Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001516-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001516-protein
Unique NameTCONS_00001516-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length300

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001516-protein ID=TCONS_00001516-protein|Name=TCONS_00001516-protein|organism=Clytia hemisphaerica|type=polypeptide|length=300bp
MILIVLRVFTLGEKIPHVSEIYHPFKYLGTNIIQSIAVVTFTFICQHNIR
ATYMQPHVTNNYDVSKPVDMVASFTLVVNLLISGAGYTTFNVFTQGNILE
NYCEEDFIAGLTKTFFMIFIIFLFPIECFNIRLMTDELIIVHHRFKNIFH
FVATFVILLPIFIGSLFIDCLPLILEMAGVVLAIPLIFILPSVIFLRRFP
GNVLASDKLPCFLFMCLGITFSVIGLAVTMSSNHNCIHSNNLLPYCNGSS
ELVGPLITLMSLNTSFTDDDILAMNTNVNISRLEQYGFENLTDVVNAYLA
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000775XLOC_000775Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001516TCONS_00001516Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR013057AA_transpt_TM
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013057Amino acid transporter, transmembrane domainPFAMPF01490Aa_transcoord: 30..230
e-value: 3.8E-15
score: 55.4

Blast
BLAST of TCONS_00001516-protein vs. Swiss-Prot (Human)
Match: S38AB (Putative sodium-coupled neutral amino acid transporter 11 OS=Homo sapiens GN=SLC38A11 PE=2 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 5.060e-30
Identity = 70/244 (28.69%), Postives = 123/244 (50.41%), Query Frame = 0
Query:    3 LIVLRVFTLGEKIPHVSEIYHPFKYLGTNIIQSIAVVTFTFICQHNIRATYMQPHVTNNYDVSKPVDMVASFTLVVNLLISGAGYTTFNVFTQGNILENYCEEDFIAGLTKTFFMIFIIFLFPIECFNIRLMTDELIIVHHRFKNIFHFVATFVILLPIFIGSLFIDCLPLILEMAGVVLAIPLIFILPSVIFLRRFPGNVLASDKLPCFLFMCLGITFSVIGLAVTMSSNHNCIHSNNLLPYC 246
            +++ R  +LG   PH+ +    + +   N IQ++ V++F FIC HN    Y           S+ + M    ++ + +  +  GY TF  FTQG++ ENYC  D +    +  + + +I  +P+ECF  R +    +       ++FH V T +++    + SL IDCL ++LE+ GV+ A PLIFI+PS  +L+        SDK+   + + +G    V G  + +++  +C H   +  YC
Sbjct:  138 IVMARAISLG---PHIPKTEDAWVFAKPNAIQAVGVMSFAFICHHNSFLVYSSLEEPTVAKWSRLIHMSIVISVFICIFFATCGYLTFTGFTQGDLFENYCRNDDLVTFGRFCYGVTVILTYPMECFVTREVIAN-VFFGGNLSSVFHIVVTVMVITVATLVSLLIDCLGIVLELNGVLCATPLIFIIPSACYLKLSEEPRTHSDKIMSCVMLPIGAVVMVFGFVMAITNTQDCTHGQEMF-YC 376          
The following BLAST results are available for this feature:
BLAST of TCONS_00001516-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
S38AB5.060e-3028.69Putative sodium-coupled neutral amino acid transpo... [more]
back to top