTCTTCCATCCGTTATTTTCTTAAGAA
GATTCCCTGGAAATGTGTTAGCATCTGATAAGCTGCCATGTTTTCTGTTT
ATGTGTCTGGGAATCACCTTTAGTGTGATTGGTTTAGCCGTAACAATGTC
ATCCAATCATAATTGTATCCATTCGAACAATCTGTTACCGTACTGTAATG
GATCTAGTGAGCTTGTTGGACCACTGATAACATTAATGTCGTTGAATACG
AGTTTTACGGACGACGATATCTTAGCAATGAACACCAACGTGAATATATC
TCGACTTGAACAATACGGGTTTGAAAACCTTACTGATGTTGTGAATGCAT
ATTTAGCTTGagaagaaaaaatatgtttttgttgatgaaaatgtacaatt
ttgataatttgtttttgttttcatcagTTTCTTTATGCA
Run BLAST on NCBI

protein sequence of TCONS_00001516-protein

>TCONS_00001516-protein ID=TCONS_00001516-protein|Name=TCONS_00001516-protein|organism=Clytia hemisphaerica|type=polypeptide|length=300bp
MILIVLRVFTLGEKIPHVSEIYHPFKYLGTNIIQSIAVVTFTFICQHNIR
ATYMQPHVTNNYDVSKPVDMVASFTLVVNLLISGAGYTTFNVFTQGNILE
NYCEEDFIAGLTKTFFMIFIIFLFPIECFNIRLMTDELIIVHHRFKNIFH
FVATFVILLPIFIGSLFIDCLPLILEMAGVVLAIPLIFILPSVIFLRRFP
GNVLASDKLPCFLFMCLGITFSVIGLAVTMSSNHNCIHSNNLLPYCNGSS
ELVGPLITLMSLNTSFTDDDILAMNTNVNISRLEQYGFENLTDVVNAYLA
Run BLAST on NCBI

transcript from alignment at sc0000010:1171439..1173443-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001516 ID=TCONS_00001516|Name=TCONS_00001516|organism=Clytia hemisphaerica|type=transcript|length=2005bp|location=Sequence derived from alignment at sc0000010:1171439..1173443- (Clytia hemisphaerica)
TTTTGAACGATCAGTTTTGAGAATAAACATTGACTGGGTTTGTCTCACCA GATAATTTTCCAGATTCGCGAAGAAGTTTACAATGTCTGGCAACGAAACT CTGTATTCGAGCAAAGAGAAGATAACAAGTCCAGTGAACAGCCTTTTACT TCAACAACAGCAATGTTACCAGAAAGATGCTGGAGATGATGAAGAATCAA CTCTGGAGAAAAATGAGCACAGTGAAGCAAATGAAAGCTCTTTGAGCTGG GATCATCTCCATAAGGTCTTTGATCAAGGATCTGAAAAAATGAAGCATTT GTTCGGGGAAACGGTAAACTCTCTAAAAGAAAAATACAATAAAACCAAGT CGAAATTAAAGCCTCGGAAAGATGCAGAAATCCCGGAGACTGATGCAGAG GGAAATAAGAAACAGAAAGATATTCCATTGCTACAAAAGATGAAAGAGAA ACTATCGAAACAAACACCAAAAGAATCAAAACCACGTATCTTCGTCACCA GATCATCCAAAGAATTTGCTCAAATCCAGATCCAAGAACAGTTTGCAAAT CTGAAGACAACCTCACAATACATTATACCTTTGTTGGGACCCTGTATCGT TGCATTACCATATGCATTGAAACAATCTGGTTTGATTCTTGGAGTATTGC TGATATTCTTAATCTCAATGTCCATGGACTATGCTGAATGTTTGATGAAG CAATGTATGTCATCAACCATTGATAAACAAAACAATATTGCAATGCTTGG CAAACAATTTTTCGGACGTTTTGGATACTTCGTCTACTTTGGAGCACCTT ATTTACTTCATTTCTGTATCCTCTTCGCTTATTTGATCATCCTTGGAGAT GCCAGTACTAAATGTATCAATACCTTTGTATCAATGTTGACCATTGAGTT TGCATTTCATCGCAACATTGTTTTATTGCTTGTTTTCTTATTGGTAATAC TGACATCCTTGATTAAAAGTGAGAAGCTGATTTCGAAGATTTCTTCCTTG GCCATTGTTCCAGGTACTGTCCTTATGATATTGATTGTTCTCCGAGTGTT CACGCTGGGCGAAAAGATTCCACACGTGTCCGAAATCTATCATCCGTTCA AATACCTGGGCACGAATATTATCCAATCAATTGCCGTGGTCACTTTCACC TTCATATGTCAACACAATATTCGTGCGACTTACATGCAGCCACACGTAAC CAACAATTATGACGTCAGCAAGCCAGTAGATATGGTTGCCTCGTTTACTT TGGTTGTAAACCTTTTAATCTCAGGTGCAGGATATACCACGTTCAATGTT TTCACACAGGGAAACATTCTCGAAAATTATTGTGAGGAAGATTTTATAGC TGGTTTAACTAAAACATTTTTCATGATATTCATCATATTTCTATTCCCTA TTGAATGTTTTAACATTCGTTTGATGACAGATGAGCTAATCATAGTGCAT CACAGATTTAAAAACATTTTCCATTTTGTTGCAACTTTTGTGATTCTATT GCCAATCTTCATTGGTTCCCTTTTCATAGACTGTCTACCACTTATTCTTG AGATGGCTGGAGTTGTATTGGCAATTCCTCTGATCTTCATTCTTCCATCC GTTATTTTCTTAAGAAGATTCCCTGGAAATGTGTTAGCATCTGATAAGCT GCCATGTTTTCTGTTTATGTGTCTGGGAATCACCTTTAGTGTGATTGGTT TAGCCGTAACAATGTCATCCAATCATAATTGTATCCATTCGAACAATCTG TTACCGTACTGTAATGGATCTAGTGAGCTTGTTGGACCACTGATAACATT AATGTCGTTGAATACGAGTTTTACGGACGACGATATCTTAGCAATGAACA CCAACGTGAATATATCTCGACTTGAACAATACGGGTTTGAAAACCTTACT GATGTTGTGAATGCATATTTAGCTTGAGAAGAAAAAATATGTTTTTGTTG ATGAAAATGTACAATTTTGATAATTTGTTTTTGTTTTCATCAGTTTCTTT ATGCA

Coding sequence (CDS) from alignment at sc0000010:1171439..1173443-

>TCONS_00001516 ID=TCONS_00001516|Name=TCONS_00001516|organism=Clytia hemisphaerica|type=CDS|length=903bp|location=Sequence derived from alignment at sc0000010:1171439..1173443- (Clytia hemisphaerica)
ATGATATTGATTGTTCTCCGAGTGTTCACGCTGGGCGAAAAGATTCCACA
CGTGTCCGAAATCTATCATCCGTTCAAATACCTGGGCACGAATATTATCC
AATCAATTGCCGTGGTCACTTTCACCTTCATATGTCAACACAATATTCGT
GCGACTTACATGCAGCCACACGTAACCAACAATTATGACGTCAGCAAGCC
AGTAGATATGGTTGCCTCGTTTACTTTGGTTGTAAACCTTTTAATCTCAG
GTGCAGGATATACCACGTTCAATGTTTTCACACAGGGAAACATTCTCGAA
AATTATTGTGAGGAAGATTTTATAGCTGGTTTAACTAAAACATTTTTCAT
GATATTCATCATATTTCTATTCCCTATTGAATGTTTTAACATTCGTTTGA
TGACAGATGAGCTAATCATAGTGCATCACAGATTTAAAAACATTTTCCAT
TTTGTTGCAACTTTTGTGATTCTATTGCCAATCTTCATTGGTTCCCTTTT
CATAGACTGTCTACCACTTATTCTTGAGATGGCTGGAGTTGTATTGGCAA
TTCCTCTGATCTTCATTCTTCCATCCGTTATTTTCTTAAGAAGATTCCCT
GGAAATGTGTTAGCATCTGATAAGCTGCCATGTTTTCTGTTTATGTGTCT
GGGAATCACCTTTAGTGTGATTGGTTTAGCCGTAACAATGTCATCCAATC
ATAATTGTATCCATTCGAACAATCTGTTACCGTACTGTAATGGATCTAGT
GAGCTTGTTGGACCACTGATAACATTAATGTCGTTGAATACGAGTTTTAC
GGACGACGATATCTTAGCAATGAACACCAACGTGAATATATCTCGACTTG
AACAATACGGGTTTGAAAACCTTACTGATGTTGTGAATGCATATTTAGCT
TGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000775XLOC_000775Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001516-proteinTCONS_00001516-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001516-exon-sc0000010-1575043694:1172606..1173443TCONS_00001516-exon-sc0000010-1575043694:1172606..1173443Clytia hemisphaericaexon
TCONS_00001516-exon-sc0000010-1575043694:1171439..1172489TCONS_00001516-exon-sc0000010-1575043694:1171439..1172489Clytia hemisphaericaexon
TCONS_00001516-exon-sc0000010-1510915933:1172606..1173443TCONS_00001516-exon-sc0000010-1510915933:1172606..1173443Clytia hemisphaericaexon
TCONS_00001516-exon-sc0000010-1510915933:1171439..1172489TCONS_00001516-exon-sc0000010-1510915933:1171439..1172489Clytia hemisphaericaexon
TCONS_00001516-exon-sc0000010-1491911889:1172606..1173443TCONS_00001516-exon-sc0000010-1491911889:1172606..1173443Clytia hemisphaericaexon
TCONS_00001516-exon-sc0000010-1491911889:1171439..1172489TCONS_00001516-exon-sc0000010-1491911889:1171439..1172489Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000010supercontigsc0000010:1171439..1173443 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 0 0 0.313262 0.180032 0.950255 0.813364 0.569455 0.242468 0.727432 0.520378 1.0674 0.656351 1.07922 2.27773 1.72797 1.93361 0 0 0.939219 0.6573 1.04117 1.03462 0.861579 1.21411 0.318522 0.0618065 0.023439 0.0238806
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR013057AA_transpt_TM
Blast
BLAST of TCONS_00001516 vs. Swiss-Prot (Human)
Match: S38AB (Putative sodium-coupled neutral amino acid transporter 11 OS=Homo sapiens GN=SLC38A11 PE=2 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 2.602e-25
Identity = 71/249 (28.51%), Postives = 127/249 (51.00%), Query Frame = 3
Query:  900 TVLMILIVLRVFTLGEKIPHVSEIYHPFKYLGTNIIQSIAVVTFTFICQHNIRATYMQPHVTNNYDVSKPVDMVASFTLVVNLLISGAGYTTFNVFTQGNILENYCEEDFIAGLTKTXXXXXXXXXXXXECFNIRLMTDELIIVHHRFKNIFHFVATFVILLPIFIGSLFIDCLPLILEMAGVVLAIPLIFILPSVIFLRRFPGNVLASDKLPCFLFMCLGITFSVIGLAVTMSSNHNCIHSNNLLPYC 1646
            T+++ +++ R  +LG   PH+ +    + +   N IQ++ V++F FIC HN    Y           S+ + M    ++ + +  +  GY TF  FTQG++ ENYC  D +    +  + + +I  +P+ECF  R +    +       ++FH V T +++    + SL IDCL ++LE+ GV+ A PLIFI+PS  +L+        SDK+   + + +G    V G  + +++  +C H   +  YC
Sbjct:  133 TLILGIVMARAISLG---PHIPKTEDAWVFAKPNAIQAVGVMSFAFICHHNSFLVYSSLEEPTVAKWSRLIHMSIVISVFICIFFATCGYLTFTGFTQGDLFENYCRNDDLVTFGRFCYGVTVILTYPMECFVTREVIAN-VFFGGNLSSVFHIVVTVMVITVATLVSLLIDCLGIVLELNGVLCATPLIFIIPSACYLKLSEEPRTHSDKIMSCVMLPIGAVVMVFGFVMAITNTQDCTHGQEMF-YC 376          
The following BLAST results are available for this feature:
BLAST of TCONS_00001516 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
S38AB2.602e-2528.51Putative sodium-coupled neutral amino acid transpo... [more]
back to top