Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001515 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001515
Unique NameTCONS_00001515
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2607

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001515 ID=TCONS_00001515|Name=TCONS_00001515|organism=Clytia hemisphaerica|type=transcript|length=2607bp
aaaacactagacaGAGCTACTCCGTCCCTGctgttccttgggaaatacag
agtagctctatctagtactttatataagatatctatggTAAACATGCTTT
CTCTCTATTTTTACCAAACACAATAGCTCAATTTAGCTAATCTTTTGTTA
TGATAAAACCTAAAAAGGAATATGTAATGTTTGATAATAGGAGGGTGAAG
GTGCAGCTAACTTTGTTGTTGAGTTGTCATTGAAAACAGAAGGAGTGGTT
TGCCGATTTAAACGTTACAATCCAATCTTtccaacaaatttttatttgtg
gAACCATAACCAAAAAATTACAAGATGCAAAAGGCCAAGAAATATGACTG
GAAAGATTCCAACATGGCCCTCTTTGGGTCTGATACTGAGAAGAAAGTGA
AGAAAGAATCAGCAGAAAGTGAGCCTGCATGGAAAGGAGCTGGTGAAAAA
GTTGGTGTTCAAGTTTGGAGAATTGTCAAATTCAAGGTCACCCACTGGGA
CAAAGAACAATATGGTGAATTTTTTAATGGAGATTCTTATATTATTTTGa
atacttacaaaaataaagaCAGCGATGAACTCCTTCATGACCTTCACTTC
TGGATCGGAAAATACTCCACTCAAGATGAATACGGTACAGCAGCTTACAA
AACTGTTGAATTGGACACCTTTTTGGATGATAAACCAATACAACATCGTG
AAGTTCAAGGACATGAATCATCAaagtttaaaagctatttttcaAcatTT
ACCTTATTGAAAGGAGGAGCAGACACAGGATTCAACagagttttaccaga
aaactatCCCAGCAGATTGTTCCATGTGAAAAAGGTTTCACGAACCAAAA
TCACTTGTACTGAAGTCAGTTTaaagaaaggaaatttgaaatctGAAGAT
GTCTTCATCATTGATGCTGGAAACAAAATCTACCAATGGAACGGTAGCGA
ATGTAGTCACGACGAGAAGTTCAAAGCAGCACAAGAAGTTGCTCGCATCA
AAGGAAAGCGTGGCAAGTGTCGTGTTGATAACCTTGATGAAGGATCCATC
TCAGAAGAACATCCAGCTATCATGATGTTGAAAGATGGAGAATCAAAACC
TaaagGAGAAGCTGCAAAGGGAGAACGAAAAATGTTCAGAGTAAGTGATG
CTGATGGCAGTTTGGATATGGATGAGATCGATGGAGACATTTCCAAGAGC
AACCTCACCTCTGATGATGTCTACATCATTAATACTGGAGACCATGTTTA
TTGTTGGGTCGGCAAAGGAGCCAGCGTTGACGAACGAAGAAATGGATTGT
CATATGCTTCCAATTATTTGAACAAGACAGAAACTCCTTACCTACCCATC
TCAGTGGTGGCAGAGGGAAAAGAAAACGCCGAATTCAACGCTGCTTTCTA
GATGCATTGACCACTTGGATTTAAGGTGATAAGCACCATCGATTCAAAAT
GGCTGCTCTTCAAACCACCAACCTATAAGGTTGATTTCGACAAAACGTCT
ACATAATTTATTCGTCATTTTCGTCCAATTAGAAATCAcgttttaagaat
tttcaacgCATAGTATTTTTTAGGGGgaatatcattttttttaattttga
tttacttttttaacatgttaattatttttacacatttcatttatttactt
ttccaGTGCATACATTTTGGTTTCCACAAAATTACAACCTGAAAATAGat
ttcgtaaaatttctttttgtctcTCTCTAGAATTTTGAACCAGTTTCGAT
CGCATATTAGCGTATTTTTGTACAGTACAAATGTatatttttcgttattt
ttgtcatcatttaatttcaaaatttttagtttaGCCTTCTATATTGGAAA
TCtgataaaaaaagtcaaaatattataCATACAGGGTTTGCAATGTATTT
TTACAACGATAATAtgtatcaaaaaaagaaatattcagtATCTAGAAATA
GAATAATTCCACAGTACATAGTTGTTACCTTTTCTTCCTTCcctttatta
aaagaaaatttatcaaaaaaattgccttgttcaaaaataccaaaacacGT
TCCCTTTGATATTCCTAATTTCatacacctccttctcacagacccactgg
gaacccttcctactggaaaaatttaccaaaatatcgtccccggtgggaaa
ttatACTCAGACTTTTTTCGCCacagaaaataatcaaataaaacaatcct
cactgcaaaatatttactattttcccatccccactgaattttctgactag
aaaacaaaagaattgaaatccccagccatagaaAATATGTATCGATCTCC
ATCGAGTTTCATCCTCTACTCCGTTATTTTCATCATcactaactgaaaaa
aaatcctacAGGGAAGGGGGTGTTTTCATTCTTTCATACATCTGGAATAC
TGTTGACCATCTTCTTTAagtcgaaagcatccaccgaaggggaACTTGTT
CTACTGaaattgggaccagctggaaaaatatggtctgttctactcAAGAT
Tgggggaccagctggaaaaatatgatctgttctactgaagattgggacca
gctggaaaaatatgatctattcttatgaaaaaatagtttgatatccaaaa
aataagg
Run BLAST on NCBI

protein sequence of TCONS_00001515-protein

>TCONS_00001515-protein ID=TCONS_00001515-protein|Name=TCONS_00001515-protein|organism=Clytia hemisphaerica|type=polypeptide|length=358bp
MQKAKKYDWKDSNMALFGSDTEKKVKKESAESEPAWKGAGEKVGVQVWRI
VKFKVTHWDKEQYGEFFNGDSYIILNTYKNKDSDELLHDLHFWIGKYSTQ
DEYGTAAYKTVELDTFLDDKPIQHREVQGHESSKFKSYFSTFTLLKGGAD
TGFNRVLPENYPSRLFHVKKVSRTKITCTEVSLKKGNLKSEDVFIIDAGN
KIYQWNGSECSHDEKFKAAQEVARIKGKRGKCRVDNLDEGSISEEHPAIM
MLKDGESKPKGEAAKGERKMFRVSDADGSLDMDEIDGDISKSNLTSDDVY
IINTGDHVYCWVGKGASVDERRNGLSYASNYLNKTETPYLPISVVAEGKE
NAEFNAAF
Run BLAST on NCBI

transcript from alignment at sc0000010:1148555..1157763-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001515 ID=TCONS_00001515|Name=TCONS_00001515|organism=Clytia hemisphaerica|type=transcript|length=9209bp|location=Sequence derived from alignment at sc0000010:1148555..1157763- (Clytia hemisphaerica)
AAAACACTAGACAGAGCTACTCCGTCCCTGCTGTTCCTTGGGAAATACAG AGTAGCTCTATCTAGTACTTTATATAAGATATCTATGGTAAACATGCTTT CTCTCTATTTTTACCAAACACAATAGCTCAATTTAGCTAATCTTTTGTTA TGATAAAACCTAAAAAGGAATATGTAATGTTTGATAATAGGAGGGTGAAG GTGCAGCTAACTTTGTTGTTGAGTTGTCATTGAAAACAGAAGGAGTGGTT TGCCGATTTAAACGTTACAATCCAATCTTTCCAACAAATTTTTATTTGTG GAACCATAACCAAAAAATTACAAGATGCAAAAGGCCAAGAAATATGACTG GAAAGATTCCAACATGGCCCTCTTTGGGTCTGATACTGAGAAGAAAGTAA GTTAATTCATTATGAGCTTATCTCCAAAACCTTTTTATCACATCTTTAAA AAGTTAAGGTGTCTAGTTTTACTCTTAGCTAATATGGTTGATAATAAAAG ATTTTAAAGAATTTCCACTTTTTTTATTGTATTAGTTCTCAGTGTGAAAC AAGGCTTAAAATAAAGCCTTTTTTATTTAATGCTGCTGTTAGGTCTTCTT CTAACCAAAGAATTACAATAATTAATTAGATTAAGTCCTTGTATTTTTGA CACTGATTAAATGATGAAATGTGCTACAACAAAAAGAATGGCTGCATTAA GAATCAACATGTTCAATTTATACATACAACATTTTGGTTTGATGCAGTGT GTCTTTATCTTCTGGTTCTGGTCATCATGATATATAAAAATTTTCCAAAA AAATAGGCAATTCAAAATGGGCTTTTATATTCAACCTTTTAACTTTACAG GAGTAATTGATGAAATTTTCCTTGGGGTCAAATCTTCTTTCAAGGGAATT TTGTTCATTTTTCAGATTCTCTAATCAGGTCATTACCGTCAACTGCTCTA ACTTGGCAGTTACATCAATATGCCTTCTTACCTTTCTTTAAAAATATAAA TAAAAGCAATCACAGAAAAGGACGCGAAAAAAAAGACATAAGTGTGAGAA CAGAGTAATCAAACTCGTTAGAAAAAGTACCATTAGAAGTCATAAAAAAT CAACCTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATTATTGAAAGT TTGTCTCAGCCTTTTTATAATGAGCGAGACATACGTTCTCTGATTACGCA ATTTTCATATTGACATTTTCGAGGCATTTTGATGTAACTGCTTGGGACGA TTGGATTGGTTGAAACATGGGATTGTTGATATCTGGCCTGTATTTTCACT TACTGTTAAATCTCTTTGACAACAAATTTGTTTTGATAACTCCACCAAGT TTATCAATCATACTTCTTCGTTCCTCTTAGAGTGCACAGACACACACAGA TTTTTTTCATGTTTTGATTTAAAAGCCTACTCGGTGCGAAAGAGAAATTG TGTGAAATTGCCGTTCATTAACTCAAATCAAATGACTTTGGAGGTTCGGT GAAATGGTGGCCGAATTGCTGTCCCATGTTTTGTCAGGTAGTCCCAAGTA AGAGCAGTTGACGGTATAACATGTCACAATAACTTTCACTGCGCGCCCTT TTTAACTTCTTTGTTTTCATTCAAAATGACCGGACGCAGATTGGAGAATT AAGAACGCCCGCCGTCTAATTGCCTATCGTCCGATGGGATTAACAAATAA CGAGTGTGTAACTTGCCGCGCGAGTGACGTCAAATGCTCCATCGTGTTCC ACTATAGATTTTTTTCATATTTCGATTTAAAAGCCTACTGTACTCGGTGC AAATTCATTAACTCAAATCAAATGATTTTGGAGGATCGGTGAAATTTACT TTTGAAAATCTTCAGGATTTCCGTAAGAATCTTTAAGGAAAAATCTTGGA ATTTGTGAAATAGAAAATAGAGCAAATTTTATGGATTTTAAGATATGGAT GACCAAATAATTATTTTCCGGAACCTTCATATCACAATTACTCAGGATTT CTAAGAAAAGAAAATTCCAAAAAACAGCGTCGCTCACAGGTAATGGTTTT TTTCTGGAACTGCCCATTACACTAGGTAAGAAAACTTTCCAATTTCTTCA GATATACAAAAATTTGCACTATCCAAACAATACAAATTGATAAATATTCT AATACAATAATGCCAAATGCAAATTTCCAAGAAAATTATTAAAACGTGAT AAAGGGCATAATTCCAGGCATAATTATTCAAAATTTTCAAGGAGTTGTAA AAACGTACGTCAATAAATACCTGTGTAAAAACTTTCCTTCAAACAATTTG ATGGTATAAATTTTTGCAGAGATCAAATTCCACTAATTTTCCAAATGCGC TAGAATCGCTCGCAAACAATTGGCAAAAAGTCTGGCGAATTTACCAACTC TCTGACTCTATTTTACTCAATTTTCATGAGTCGGCCGGGCGAGGCAAAAT GATTATTTTTTTGATTGCCACCTTACTGCCAAACCATAGCTGTCAACTCT CTGGGGGCTTGGGCAAAATGGGTGTCAGGTATGTGTGAGTCATAAAGGTC CCTTTAAACCCTCAAAAGTCTCTCAAAGGGGTACAAAAGACAATAAGTTG GCATTGATTCTCTGAAAGGGTCCCAAAATTACGAAATATCAAGAATCAAC TCCCTCAAAGGGTCATAAAATCTGGTAATTTTGAGCTTAAAATTGGGAAA ATAGTTTCTCAAAGGGTTGCAAAAACGTCTAAATTCAGTCAATTCTCAAA CTTTAGCTCAGACATCCCTGTCACCTTGCAAGCTAGTACTTACCTGAGCA ATTCTCCCACATAGACCTTTTGATAAGCGCAATACTATTTTGACTCCAGT GGTGAAAATATTAATGACTCCACACAATAGCCTGATATTAGATCAATTTC CACATGTTTAATATTTATCATACTGTGGTATATAACTATTAACTAATAGA CAGGCAGCTGATGCCATCTGAAATTTGGATGACTTTGGTACAAATTCTGT GTTGGTTTCTCTTATTCCCATATATTTACTGATCCTAAAAATTTTACTCG GTGTCCCAAAAGAATTTTGGTCAATAATGACCCTCTAACCCACAGTAACC CCCTGAAAATGTCAACTTTTAACGTCACACAGCAGAAAAAAATCCATCCT ACGATTGTTCTTTGAATTAGTTTTTGAGGTTTGGCTTGGGTCAAGATTTT TAAACATGATGACCAACTGACTAGGAAATCAATGTTAGAAAAAAATGTGC TATGTGTAGTGACACATGAGCTCAAATGTTAGCTGTTAGGTTGATACTGG CATTTTTGTAACTAACTGGCTCTTATGGTTTATATTTTTGTTTTTATTAA CAGGTGAAGAAAGAATNAATGTTAGCTGTTAGGTTGATACTGGCATTTTT GTAACTAACTGGCTCTTATGGTTTATATTTTTGTTTTATCAACAGGTGAA GAAAGAATCAGCAGAAAGTGAGCCTGCATGGAAAGGAGCTGGTGAAAAAG TTGGTGTTCAAGTTTGGAGAATTGTCAAATTCAAGGTAAGGAGTGAACTC TATAAAGTTATTTATTCTAAAATGATCGGAATTGGCCCCAATCCTAATTC TAAACATAAAAAAATCATTTAGTTTTTTAAAATGTTATTATAATGTTCCT GAAATCAATTATTGATTACTTTTATTGGATTATATTAAAAATGTTCTGTG ACAAATGAATTTTTAATTTCTCACAAGGTTTGATTAATTTTTCTTCCGAC AGGTCACCCACTGGGACAAAGAACAATATGGTGAATTTTTTAATGGAGAT TCTTATATTATTTTGAATACTTACAAAAATAAAGACAGCGATGAACTCCT TCATGACCTTCACTTCTGGATCGGAAAATACTCCACTCAAGATGAATACG GTACAGCAGCTTACAAAACTGTTGAATTGGACACCTTTTTGGATGATAAA CCAATACAACATCGTGAAGTTCAAGGACATGAATCATCAAAGTTTAAAAG CTATTTTTCAAGTAAGTGACAAAGTATGTTTTGACTTTCAATTATGTTTA AAGGTAGTTTAAGGGAAGTTAGTGGGACACCTCTCTTTTGAAAATGTGTC ATATTTTTCTGGGTGATTGGATATCCCTATACCATACTATATAATCCAAA CCACATTCTAAAGCGTCAATTCTTCTTCTCCTCTTTCTAAATAAATCACC ATTTAGGAAGGAGGAACATATTATCTATTTCTATCAACTCTTTTTACCAT TTTTCATTTTAAACTTAACTTTTTTTTTCAGCATTTACCTTATTGAAAGG AGGAGCAGACACAGGATTCAACAGAGTTTTACCAGAAAACTATCCCAGCA GATTGTTCCATGTGAAAAAGGTTTCACGAACCAAAATCACTTGTACTGAA GTCAGTTTAAAGAAAGGAAATTTGAAATCTGAAGATGTCTTCATCATTGA TGCTGGAAACAAAATCTACCAAGTAAGGATCTGTAGATGAACCCTCCCGT ATTCTGCAAAATCAAATGTAATTTTCGAAAGGAAAAATCAGACCCGATTA GTGTTTTAATCATTTAAAGTACTTTTACTTATAAAGTTATAAATATTGAG TATTGAGAGAAGAGGTCAGCTGCTGATTGTACGAAAAAAAGAAATCAGAG CAGGGTACTCGATGTAACTCCTCACAAAGGGTATGTAAGGGTCGATCTGA TATCTCACTTTGTCTATAAGGGTGTCAAAAATTAAAAAAATGTTTTCCTT TGAGCAAGACTCAATCAAATTTGACTATAATTTCTCTGCACTTTAATGGT CCAATTTCTACGTTTGTCCGTGCATTATGTGGCGCTTTTTTTTAAATCAA GTGCCCGCCGAGTTCAGGAAGTATTTTGTTTCTTGCATCGTAAAAAAAAA AACAATATGAAACTTATTTTTTTAGTGGAACGGTAGCGAATGTAGTCACG ACGAGAAGTTCAAAGCAGCACAAGAAGTTGCTCGCATCAAAGGAAAGCGT GGCAAGTGTCGTGTTGATAACCTTGATGAAGGATCCATCTCAGAAGAACA TCCAGCTATCATGATGTTGAAAGATGGAGAATCAAAACCTGTAAGTAATC TTTTTTACCTTCAGATGAGATGGAGTTTTTACAAGTGACTTCACTAATTG GTTATTTGAAGTAACGAAAATGACGCGTTCTTTAGAAAAAGTAACAAAAT TGTATTATTACTGGTTAACGACCAACCAATTCAAAGAGAGCTTGTAAAAA ACTCAATCTCGTCCCTTTACCTTACGTTAAGAGAAGAAACTTTGGCGAAT TGGCGCAATTCGCTAGTTTTCGTTTAATTTGGTGGAATTTATTTTGGTGA ATGACCCGTTATTTTGTTAGCATACAGGATGAAAAAGGAGAAATATAGGT TGTTTTTATGAAAAATCTGGGCAAAATTGACAGTAATTAGATTTGGCGAG AATCAATTTTTATTAAATGGAATTTGCTAAGTTGACCGAAATTTTTCCTT TAAGGTATTTCCTTTTCATGAATTTGCAACTAATTGCTGCTTTAAAAATT CTAAAATTTTCTTGATATGTTACGAAGTTCTTAGCTTCAAATTTCTCGTT TTTTAAACTTTTTTATTGATCTCACCCAGTAGAGATTTCAAGAAGGAGTT GAAATGGAATGCTTAACTTTTATTAAACTTCCCCATTGTATTGCATAACG TATGTTTGGGTTTAGTTTTTTTATTAGTATGTCGAATTAAAGTGATGTAA TTTCTTAATCGAGCTGGACTTGTCATTAAATTACTGTTGAGGTTAATACA GTAATCAATGTATGTATCAATGTTTACCCTTCGTCGCGTGAGAGATAATT CGAAATGGTGTGTTTTCTTTTTTTAGAAAGGAGAAGCTGCAAAGGGAGAA CGAAAAATGTTCAGGTAAGTTTTTAGAGATTCCCTTTAAAAAGTTTTGAC CTTTGTTCATTTTCTAAACAGCATGTAATGTAAATGGTAGTTCTAAACTT ATTTTGGTTTCTGACAATGCTGGTCAATTTGGAACGTTTTCGTCACACAA TGTCAATTAAAAAATATATCTTCTTTGAAATAAATGAAAATGAATATCAT CCCGGAAAAATAACTGATGTGAGATGTTAAATCAAAAGGACACCAAATTT CTTAATAATCTTACTTTCCATTTCTAGAGTAAGTGATGCTGATGGCAGTT TGGATATGGATGAGATCGATGGAGACATTTCCAAGAGCAACCTCACCTCT GATGATGGTAAATTTAGATTTAAGCATCAGTGTTCGTATAATCTTGGAAC CATTCAAATGAGAATTATACTCAAGCTCAAACAGACCCGAAGCGAAGCAA AAAGTTGTTTTCCTTTTTTTTTTTTTGGTGCATAAATTACGTCACGATCA ACGCTTACCTCGTTTTCAAAATATTCATAATGTTAATTGATTCCTAGATG AGTTCAAAAGAGGCTTACTCTATTCAAAAAAATACTTGTAGACTCAATTT GATCACTTTGGTAATGGTTTCAAAACGAGGCAGTCTGTAGATTTAGCTCC GTCTTTCGGCATTACCATTTGTCATATGTTTGATTTTTCTTGTTTTTTGC CACGTTTTAGTCTACATCATTAATACTGGAGACCATGTTTATTGTTGGGT CGGCAAAGGAGCCAGCGTTGACGAACGAAGAAATGGATTGTCATATGCTT CCAATTATTTGAACAAGACAGAAACTCCTTACCTACCCATCTCAGTGGTG GCAGAGGGAAAAGAAAACGCCGAATTCAACGCTGCTTTCTAGATGCATTG ACCACTTGGATTTAAGGTAAAGACTTAATGGTGTAAGAAAGAAATTTCTG TTGTCATTCGATGTGTTCTAGGAACCGTGCTTTTTTTCTCTCGATGTCTT TTGAAAAAGTATGTTTTTCAAGATAACAGAAATGCACTGTAAGGGTGGAC ATTTCAGCAAATCCAGGAAAAATTGCTAATATTAGTCCGAAAATTGTTTT TTTTGCTCAAAGAGACTTGAGAATTTGAGAAAAATATACCATAAGGGTAT ACATTTCACTGATATTTTGCTGCACTGTAAGGATGCGATTCTAAAAGTCA TTTTTTCGCCGCACAAACCTTGTCTTTAGCTCTTGTATTATTCCTTGTCA AGCTTCTTCTTCGAAAATGTCTTCCGATATGTTGAACGACTGTAGGATTT GTTGGCTTCAAATCCTACCATAGAGATTCGATTCTAGCCCTTCGAGCTTA TACTTCATTGGGCCCCCCATATGTTTGGTCCAACGAACCAGAAAATACTT TAGATTTTAATACCCTCTAAATTAGCTTAAGCAGCGACTCTCTAAACGTC AATTTTAAAGGATTGGAAACAATTTGGTAATGATTTAGAATATTGTCTCC AAAACTGTTTTTCTGGTGTCGCAACATGATATCTTGAAAAATATTGGATG GCTACGGCACTGAATTCAGAAAACTTATTGTGTTTCGTGATTATTATTAG GTTATCTTTGGACATCAGAATCTATGTCAACTGATTAATATTCAAATCCA TTATAAAAATTTATTTTCTGTTTATAGGTGATAAGCACCATCGATTCAAA ATGGCTGCTCTTCAAACCACCAACCTATAAGGTTGATTTCGACAAAACGT CTACATAATTTATTCGTCATTTTCGTCCAATTAGAAATCACGTTTTAAGA ATTTTCAACGCATAGTATTTTTTAGGGGGAATATCATTTTTTTTAATTTT GATTTACTTTTTTAACATGTTAATTATTTTTACACATTTCATTTATTTAC TTTTCCAGTGCATACATTTTGGTTTCCACAAAATTACAACCTGAAAATAG ATTTCGTAAAATTTCTTTTTGTCTCTCTCTAGAATTTTGAACCAGTTTCG ATCGCATATTAGCGTATTTTTGTACAGTACAAATGTATATTTTTCGTTAT TTTTGTCATCATTTAATTTCAAAATTTTTAGTTTAGCCTTCTATATTGGA AATCTGATAAAAAAAGTCAAAATATTATACATACAGGGTTTGCAATGTAT TTTTACAACGATAATATGTATCAAAAAAAGAAATATTCAGTATCTAGAAA TAGAATAATTCCACAGTACATAGTTGTTACCTTTTCTTCCTTCCCTTTAT TAAAAGAAAATTTATCAAAAAAATTGCCTTGTTCAAAAATACCAAAACAC GTTCCCTTTGATATTCCTAATTTCATACACCTCCTTCTCACAGACCCACT GGGAACCCTTCCTACTGGAAAAATTTACCAAAATATCGTCCCCGGTGGGA AATTATACTCAGACTTTTTTCGCCACAGAAAATAATCAAATAAAACAATC CTCACTGCAAAATATTTACTATTTTCCCATCCCCACTGAATTTTCTGACT AGAAAACAAAAGAATTGAAATCCCCAGCCATAGAAAATATGTATCGATCT CCATCGAGTTTCATCCTCTACTCCGTTATTTTCATCATCACTAACTGAAA AAAAATCCTACAGGGAAGGGGGTGTTTTCATTCTTTCATACATCTGGAAT ACTGTTGACCATCTTCTTTAAGTCGAAAGCATCCACCGAAGGGGAACTTG TTCTACTGAAATTGGGACCAGCTGGAAAAATATGGTCTGTTCTACTCAAG ATTGGGGGACCAGCTGGAAAAATATGATCTGTTCTACTGAAGATTGGGAC CAGCTGGAAAAATATGATCTATTCTTATGAAAAAATAGTTTGATATCCAA AAAATAAGG

Coding sequence (CDS) from alignment at sc0000010:1148555..1157763-

>TCONS_00001515 ID=TCONS_00001515|Name=TCONS_00001515|organism=Clytia hemisphaerica|type=CDS|length=8616bp|location=Sequence derived from alignment at sc0000010:1148555..1157763- (Clytia hemisphaerica)
TCTACATCATTAATACTGGAGACCATGTTTATTGTTGGGTCGGCAAAGGA
GCCAGCGTTGACGAACGAAGAAATGGATTGTCATATGCTTCCAATTATTT
GAACAAGACAGAAACTCCTTACCTACCCATCTCAGTGGTGGCAGAGGGAA
AAGAAAACGCCGAATTCAACGCTGCTTTCTAGAGTAAGTGATGCTGATGG
CAGTTTGGATATGGATGAGATCGATGGAGACATTTCCAAGAGCAACCTCA
CCTCTGATGATGAAAGGAGAAGCTGCAAAGGGAGAACGAAAAATGTTCAG
TGGAACGGTAGCGAATGTAGTCACGACGAGAAGTTCAAAGCAGCACAAGA
AGTTGCTCGCATCAAAGGAAAGCGTGGCAAGTGTCGTGTTGATAACCTTG
ATGAAGGATCCATCTCAGAAGAACATCCAGCTATCATGATGTTGAAAGAT
GGAGAATCAAAACCTCATTTACCTTATTGAAAGGAGGAGCAGACACAGGA
TTCAACAGAGTTTTACCAGAAAACTATCCCAGCAGATTGTTCCATGTGAA
AAAGGTTTCACGAACCAAAATCACTTGTACTGAAGTCAGTTTAAAGAAAG
GAAATTTGAAATCTGAAGATGTCTTCATCATTGATGCTGGAAACAAAATC
TACCAAGTCACCCACTGGGACAAAGAACAATATGGTGAATTTTTTAATGG
AGATTCTTATATTATTTTGAATACTTACAAAAATAAAGACAGCGATGAAC
TCCTTCATGACCTTCACTTCTGGATCGGAAAATACTCCACTCAAGATGAA
TACGGTACAGCAGCTTACAAAACTGTTGAATTGGACACCTTTTTGGATGA
TAAACCAATACAACATCGTGAAGTTCAAGGACATGAATCATCAAAGTTTA
AAAGCTATTTTTCAAGTGAAGAAAGAATCAGCAGAAAGTGAGCCTGCATG
GAAAGGAGCTGGTGAAAAAGTTGGTGTTCAAGTTTGGAGAATTGTCAAAT
TCAAGATGCAAAAGGCCAAGAAATATGACTGGAAAGATTCCAACATGGCC
CTCTTTGGGTCTGATACTGAGAAGAAATCTACATCATTAATACTGGAGAC
CATGTTTATTGTTGGGTCGGCAAAGGAGCCAGCGTTGACGAACGAAGAAA
TGGATTGTCATATGCTTCCAATTATTTGAACAAGACAGAAACTCCTTACC
TACCCATCTCAGTGGTGGCAGAGGGAAAAGAAAACGCCGAATTCAACGCT
GCTTTCTAGAGTAAGTGATGCTGATGGCAGTTTGGATATGGATGAGATCG
ATGGAGACATTTCCAAGAGCAACCTCACCTCTGATGATGAAAGGAGAAGC
TGCAAAGGGAGAACGAAAAATGTTCAGTGGAACGGTAGCGAATGTAGTCA
CGACGAGAAGTTCAAAGCAGCACAAGAAGTTGCTCGCATCAAAGGAAAGC
GTGGCAAGTGTCGTGTTGATAACCTTGATGAAGGATCCATCTCAGAAGAA
CATCCAGCTATCATGATGTTGAAAGATGGAGAATCAAAACCTCATTTACC
TTATTGAAAGGAGGAGCAGACACAGGATTCAACAGAGTTTTACCAGAAAA
CTATCCCAGCAGATTGTTCCATGTGAAAAAGGTTTCACGAACCAAAATCA
CTTGTACTGAAGTCAGTTTAAAGAAAGGAAATTTGAAATCTGAAGATGTC
TTCATCATTGATGCTGGAAACAAAATCTACCAAGTCACCCACTGGGACAA
AGAACAATATGGTGAATTTTTTAATGGAGATTCTTATATTATTTTGAATA
CTTACAAAAATAAAGACAGCGATGAACTCCTTCATGACCTTCACTTCTGG
ATCGGAAAATACTCCACTCAAGATGAATACGGTACAGCAGCTTACAAAAC
TGTTGAATTGGACACCTTTTTGGATGATAAACCAATACAACATCGTGAAG
TTCAAGGACATGAATCATCAAAGTTTAAAAGCTATTTTTCAAGTGAAGAA
AGAATCAGCAGAAAGTGAGCCTGCATGGAAAGGAGCTGGTGAAAAAGTTG
GTGTTCAAGTTTGGAGAATTGTCAAATTCAAGATGCAAAAGGCCAAGAAA
TATGACTGGAAAGATTCCAACATGGCCCTCTTTGGGTCTGATACTGAGAA
GAAATCTACATCATTAATACTGGAGACCATGTTTATTGTTGGGTCGGCAA
AGGAGCCAGCGTTGACGAACGAAGAAATGGATTGTCATATGCTTCCAATT
ATTTGAACAAGACAGAAACTCCTTACCTACCCATCTCAGTGGTGGCAGAG
GGAAAAGAAAACGCCGAATTCAACGCTGCTTTCTAGAGTAAGTGATGCTG
ATGGCAGTTTGGATATGGATGAGATCGATGGAGACATTTCCAAGAGCAAC
CTCACCTCTGATGATGAAAGGAGAAGCTGCAAAGGGAGAACGAAAAATGT
TCAGTGGAACGGTAGCGAATGTAGTCACGACGAGAAGTTCAAAGCAGCAC
AAGAAGTTGCTCGCATCAAAGGAAAGCGTGGCAAGTGTCGTGTTGATAAC
CTTGATGAAGGATCCATCTCAGAAGAACATCCAGCTATCATGATGTTGAA
AGATGGAGAATCAAAACCTCATTTACCTTATTGAAAGGAGGAGCAGACAC
AGGATTCAACAGAGTTTTACCAGAAAACTATCCCAGCAGATTGTTCCATG
TGAAAAAGGTTTCACGAACCAAAATCACTTGTACTGAAGTCAGTTTAAAG
AAAGGAAATTTGAAATCTGAAGATGTCTTCATCATTGATGCTGGAAACAA
AATCTACCAAGTCACCCACTGGGACAAAGAACAATATGGTGAATTTTTTA
ATGGAGATTCTTATATTATTTTGAATACTTACAAAAATAAAGACAGCGAT
GAACTCCTTCATGACCTTCACTTCTGGATCGGAAAATACTCCACTCAAGA
TGAATACGGTACAGCAGCTTACAAAACTGTTGAATTGGACACCTTTTTGG
ATGATAAACCAATACAACATCGTGAAGTTCAAGGACATGAATCATCAAAG
TTTAAAAGCTATTTTTCAAGTGAAGAAAGAATCAGCAGAAAGTGAGCCTG
CATGGAAAGGAGCTGGTGAAAAAGTTGGTGTTCAAGTTTGGAGAATTGTC
AAATTCAAGATGCAAAAGGCCAAGAAATATGACTGGAAAGATTCCAACAT
GGCCCTCTTTGGGTCTGATACTGAGAAGAAATCTACATCATTAATACTGG
AGACCATGTTTATTGTTGGGTCGGCAAAGGAGCCAGCGTTGACGAACGAA
GAAATGGATTGTCATATGCTTCCAATTATTTGAACAAGACAGAAACTCCT
TACCTACCCATCTCAGTGGTGGCAGAGGGAAAAGAAAACGCCGAATTCAA
CGCTGCTTTCTAGAGTAAGTGATGCTGATGGCAGTTTGGATATGGATGAG
ATCGATGGAGACATTTCCAAGAGCAACCTCACCTCTGATGATGAAAGGAG
AAGCTGCAAAGGGAGAACGAAAAATGTTCAGTGGAACGGTAGCGAATGTA
GTCACGACGAGAAGTTCAAAGCAGCACAAGAAGTTGCTCGCATCAAAGGA
AAGCGTGGCAAGTGTCGTGTTGATAACCTTGATGAAGGATCCATCTCAGA
AGAACATCCAGCTATCATGATGTTGAAAGATGGAGAATCAAAACCTCATT
TACCTTATTGAAAGGAGGAGCAGACACAGGATTCAACAGAGTTTTACCAG
AAAACTATCCCAGCAGATTGTTCCATGTGAAAAAGGTTTCACGAACCAAA
ATCACTTGTACTGAAGTCAGTTTAAAGAAAGGAAATTTGAAATCTGAAGA
TGTCTTCATCATTGATGCTGGAAACAAAATCTACCAAGTCACCCACTGGG
ACAAAGAACAATATGGTGAATTTTTTAATGGAGATTCTTATATTATTTTG
AATACTTACAAAAATAAAGACAGCGATGAACTCCTTCATGACCTTCACTT
CTGGATCGGAAAATACTCCACTCAAGATGAATACGGTACAGCAGCTTACA
AAACTGTTGAATTGGACACCTTTTTGGATGATAAACCAATACAACATCGT
GAAGTTCAAGGACATGAATCATCAAAGTTTAAAAGCTATTTTTCAAGTGA
AGAAAGAATCAGCAGAAAGTGAGCCTGCATGGAAAGGAGCTGGTGAAAAA
GTTGGTGTTCAAGTTTGGAGAATTGTCAAATTCAAGATGCAAAAGGCCAA
GAAATATGACTGGAAAGATTCCAACATGGCCCTCTTTGGGTCTGATACTG
AGAAGAAATCTACATCATTAATACTGGAGACCATGTTTATTGTTGGGTCG
GCAAAGGAGCCAGCGTTGACGAACGAAGAAATGGATTGTCATATGCTTCC
AATTATTTGAACAAGACAGAAACTCCTTACCTACCCATCTCAGTGGTGGC
AGAGGGAAAAGAAAACGCCGAATTCAACGCTGCTTTCTAGAGTAAGTGAT
GCTGATGGCAGTTTGGATATGGATGAGATCGATGGAGACATTTCCAAGAG
CAACCTCACCTCTGATGATGAAAGGAGAAGCTGCAAAGGGAGAACGAAAA
ATGTTCAGTGGAACGGTAGCGAATGTAGTCACGACGAGAAGTTCAAAGCA
GCACAAGAAGTTGCTCGCATCAAAGGAAAGCGTGGCAAGTGTCGTGTTGA
TAACCTTGATGAAGGATCCATCTCAGAAGAACATCCAGCTATCATGATGT
TGAAAGATGGAGAATCAAAACCTCATTTACCTTATTGAAAGGAGGAGCAG
ACACAGGATTCAACAGAGTTTTACCAGAAAACTATCCCAGCAGATTGTTC
CATGTGAAAAAGGTTTCACGAACCAAAATCACTTGTACTGAAGTCAGTTT
AAAGAAAGGAAATTTGAAATCTGAAGATGTCTTCATCATTGATGCTGGAA
ACAAAATCTACCAAGTCACCCACTGGGACAAAGAACAATATGGTGAATTT
TTTAATGGAGATTCTTATATTATTTTGAATACTTACAAAAATAAAGACAG
CGATGAACTCCTTCATGACCTTCACTTCTGGATCGGAAAATACTCCACTC
AAGATGAATACGGTACAGCAGCTTACAAAACTGTTGAATTGGACACCTTT
TTGGATGATAAACCAATACAACATCGTGAAGTTCAAGGACATGAATCATC
AAAGTTTAAAAGCTATTTTTCAAGTGAAGAAAGAATCAGCAGAAAGTGAG
CCTGCATGGAAAGGAGCTGGTGAAAAAGTTGGTGTTCAAGTTTGGAGAAT
TGTCAAATTCAAGATGCAAAAGGCCAAGAAATATGACTGGAAAGATTCCA
ACATGGCCCTCTTTGGGTCTGATACTGAGAAGAAATCTACATCATTAATA
CTGGAGACCATGTTTATTGTTGGGTCGGCAAAGGAGCCAGCGTTGACGAA
CGAAGAAATGGATTGTCATATGCTTCCAATTATTTGAACAAGACAGAAAC
TCCTTACCTACCCATCTCAGTGGTGGCAGAGGGAAAAGAAAACGCCGAAT
TCAACGCTGCTTTCTAGAGTAAGTGATGCTGATGGCAGTTTGGATATGGA
TGAGATCGATGGAGACATTTCCAAGAGCAACCTCACCTCTGATGATGAAA
GGAGAAGCTGCAAAGGGAGAACGAAAAATGTTCAGTGGAACGGTAGCGAA
TGTAGTCACGACGAGAAGTTCAAAGCAGCACAAGAAGTTGCTCGCATCAA
AGGAAAGCGTGGCAAGTGTCGTGTTGATAACCTTGATGAAGGATCCATCT
CAGAAGAACATCCAGCTATCATGATGTTGAAAGATGGAGAATCAAAACCT
CATTTACCTTATTGAAAGGAGGAGCAGACACAGGATTCAACAGAGTTTTA
CCAGAAAACTATCCCAGCAGATTGTTCCATGTGAAAAAGGTTTCACGAAC
CAAAATCACTTGTACTGAAGTCAGTTTAAAGAAAGGAAATTTGAAATCTG
AAGATGTCTTCATCATTGATGCTGGAAACAAAATCTACCAAGTCACCCAC
TGGGACAAAGAACAATATGGTGAATTTTTTAATGGAGATTCTTATATTAT
TTTGAATACTTACAAAAATAAAGACAGCGATGAACTCCTTCATGACCTTC
ACTTCTGGATCGGAAAATACTCCACTCAAGATGAATACGGTACAGCAGCT
TACAAAACTGTTGAATTGGACACCTTTTTGGATGATAAACCAATACAACA
TCGTGAAGTTCAAGGACATGAATCATCAAAGTTTAAAAGCTATTTTTCAA
GTGAAGAAAGAATCAGCAGAAAGTGAGCCTGCATGGAAAGGAGCTGGTGA
AAAAGTTGGTGTTCAAGTTTGGAGAATTGTCAAATTCAAGATGCAAAAGG
CCAAGAAATATGACTGGAAAGATTCCAACATGGCCCTCTTTGGGTCTGAT
ACTGAGAAGAAATCTACATCATTAATACTGGAGACCATGTTTATTGTTGG
GTCGGCAAAGGAGCCAGCGTTGACGAACGAAGAAATGGATTGTCATATGC
TTCCAATTATTTGAACAAGACAGAAACTCCTTACCTACCCATCTCAGTGG
TGGCAGAGGGAAAAGAAAACGCCGAATTCAACGCTGCTTTCTAGAGTAAG
TGATGCTGATGGCAGTTTGGATATGGATGAGATCGATGGAGACATTTCCA
AGAGCAACCTCACCTCTGATGATGAAAGGAGAAGCTGCAAAGGGAGAACG
AAAAATGTTCAGTGGAACGGTAGCGAATGTAGTCACGACGAGAAGTTCAA
AGCAGCACAAGAAGTTGCTCGCATCAAAGGAAAGCGTGGCAAGTGTCGTG
TTGATAACCTTGATGAAGGATCCATCTCAGAAGAACATCCAGCTATCATG
ATGTTGAAAGATGGAGAATCAAAACCTCATTTACCTTATTGAAAGGAGGA
GCAGACACAGGATTCAACAGAGTTTTACCAGAAAACTATCCCAGCAGATT
GTTCCATGTGAAAAAGGTTTCACGAACCAAAATCACTTGTACTGAAGTCA
GTTTAAAGAAAGGAAATTTGAAATCTGAAGATGTCTTCATCATTGATGCT
GGAAACAAAATCTACCAAGTCACCCACTGGGACAAAGAACAATATGGTGA
ATTTTTTAATGGAGATTCTTATATTATTTTGAATACTTACAAAAATAAAG
ACAGCGATGAACTCCTTCATGACCTTCACTTCTGGATCGGAAAATACTCC
ACTCAAGATGAATACGGTACAGCAGCTTACAAAACTGTTGAATTGGACAC
CTTTTTGGATGATAAACCAATACAACATCGTGAAGTTCAAGGACATGAAT
CATCAAAGTTTAAAAGCTATTTTTCAAGTGAAGAAAGAATCAGCAGAAAG
TGAGCCTGCATGGAAAGGAGCTGGTGAAAAAGTTGGTGTTCAAGTTTGGA
GAATTGTCAAATTCAAGATGCAAAAGGCCAAGAAATATGACTGGAAAGAT
TCCAACATGGCCCTCTTTGGGTCTGATACTGAGAAGAAATCTACATCATT
AATACTGGAGACCATGTTTATTGTTGGGTCGGCAAAGGAGCCAGCGTTGA
CGAACGAAGAAATGGATTGTCATATGCTTCCAATTATTTGAACAAGACAG
AAACTCCTTACCTACCCATCTCAGTGGTGGCAGAGGGAAAAGAAAACGCC
GAATTCAACGCTGCTTTCTAGAGTAAGTGATGCTGATGGCAGTTTGGATA
TGGATGAGATCGATGGAGACATTTCCAAGAGCAACCTCACCTCTGATGAT
GAAAGGAGAAGCTGCAAAGGGAGAACGAAAAATGTTCAGTGGAACGGTAG
CGAATGTAGTCACGACGAGAAGTTCAAAGCAGCACAAGAAGTTGCTCGCA
TCAAAGGAAAGCGTGGCAAGTGTCGTGTTGATAACCTTGATGAAGGATCC
ATCTCAGAAGAACATCCAGCTATCATGATGTTGAAAGATGGAGAATCAAA
ACCTCATTTACCTTATTGAAAGGAGGAGCAGACACAGGATTCAACAGAGT
TTTACCAGAAAACTATCCCAGCAGATTGTTCCATGTGAAAAAGGTTTCAC
GAACCAAAATCACTTGTACTGAAGTCAGTTTAAAGAAAGGAAATTTGAAA
TCTGAAGATGTCTTCATCATTGATGCTGGAAACAAAATCTACCAAGTCAC
CCACTGGGACAAAGAACAATATGGTGAATTTTTTAATGGAGATTCTTATA
TTATTTTGAATACTTACAAAAATAAAGACAGCGATGAACTCCTTCATGAC
CTTCACTTCTGGATCGGAAAATACTCCACTCAAGATGAATACGGTACAGC
AGCTTACAAAACTGTTGAATTGGACACCTTTTTGGATGATAAACCAATAC
AACATCGTGAAGTTCAAGGACATGAATCATCAAAGTTTAAAAGCTATTTT
TCAAGTGAAGAAAGAATCAGCAGAAAGTGAGCCTGCATGGAAAGGAGCTG
GTGAAAAAGTTGGTGTTCAAGTTTGGAGAATTGTCAAATTCAAGATGCAA
AAGGCCAAGAAATATGACTGGAAAGATTCCAACATGGCCCTCTTTGGGTC
TGATACTGAGAAGAAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000774XLOC_000774Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001515-exon-sc0000010-1575043694:1157368..1157763TCONS_00001515-exon-sc0000010-1575043694:1157368..1157763Clytia hemisphaericaexon
TCONS_00001515-exon-sc0000010-1575043694:1153779..1153868TCONS_00001515-exon-sc0000010-1575043694:1153779..1153868Clytia hemisphaericaexon
TCONS_00001515-exon-sc0000010-1575043694:1153303..1153561TCONS_00001515-exon-sc0000010-1575043694:1153303..1153561Clytia hemisphaericaexon
TCONS_00001515-exon-sc0000010-1575043694:1152842..1153032TCONS_00001515-exon-sc0000010-1575043694:1152842..1153032Clytia hemisphaericaexon
TCONS_00001515-exon-sc0000010-1575043694:1152224..1152388TCONS_00001515-exon-sc0000010-1575043694:1152224..1152388Clytia hemisphaericaexon
TCONS_00001515-exon-sc0000010-1575043694:1151400..1151437TCONS_00001515-exon-sc0000010-1575043694:1151400..1151437Clytia hemisphaericaexon
TCONS_00001515-exon-sc0000010-1575043694:1151057..1151136TCONS_00001515-exon-sc0000010-1575043694:1151057..1151136Clytia hemisphaericaexon
TCONS_00001515-exon-sc0000010-1575043694:1150498..1150703TCONS_00001515-exon-sc0000010-1575043694:1150498..1150703Clytia hemisphaericaexon
TCONS_00001515-exon-sc0000010-1575043694:1148555..1149736TCONS_00001515-exon-sc0000010-1575043694:1148555..1149736Clytia hemisphaericaexon
TCONS_00001515-exon-sc0000010-1510915933:1157368..1157763TCONS_00001515-exon-sc0000010-1510915933:1157368..1157763Clytia hemisphaericaexon
TCONS_00001515-exon-sc0000010-1510915933:1153779..1153868TCONS_00001515-exon-sc0000010-1510915933:1153779..1153868Clytia hemisphaericaexon
TCONS_00001515-exon-sc0000010-1510915933:1153303..1153561TCONS_00001515-exon-sc0000010-1510915933:1153303..1153561Clytia hemisphaericaexon
TCONS_00001515-exon-sc0000010-1510915933:1152842..1153032TCONS_00001515-exon-sc0000010-1510915933:1152842..1153032Clytia hemisphaericaexon
TCONS_00001515-exon-sc0000010-1510915933:1152224..1152388TCONS_00001515-exon-sc0000010-1510915933:1152224..1152388Clytia hemisphaericaexon
TCONS_00001515-exon-sc0000010-1510915933:1151400..1151437TCONS_00001515-exon-sc0000010-1510915933:1151400..1151437Clytia hemisphaericaexon
TCONS_00001515-exon-sc0000010-1510915933:1151057..1151136TCONS_00001515-exon-sc0000010-1510915933:1151057..1151136Clytia hemisphaericaexon
TCONS_00001515-exon-sc0000010-1510915933:1150498..1150703TCONS_00001515-exon-sc0000010-1510915933:1150498..1150703Clytia hemisphaericaexon
TCONS_00001515-exon-sc0000010-1510915933:1148555..1149736TCONS_00001515-exon-sc0000010-1510915933:1148555..1149736Clytia hemisphaericaexon
TCONS_00001515-exon-sc0000010-1491911889:1157368..1157763TCONS_00001515-exon-sc0000010-1491911889:1157368..1157763Clytia hemisphaericaexon
TCONS_00001515-exon-sc0000010-1491911889:1153779..1153868TCONS_00001515-exon-sc0000010-1491911889:1153779..1153868Clytia hemisphaericaexon
TCONS_00001515-exon-sc0000010-1491911889:1153303..1153561TCONS_00001515-exon-sc0000010-1491911889:1153303..1153561Clytia hemisphaericaexon
TCONS_00001515-exon-sc0000010-1491911889:1152842..1153032TCONS_00001515-exon-sc0000010-1491911889:1152842..1153032Clytia hemisphaericaexon
TCONS_00001515-exon-sc0000010-1491911889:1152224..1152388TCONS_00001515-exon-sc0000010-1491911889:1152224..1152388Clytia hemisphaericaexon
TCONS_00001515-exon-sc0000010-1491911889:1151400..1151437TCONS_00001515-exon-sc0000010-1491911889:1151400..1151437Clytia hemisphaericaexon
TCONS_00001515-exon-sc0000010-1491911889:1151057..1151136TCONS_00001515-exon-sc0000010-1491911889:1151057..1151136Clytia hemisphaericaexon
TCONS_00001515-exon-sc0000010-1491911889:1150498..1150703TCONS_00001515-exon-sc0000010-1491911889:1150498..1150703Clytia hemisphaericaexon
TCONS_00001515-exon-sc0000010-1491911889:1148555..1149736TCONS_00001515-exon-sc0000010-1491911889:1148555..1149736Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001515-proteinTCONS_00001515-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000010supercontigsc0000010:1148555..1157763 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
277.366 294.998 318.996 312.251 335.335 255.66 536.355 548.207 453.139 519.682 328.053 274.426 324.114 296.664 252.334 314.853 171.594 157.629 321.283 318.973 138.4 151.664 151.531 153.429 82.0208 119.67 134.911 117.908 211.53 229.757
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR007122Villin/Gelsolin
IPR007123Gelsolin-like_dom
IPR029006ADF-H/Gelsolin-like_dom
Vocabulary: Molecular Function
TermDefinition
GO:0051015actin filament binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0051015 actin filament binding
Blast
BLAST of TCONS_00001515 vs. Swiss-Prot (Human)
Match: GELS (Gelsolin OS=Homo sapiens GN=GSN PE=1 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 6.650e-47
Identity = 116/342 (33.92%), Postives = 186/342 (54.39%), Query Frame = 1
Query:  424 PAWKGAGEKVGVQVWRIVKFKVTHWDKEQYGEFFNGDSYIILNTYKNKDSDELLHDLHFWIGKYSTQDEYGTAAYKTVELDTFLDDKPIQHREVQGHEXXX-XXXXXXXXXLLKGGADTGFNRVLP-ENYPSRLFHVKKVSRTKITCTEVSLKKGNLKSEDVFIIDAGNKIYQWNGSECSHDEKFKAAQEVARIKG--KRGKCRVDNLDEGSISEEHPAIMMLKDGESKPKG--------EAAKGERKMFRVSDADGSLDMDEI--DGDISKSNLTSDDVYIINTGD--HVYCWVGKGASVDERRNGLSYASNYLNKTETP-YLPISVVAEGKENAEFNAAF 1398
            P +  AG++ G+Q+WR+ KF +       YG+FF GD+Y+IL T + ++ + L +DLH+W+G   +QDE G AA  TV+LD +L+ + +QHREVQG ES+     + S     KGG  +GF  V+P E    RLF VK   R  +  TEV +   +  + D FI+D GN I+QW GS  +  E+ KA Q    I+   + G+ RV   +EG  +E    + +L    + P G         A +   K+++VS+  G++ +  +  +   ++  L S+D +I++ G    ++ W GK A+ +ER+  L  AS+++ K + P    +SV+ EG E   F   F
Sbjct:   57 PEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGN-LQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVK--GRRVVRATEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNRYERLKATQVSKGIRDNERSGRARVHVSEEG--TEPEAMLQVLGPKPALPAGTEDTAKEDAANRKLAKLYKVSNGAGTMSVSLVADENPFAQGALKSEDCFILDHGKDGKIFVWKGKQANTEERKAALKTASDFITKMDYPKQTQVSVLPEGGETPLFKQFF 393          

HSP 2 Score: 132.494 bits (332), Expect = 1.417e-31
Identity = 101/330 (30.61%), Postives = 157/330 (47.58%), Query Frame = 1
Query:  436 GAGEKVGVQVWRIVKFKVTHWDKEQYGEFFNGDSYIILNTYKNKDSDELLHDLHFWIGKYSTQDEYGTAAYKTVELDTFLDDKPIQHREVQGHEXXXXXXXXXXXXLL--KGGADTGFNRVLPENYPSRLFHVKKVSRTKITCTEVSLKKGNLKSEDVFIIDAGNKIYQWNGSECSHDEKFKAAQEVARIKGKRGKCRVDNLDEGSISEEHPAIMMLKDG-ESKPKGEAAKGER---KMFRVSDADGSLDMDEIDGDISKSNLTSDDVYIINTGDHVYCWVGKGASVDERRNGLSYASNYLNKTET---PYLPISVVAEGKENAEFNAAF 1398
            G G+K   Q+WRI        D   YG+F+ GDSYIIL  Y++      +  ++ W G  STQDE   +A  T +LD  L   P+Q R VQG E +   S F    ++  KGG      +  P +  +RLF V+  S       EV  K G L S D F++   +  Y W G+  S  EK   AQE+ R+     + +   + EGS  +     +  K    + P+ +  K +    ++F  S+  G   ++E+ G++ + +L +DDV +++T D V+ WVGK +  +E+   L+ A  Y+           PI+VV +G E   F   F
Sbjct:  443 GTGQK---QIWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQI--IYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSREGGQTAPAS--TRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEK-TGAQELLRVL----RAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWF 760          
The following BLAST results are available for this feature:
BLAST of TCONS_00001515 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
GELS6.650e-4733.92Gelsolin OS=Homo sapiens GN=GSN PE=1 SV=1[more]
back to top