Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001510 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001510
Unique NameTCONS_00001510
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3002

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001510 ID=TCONS_00001510|Name=TCONS_00001510|organism=Clytia hemisphaerica|type=transcript|length=3002bp
GTTCTTGGCTCTTGAAGAAGAAAGACCTCTTCTtcacttcttcattttca
tttgtacCGGGCAGTTCGTTCTTTCAGGTACACACAGTGAAGAATGTGGG
CCCTTTGGTTCTTGTTTTCGATTGTTGCTACATCAGCATCAGaatTGACA
TGGCTGAAACTTGATGATGCATTATCCCAAGCTAAAGAAAAGACGCTTCC
AATCTTATTGTTGAGTACTCGTTCTAAATGTAAACCCTGCAAAAaactga
TCGAAGATTTCGAAGCGTCCAGTGAGTTTGTTGAACAAAGCAAGAAATTC
CTACTGGCAAAAGCTGAAGATAAAGAGATTGGCAAATTGGGTGCATATAA
AAGCGAAGGAAAATATGTCCCTAAAATCGTATTCATTAATCACAATGGTG
TCATGATGCGGGAATTGGACAACAAGAATAAGAAATCCGATAAAACAAAA
TACTTCTACAAAAAAGTTTCTGATGTTTTGATCAGTATGGAAGTATGTTT
GGAGCACCAGTTCTTGGATAGTGGTTTCGGTAAAGACTATGTGTGGTATG
AGTGGACCTCAGGCTTGGCGGCTGCAAAACAACAGAATAAGCCAATTCTT
GCTGTTTTCCATCAAGACTGGTGTGGTGCTTGCCAACGATTGAAACCATC
ATTCGCAGCTTCAGATGAGATCAAAGAAGTAGCGGACAAGTTCATCATGA
TTAATACTGACGAAGATGACATTGTGAAAGAAAGTGATAAATACAGAGCT
GATGGAGAATACTATCCCAAAATATTATTTATTGACAGCGATGGTGATTT
GATTGAAGAAGAATTGAATTATGGAACAAAACATAAACATGTTCTTCATT
ATTATGGTTCAGGAAAAGAAATCCGCGCATCAATGGACCGAGTCATTGGA
AATATCACCGAAGCTCAAAACGTCAAAGACAATGATCTTGGAAAACACAT
CAAATGGGTTACTTACAAAAAAGGATTACAACTTGTTAAAACTTTGAAGA
AGCCAATGATGTTAATCATCACCAAATCTTATTGTGGTGCTTGTAAAGCT
CTCAAACCAAGAATTCAAAGAAGTAAAGAATTTGCTGAGCTCAGCAAGAA
ATTTGTCATGGTTACTGTTGAAGATGATGATGAACCAGATGAAGATCAAT
TTGATGTTGATGGTGCCTACATTCCAAGAATATTCTTCTTAGACAGCAAT
GGTAAAGTTGACGAATCCCTACGCAATGaaggaaaatctttcaaaaaatc
acgATACGCTTATGGAAATGTTGACCAATTGATGACTAACATGAACAAAG
CTTTGGAGATGAAACTTGGTGAACGAACAGAGGATCACCAATacacacaa
caacaacaacaacaacaacaacaacaagattcTCAGAACACTCAACAAGA
ATCGCAGAACACTCAACAAGAACAAACACAAACTCAGCAACAACCAAAAG
AAGAAGCCAAGCAGAAAACTGATGGTTTTGGCACCAACATCAGATGGTAC
AATTATACAGTTGGAGTACAACAAGTGAAGAAGAATCACATGATTGGTCT
TGTCGTATTCTACAATAACTATTGTGAATTCGCTCGATACATGAAAGAGC
AGCTCAATGAATCACCAGAGATCACTGAACTTTCTAACAAATTTGTTATG
ATTCGTGTCAGCGAAGAGGAAGCGaaagaaacgaaagaaaaatatgatgT
CGATGGAAAATATTCACCAAGGATGTTCTTTATCGATCCTGATGAGAACG
TCCAGGTCAATCTCAACAACAGTTTGATCGACTCACCATACGATTCCACC
CTCTTTTACTACGGTACCGATAAAGAGATTCTCAGCATGATGAAAAGCGC
CCAACAAACAATGAATATCACCCTCGGGCGGGGATTTGGTGAATACATTG
ACTGGGTGGCCTATCCAAGGGCGTTGGAGttatgcaaggagaaaaatatG
CCAATGATGTTAATTATCCATAAAACGTGGTGTGGTGCATGTAAATCTTT
GAAACCAACGATCAAAGATTCGAGACCTATCTGGGAATTGAGCAAATATT
TCATCATGGTTAATACTGAGGATTCAGAGGAGCCTCATGACGAACAATAT
TTCATTGATGGTGGATATTATCCAAGAATTTATTTCTTAGATTCTCAAGG
CAAAGTACACCATGACCTTCACAACAGAGATCCCGCCTTCTTGAAATACA
AATTTTCATTCGCCTATGAAGAACAAATCTTGCAAACGATGAAATTTGCT
GTTGGGAAGTTTTATAACACACAAAACACTGCACAACAAAACACACAACA
ACAAACCACACAAcaacaagaaaaacaacaacaaaaacaggAAACTAAAA
CAGAAGAAGGTAAGAAAGAGAAGAGCACAACATTATCTCCTGGTAAACGA
TTGTTATCAAACAGTGGTCTCAAATGGAATAACATTAATGCTGCTCTGGA
AGAAGCAAAGGAAagccAAAAGCCAATTATGTTCTTAGTTCATCGCACAA
CTTGCCCCGCTTGTAAAGcTACTATCAAGATGATTGTGAGAGATGAAGAG
TTCAAAGAGAAATCTCAAGGATTCATCCTTGCTGACATTGAGGACGACGT
TGATGATGAATTAGCTGATTCTTTTGATATCGATGGAACGTATGTACCGA
GAATTTATTTCTTGGATCCTGAAGGCAAGATATGGAAAGATTTATGGAAC
GTGGGTACAAGTTATTTGGACAACAAGTTCTACTTCTTCGAAAGCTCAGC
AAtcTATCGAGCAATGGAAAAAGCCAAGGAAAAGATGTCAGCGTGGAAAC
CAGGGGACCAGTCTGAAGAGACTAATCGAGTTGTCAAAAAACCAAAAGAT
GAATTATAGTTTtaaatttctatttctaatttaagttaatttttgtactt
ttatttcctgattttatttatttttctttttttttttatttcaaccatga
tcatgtttttttgttctggttttgtttttgatgtttctgaatctgctttt
tg
Run BLAST on NCBI

protein sequence of Thioredoxin domain containing protein

>TCONS_00001510-protein ID=TCONS_00001510-protein|Name=Thioredoxin domain containing protein|organism=Clytia hemisphaerica|type=polypeptide|length=921bp
MWALWFLFSIVATSASELTWLKLDDALSQAKEKTLPILLLSTRSKCKPCK
KLIEDFEASSEFVEQSKKFLLAKAEDKEIGKLGAYKSEGKYVPKIVFINH
NGVMMRELDNKNKKSDKTKYFYKKVSDVLISMEVCLEHQFLDSGFGKDYV
WYEWTSGLAAAKQQNKPILAVFHQDWCGACQRLKPSFAASDEIKEVADKF
IMINTDEDDIVKESDKYRADGEYYPKILFIDSDGDLIEEELNYGTKHKHV
LHYYGSGKEIRASMDRVIGNITEAQNVKDNDLGKHIKWVTYKKGLQLVKT
LKKPMMLIITKSYCGACKALKPRIQRSKEFAELSKKFVMVTVEDDDEPDE
DQFDVDGAYIPRIFFLDSNGKVDESLRNEGKSFKKSRYAYGNVDQLMTNM
NKALEMKLGERTEDHQYTQQQQQQQQQQDSQNTQQESQNTQQEQTQTQQQ
PKEEAKQKTDGFGTNIRWYNYTVGVQQVKKNHMIGLVVFYNNYCEFARYM
KEQLNESPEITELSNKFVMIRVSEEEAKETKEKYDVDGKYSPRMFFIDPD
ENVQVNLNNSLIDSPYDSTLFYYGTDKEILSMMKSAQQTMNITLGRGFGE
YIDWVAYPRALELCKEKNMPMMLIIHKTWCGACKSLKPTIKDSRPIWELS
KYFIMVNTEDSEEPHDEQYFIDGGYYPRIYFLDSQGKVHHDLHNRDPAFL
KYKFSFAYEEQILQTMKFAVGKFYNTQNTAQQNTQQQTTQQQEKQQQKQE
TKTEEGKKEKSTTLSPGKRLLSNSGLKWNNINAALEEAKESQKPIMFLVH
RTTCPACKATIKMIVRDEEFKEKSQGFILADIEDDVDDELADSFDIDGTY
VPRIYFLDPEGKIWKDLWNVGTSYLDNKFYFFESSAIYRAMEKAKEKMSA
WKPGDQSEETNRVVKKPKDEL
Run BLAST on NCBI

transcript from alignment at sc0000010:965417..981344-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001510 ID=TCONS_00001510|Name=TCONS_00001510|organism=Clytia hemisphaerica|type=transcript|length=15928bp|location=Sequence derived from alignment at sc0000010:965417..981344- (Clytia hemisphaerica)
GTTCTTGGCTCTTGAAGAAGAAAGACCTCTTCTTCACTTCTTCATTTTCA TTTGTACCGGGCAGTTCGTTCTTTCAGGTACACACAGTGAAGAATGTGGG CCCTTTGGTTCTTGTTTTCGATTGTTGCTACATCAGCATCAGGTATGTAG AACTCCTTGTATTTCATACAATTTGATATTGGCTATTCGGACTAATAATT CGGGAAATCTTATTATTTATTCGATATTTCGTGAGATTCGAATTTTTAAA AGTATTTTCAAGGCATTCGAGAACTTATATCTACAAAAGACTATTGTTTT AGGAAAGTCAGATTAATGGAAATCCATTTTATTATGTATCATCATGTTCG TATCTAATTGTATCGGTTACGCTTTCAATTTGGAGATATTATCGTTATAA AATACTGTTCTTATTTTTTCAGAATTGACATGGCTGAAACTTGATGATGC ATTATCCCAAGCTAAAGAAAAGTAAGATGAATGTGATGTTTTATCAATTT TAATTTTGTCTTCTCTGACAAAATGTTACATCTTTTTCGATCCTTAGAAT GCTGAGTTTGACACTTATATAAAAGTCGTCTGAAGTTCTACACCTGTTAG TTTTTTAGTATTTAGAAGCCTATTAACTTTCTAGTCGGACCATGGTCTGT ACTGTACTAAATCATCTGTAACTTATGAATTTCTTTCGGTTTTAGGACGC TTCCAATCTTATTGTTGAGTACTCGTTCTAAATGTAAACCCTGCAAAAGT AAGTCTACCATTGATGTATTGCTTTCTTGAACTGTGACCTCTTTTTAACA AATTCTTTTCTAAAAGATCTTCAAGTAAAAGTTGAAGAGAAAGTTCTCAA AGGTCAAATAAGTCCAGAAATTTGTAAATTTTATTTCCTTTCTCCGTTAC GTATGTAGAGGGGTCTGTACCACTCACTCCCTTTATAAAACTACCGCTCA CGTTTGGACGATTTCTCTTTTAGCAAAAGGTACCGATCCCCTGAACCGCC TTTTTTCAGCACCCCCGGACAAGGATGGATTTATTAACCCCTTATGATTC TTAATCTTATATATTATCAAATAATTTTTAAGAACTGATCGAAGATTTCG AAGCGTCCAGTGAGTTTGTTGAACAAAGCAAGAAATTCCTACTGGCAAAA GCTGAAGATAAAGAGATTGGCAAATTGGGTGCATATAAAAGCGAAGGAAA ATATGTCCCTAAAATCGTATTCATTAGTAAGTATATTCGACCTTTTTATC AAAACTTTTATATTTTCATCTCTTTTCTTTGGTTCGTCTTCTTGGCTGTC AACATTCCTCAGATAGGTTTTGCTTGAACTTAAACTATTCGGGGATCCCT GCATGCTTTTCACTTTACCGCATATACAATTTTTTTTTCAAATCAGCATT TTCAAATATTTGAGATTTAGCCAAGAATTAATTAAAATTACCCTGAATAC GCGCCAATTTTCCTCAAACTATGTGTTTTTTATTAATTTCGCGAGTTTTA TTTTCGAAAAAAAAAACACGAAAATTTGCGAAAACACAAGATTGAATCTT GTTAAAATTAATCCAAGTAATATAACTCGAACCTCTACATCATATCCTAA GAAATATTAATTATCCCCCTAGATCACAATGGTGTCATGATGCGGGAATT GGACAACAAGAATAAGAAATCCGATAAAACAAAATACTTCTACAAAAAAG TTTCTGATGGTAAGTTCATCTTTTTACTGTTGCGTTGCGATTGCAATAAG ATAGAATTTAAGTTTCCGTCGCCAAAAAGTTTTTAGAAAAAATTATTGGT ATATTTCAGGAAAATTATATTCAAAGCTATTAAATGCTATCAGTTGTACA TCCAGTTTTTGCCCTTTGATGTACGATGCATTGTTACATCCCCTGTCTCA GTAACCCGGTGATCTCTTAGCCAGCCTTAGCGAGGATGAAGTAAAAGCGT TGAATATCAATATGGCTCGTGGAAAATCTCATTTTAATCATCCGATAGTG TCTTTATCAAATGAGATGCTCCAATGCTTTTTCCGTGAAAATTTCATGAA TTTTTTGACGTATTTTTCCAGTGGGTAGAGGGCTCCACCAAATCTTTGAG GATGCGATTATATTTTTTGAAACTGCTATTTCTTGTTCTCGATACAGTTT TGATCAGTATGGAAGTATGTTTGGAGCACCAGTTCTTGGATAGTGGTTTC GGTAAAGACTATGTGTGGTATGAGTGGACCTCAGGCTTGGCGGCTGCAAA ACAACAGTAAGTTGGTGAAATAGATATAATTTTTTTTTTTTTTTGGGGGG GGGAGGGCGACTTTATTGAAAAACATGCAACTTATTAACGTCGTCGTGAA TTACTTCGAAATTCCACAGTAAATCTTTTAATTATCCTATGTCAGTCAGA GCCAGATAGAGATTTTGCCTTGTCGGGGAAAAGCTCGTTTCAGTCGCGTG TTTTTTATTCTCAAAAAGGTTCATGTATCTTTGAAGAAGAGATACGAGTA TTTTAAAACAACTGCTTCTTCCAATCAACTTTAAAAAACCTATGTAGAAC TTCTAGCTTTGTTTGAGAGCTGTTGAGAGTGTTCTTTCGCAGGTATTTTC TTTTAATCATACCAAAAAATCGATTTTGTTTCCAGGAATAAGCCAATTCT TGCTGTTTTCCATCAAGACTGGTGTGGTGCTTGCCAACGTAAGAAAATCT TCCATCTTTCAAAAGATCCCTCTAAATAAACTATTCAGCATTTATATAAG CATTTTGCTAATCTTAAACTTTGGCCTAATTATGGATTATTACCCTCTAC CAGAGTCTTCTACTTCACGCATAACGTAGTCGTAGTACAGTGATGAATTT TGATATTTCTGAAGATTTCGGGTGTAGGGAAGATTTAGAAGTTTGTCTTT TATTTATTTATAATCTAATGTTTCTTGTGATTTGTAGGATTGAAACCATC ATTCGCAGCTTCAGATGAGATCAAAGAAGTAGCGGACAAGTTCATCATGA TTAATACTGACGTATGTATATATCTAACCAGAAATTCCTGGATTTCTTTC AAAAAGGAAACATTAACAAAATTACTTTATTTGTTCATCCCATCATCTCG TTTCTCTCGGTCACGGTATAATGACGTCAATCTATCGGGAAATTACACGC TTTTTGATTAGAACACAAGACTTAAAATATTGAAAAGAAGAGAAAAGCTA ATGCTCAGGTTCTTATAGAAAAAACGTATTAACATCGCCTCATCCTCGGT ATTTTAGGAAGATGACATTGTGAAAGAAAGTGATAAATACAGAGCTGATG GAGAATACTATCCCAAAATATTATTTATTGGTAAGAAAAAATCGGTTATC TCGTTTGTATTGTATTTTCGAATCTTGTGATATACATAAGAAGGACATTA ACTGTTTATTAATCTTAACTGGAAATTTATGCGATCTCTACATTTCAGAC AGCGATGGTGATTTGATTGAAGAAGAATTGAATTATGGAACAAAACATAA ACATGTTCTTCATTATTATGGTTCAGGAAAAGAAAGTAAGAATTAAAAAT GTTTTTAAAATAAAGTTCCATTTAACAGGGCGATTGCCGGTCGCTTTGTA GATGAACGCTAAAAGGCCTTAGATTACTTGGGATATCAACGAAATATCAA CTCTATCTACAATGTCTCTCACCAACTCTAATCTTAGACTGTACTCCACT ATGTGGGATTAGCGACAAATCTAAAATAATTATTTTGGATAGTTGTCACC CGAAATTGAGTATTGGCATTGTATTTTAGTTTACAAATAAGATTGAAACG TTAACTTTTCAACATTATCTTATAATAGTCCGCGCATCAATGGACCGAGT CATTGGAAATATCACCGAAGCTCAAAACGTCAAAGACAATGGTAAGACAA TCTCCTTGGAATTTTATCCATCCAGCATAATACCTTAGGTCAAGGAAGGG AAACAAAGAAATTGCACTACCTTCATATCAGCTTGTCGCATAATCAACTT GGATTCATTTCCCGGTGGGTAGTACTAGGTTTGCCAACTGATGGTATGTT CAACGAAAAATTGGCTTTTAGAATTGCACCTTTACAGTGAAGCAAAAAAT CGGAGAAGTTCAAACCCTTAACTGCATTCTTCTCAAATTTTCAAATCTTT CAAGCAAAAATAAATCAGAATTTTCAAGCAAAAATTTGCAATTTTTCCTG GATTTTTGCAGAAATTTCCACCCTTAAAGTGCGTTTATCGAAAATTATAC CCTTACAGTGAGTGCATTTATGCTTTCTTGAAAAATATACCCTAAATCGC TGCACATACCCGTCGGTCAATTTGCCTGACTGCTTCCCCCCCCCGGATTC ATTTTTTTCACTGGCCTACTGGTAGATATAAGATTTTATCATAATAACGG GGAGCTTTGCTTTTCTAATTGACTTGGATATCTTTTGCTATTTTAGATCT TGGAAAACACATCAAATGGGTTACTTACAAAAAAGGATTACAACTTGTTA AAACTTTGTAAGTTATTCTCGTTTCCAGTCTTTTCCATCACAATCATGTG ATAGCTTTTTGAGCAGAACCAATATATACATTTTTAAAATCCAGCGTTTT ACTGAAGAACTACTCGGTACCAGAGTGTATCTCACGTTTATCGCTTCGTA GTACCTCTACGGGGATGAATCTTGAAATTAGCCGTAGAAATTGGGTCTGT GTACAGATAACTGAAAAACACGATTGCTTTATGTTTTCAGCGTTCAAGCT TACTTTTTGAGAAACACCCCTGTCTCAGTGACCAATGAGAATGTTCGTTG ATATAAAAAACTTCATCTTTTTATGCAGTCCGGTCTTATTTAGGATTTCA TTATTTTTCATCATAGGAAGAAGCCAATGATGTTAATCATCACCAAATCT TATTGTGGTGCTTGTAAAGGTATTACAAATCTCCCCCCTTTATAAGCAAC AAATATGTCACCAATTATAGTGGAATCTCCATAAATCGAACACACACAGA GAACAAAGAATTTGTTCCAGTTGAGGAAATTACAGTGGAATCTCCAAATT AATTTCGAGATATTGAGTTATAGAGGTTCAAATTATTGAGACTGTACTGT ACATGTACAACACTGTGGTCTCTAAGATTTTTCTAACAAGTCAGATTTTC ATGGACTGTTTATTTCACAATTCTACAATATGCCTGAATCGTTTGTTCAA ACAACAACCCAACACTTAAAAAGCATTGTAATAACATCAAATGAGAAATG GATTTCAAATTTATTACTATTTCAGCTCTCAAACCAAGAATTCAAAGAAG TAAAGAATTTGCTGAGCTCAGCAAGAAATTTGTCATGGTTACTGTTGAAG TAAGTTGATTCTTTCACACAAAAAAATTCTAAACTTGAAACACCACCTTC TCACAAACCTGGTAGGATTTTTCATCCAGTAGGATAAAAATGCTAGACTG AAAGTCAATGAGGATATTCCCATGTTTTTAAGACTGTGGGCTTCTATTCC ATTGTTTTCAAGTCAGCAAATTCAGTGGGAATGGAAAAAATAGCACAATT TTTTACAGTGAGGATTTGTTTATTTGAGTATTTTTAGCGGGGACTAACCT ATAAATTTCTACTGGGAACGATATTTTGGCTAATTTTTCCAGTAGGAAGG GGTTACATCTGGTCTGTGTGAAGGGGGTTTCTTAAAATAGAGGAATATGT ATTTAGCTCTTATTTTATTCAGTCTTTTCAGTTAAACAATCCTTAATCTA CCAGTTAGACTCTTAGTAATTATAGTTTAAACCAGAAGATGTGACGGATC GGTATATTATGGAATAAACTTTCGAATTTAAGGGGCGATTTCTTAAACGC AAATCGAATGTTTTCTTTCATTATAGCGGTAGTTAAGTAACTATTAAGGG CTATTAAATTAAGATATGGAATCAAGTCCAAATGTTTCATGTTAAATGAA ATCTAGTATCCAATTAGTCTACACAATAGACAGCTCCAGGCTTTTAGGCC TTACTCTTGGTATAGGCAGCCACTAATAACCTAGTACCACATGAAATTTT ATTTTCATTTTCTCGCAGGATGATGATGAACCAGATGAAGATCAATTTGA TGTTGATGGTGCCTACATTCCAAGAATATTCTTCTTAGGTAATTTAACCC TCAAATAATTCATACGAATGTAGTCTAAGGTCCCAAATAAATAAACGTCC CCACCCGGTTATTAATTTTCTAAAAGTTTTCGGTCCAACCCCTCCCCCGC TTTTTTATTCTAAAAATATTGTCAGCTATCAATAAGCTGAATTGCTCTAA ATTGCTTGTTTTTAATTAATCGTAGAAATTTTAGCGTATATTAGCGTCAG GAAAATCTTGATTTTTTTTGGATTTATTTTAGCGAATCACGATTTCAAAA AGTTTTGCGTGGATAAATTTTAGCGAATATTCGTATTACATCATTGACTG AGTTCGTTTTCTAGCATTTCTCTGCACTGAAACCCTTCGTATTGACAAAA ATGTATCAAGGCAATAAAACTAGAAATTTCGCGCGGATAAATTTTAGCGA TCTGTCGATTCGGCGTGTTTTAGCGAGATTTATTTTAGCGAAAGTAGGGA AAACTCGCTAAAACGCTAAAATTAGTCTCGCTAAAATTTCTACGATTAAT TGGAGATACAATTTCGGACAATCTTTTATTCGGATCCCATCTACTAGTCG AGACCTTAAAGTAGCCTAGGAGTGGGCGCCAATTTTTCCCCTGGATTGTC CCCCCTTACTCTTGAGCAAAGAGGCTTAAAATGTGTACAATTCATGAACC AGGGCCACCGTGCTCTAAAAACAACTTTCTGCTGGTCTAAAATTTTAAAT GCTTTTGCTTCAAACCAACGAGAAACCGTTATATGGTTTTCAATATAATG AGCACATTTCCTTAATACACACCCCTCCTCTTTATATATTACAGACAGCA ATGGTAAAGTTGACGAATCCCTACGCAATGAAGGAAAATCTTTCAAAAAA TCACGATACGCTTATGGAAATGTTGACCAATGTAAGAATTTTATTTATCT CCAATACTTACAGTTATAATTAGTTGGGTAACCTAATTGAAGAGATCCGA ATTGCCGTTTCTGATTCTTCACCTTACATAAAGGTTCGACTCGATTTTAC GAAAATAAATTTCGCGAATCGGAAGAGATCACTGACTTACGAAATTAAAT GCAGGCGAAATTTTTAAATCATAAATTTGGGTTTAATGTGTACTATAAGT TTGTTATGGCGAAAATATGCGTTTTGAGGGCGATGCTCAGTTCACTTTTT GGTTGTTTCGCAAATCGACTTGAAACCTAATGTTTTCGAATCTCTCGAAA CGAAATGACAATCACCAAACCTATGTCTATATTCAACAATAACCTTATTT TATCTGTTTTTCCCAGTGATGACTAACATGAACAAAGCTTTGGAGATGAA ACTTGGTGAACGAACAGAGGATCACCAATACACACAACAACAACAACAAC AACAACAACAACAAGATTCTCAGAACACTCAACAAGAATCGCAGAACACT CAACAAGAACAAACACAAACTCAGCAACAACCAAAAGAAGAAGCCAAGCA GAAAACTGATGGTGAGTCTACCTCAAAATTTTGAAAATCGAGTCAAAATT GACAAAAATTTGGGGAAAAGTCTCTCCATTAAGGGTCCTAAATACGTCAA TTTTTTCTCTCTCTCAGGGTCTATTTTCGATTTTTAGCTCAGACTTACCC GTAACCTCGCAAACCTAGTACCTCTTAGGCTGTTACCCTCTCTTAGACAG GGATTTGCAGCAGAAAACTGCTGGAACGCAAAATTTATTAGTAACGTTCA TCTAACATCAAATGAACGTTTGGCATTGAACATTGTTTCTAAGACATTTT TGCCACATTTTTAAAACCATCATTTTAAGCGTCATAAAAATTATTCTTTA TGTCTTTTCTTCTCGCAAACTAAAATGAATAGACAAGGTTAAGTAGGGAA ATTCAGGGGAAACAGAAGTGGTATCTTTCCCTACCTACCCTAGTTCATTT ATCTTACCAACATTACATTAGGTTTTGGCACCAACATCAGATGGTACAAT TATACAGTTGGAGTACAACAAGTGAAGAAGAATCACATGATTGGTCTTGT CGTATTCTACAATAACTATTGTGAATTCGCTCGATGTAAGTTTCTCCATT TATTCACCCCTGTGTCACAGACCCGCTGGGACCCAAGCCAAGCCCCACTG GAAAATTTGGCCAAAGTTTCGTCCCCGGTGGGAAAAATACCCTACAATTT CAGCCTCACTGGAAAACTCCTTATAGGTGTTTTTATTTTTCTAGAACAGC GATGCATCGTGGGATGAGGAATTCCTAAGAGATTTCTATTGTAATACCCC CGAAACAATCCGAAACAATCAAAAACTCTGATAAGATCTATTGACTTTGA TTTCATCCCCATTCGAAATTCAATGTCAAAAATTACACTGCCGAAACCAT CACCAGAACGATAGAACTTAATATTCCAAGGGGATTTCAATAGAATTTAT CCCCGCTTTGGGAAAAAGTTCCACTGGGGCTGTGTGACAGTAGTATATTC ATTTGTAATTATGGAATTATAAATAGCTGTAAATAGCATTGATAACTGTA TCATAGAAATCTGCTCTCCTAAATGAAGTTTGCGCTCCTTTTGGCTATGA TGCTTGTTAGAAAATTTCACTTGAACATAAAAATTTGATACCTTAAGGGA ACTTATTTTGGCAGGAACTAATTTTGACGAGCGGCAAAAATCCTGAAAAT TTTTAATTTTGGCGAGAACTTATATTGGCGATCGATGAATTTTTTTCATG GTTAAGATGTGAAATTTATATATTAACGCGATTCTTTGTATCATTTTTTT AGACATGAAAGAGCAGCTCAATGAATCACCAGAGATCACTGAACTTTCTA ACAAATTTGTTATGATTCGTGTCAGCGTACGTAGAAATTGCTTCTTTATG GAAATCCATTGTCAATTTGTTTTGATTTTTTAGCTAAGAGATTTGTAGAA GTATTACATCACCCTCAGATTCGAAAAATTCCAAAGAATACTTCACCCTC CGCCAAAAAAAACACTATTCTTATAAAAAAGGGTGTATTTGACGGAAAAA TGATGAGTATTTCGGTATTGATCGGTCGTATAATATTTCCGGTATTCTGA TACTCGTGGTAGCATTTTGACCGGTATTTGAAAACTTTTGTCGGGTACGC TGGTATTCCGGTATTTTGTACCCTCGGAAGCAAGCCCCATCAAAGAATTG ATGTCAGGTACTGGTATCGTCCATGATGAAGTAAAAATTTAAGAGTGTTA TAAAATATCATTTAGATTTTAAATTGATTTATATTCAGGAAGAGGAAGCG AAAGAAACGAAAGAAAAATATGATGTCGATGGAAAATATTCACCAAGGAT GTTCTTTATCGGTAAAATTGATATTTCCGAGCATTTTACTATTAGAAACT TTGGAGTTTGCGAAAACAGGTGTAGTTTTGGTTGATCAGAATATTTTTTC ATAAGAATTACCTTTCCAGCGTGCCTCATCTTTGGAAAAGGTCCAAGTTT AAAATTACGGCAGCCGAGAGAAATTTTTTACCCAATATTTCATCTTCCCC TTCACATTTCAGATCCTGATGAGAACGTCCAGGTCAATCTCAACAACAGT TTGATCGACTCACCATACGATTCCACCCTCTTTTACTACGGTACCGATAA AGAGATTCTCAGCATGATGAAAAGCGCCCAACAAACAATGAATATCACCC TCGGGCGGGGATTTGGTGAATACATTGACTGGGTGGCCTATCCAAGGGCG TTGGAGTTATGCAAGGAGAAAAATATGCCAATGATGTTAATTATCCATAA AACGTGGTGTGGTGCATGTAAATCTTTGAAACCAACGATCAAAGATTCGA GACCTATCTGGGAATTGAGCAAATATTTCATCATGGTTAATACTGAGGTT AGTGGAGACAAAAAGATTCGATCGATTGTAGATCTACAACTGAAATCTAT GTAGGGTCTATGATAATCTGAATTGCAGATCTTTAGAAAACTGCAGATGC TATATTCATGATGCGCCATTGCAATGTCTTCTGACATTACATCACGGACC CAACAGCTGATTGGTTGTAAGTGACGTAAAATCACTTTTAACAAATCAGG TGTTGGGTCCGTGGAATATATTGCAATGGTGCATATCATGAATAGGGAGA GGATTTTTAGCAACCTGGGCCTATAAATGGTAGCACAAGAAACTTTTGAC GTGATGAAGCAAAGTAAATAAATCTTTTCCCATCTTAGGATTCAGAGGAG CCTCATGACGAACAATATTTCATTGATGGTGGATATTATCCAAGAATTTA TTTCTTAGGTAAGTGCTTCTTTATACTGGCAATGATCATAAACATTACCG AGTTGGCTTGTGATAACTTCATCAATGATCATTGACCTCATATTTATCAT TTTCGCTTTTGTGTAGCTCCGTCGGAAAAATAAGAACAAAGCTATCTACT TAAACTTCAATTAACTCCAGCGTTATTCATGGTCTGGAAGCTAATGAATC GTATTATTTGATTTTCTTCTTCGGAAAGAAAGGAAAGAAATAAGTCCTAC CGATGCAGGAGGAGAGACGTCTACCATACGCCTTCTCGCTACACTTACCT CGGAGTGTATTTGTTTCCTAGGGTAATTCCCTCGTGTAGGAATTCTGTCT TCTCAGAAATATCTGGATAATGCATGAGAAAAAAGACTCTTTCGTTTAAC CTACTCTGTGACAATCAACCAATACTAACGCTTAACCTTTAATCTTCTTT TCATTTAGATTCTCAAGGCAAAGTACACCATGACCTTCACAACAGAGATC CCGCCTTCTTGAAATACAAATTTTCATTCGCCTATGAAGAACAAAGTAAG TGATACCAAAGTGACAACACTAATTAATGTCGTTGCAGAAATTCTTCCGA AAACAAACAAAAGTTTAGCCTGTAACAGAGTGAACAAATAAAGTTGGTTA CCTAAAAAGTATAGGTTTTACGACCTTAAATTCAATTGTGTAACCTCTAG GTCTGAAAATAAACTTGATTTATTGAAGGGATTTTTGATAAAATTTTGAA TAAATTTTACGACACTTAGTATTAGGTGCCAAATAAACGGGGGGTGGGAT AAACGGGGGTGGGGGTGGTTGGAAAATTTTTGAGATTTCAATAAACCTAA TTGCCGGGGGGGTTGGAAATTGTACTTCTGAAAACCCAAAAATTAGGTAA ATATAGGCTAAAATCAGGCTATTTAGAGCAAAATGAGAGGCCTTCCCTTT GACAGCTGAAAATATTTTTTAAATTGGTAAACGGGGGGTCCTAATAAGGT GCGGGGGGTGGGGTTGGAAAATTTTCGAAAAATTAACAAGCGGGGGGCCC GTTTATTTGGCACCTAAGAGTAAGCACAAGCTAATCATAATTCTTGAAAT TAGGTATTTAATGAAAGTACCTATAAAAGTGAATTATACAATATTAAATT ATTGTTGGTTAAGAGACCTGTGATTTTAAGGGGTATCCACTTGTACCAGA GGCTTTATATTCTTCATGTTCGAAAAATTTGAAATTTTCAATCCACGCTA TAAGAAGATGTTGTTTATGCATTCATAGACGCTCTTGGACGTTATATGGA CGTCGAAACAGCGTTTGTTTGTCCATTTTGTTTCTTCATTCACACACAAA ACACGTTGTAATTTATCATCTCCACTTTTCTAGTCTTGCAAACGATGAAA TTTGCTGTTGGGAAGTTTTATAACACACAAAACACTGCACAACAAAACAC ACAACAACAAACCACACAACAACAAGAAAAACAACAACAAAAACAGGGTA AATCATATTAATATTTCCATCATGGCGTTCTAAATCTGATTTCTATTTTT TAATCTATTCTTCAATCCGATGCAGAACTTTAGCCTAACAAAGATCTTCT TTTTTCTGTGAGGCACATTGTGGCTCATCGTTTTATAAGCTATAATTATA TTAAAAAGTTGCGCCAGTCGTTAATTATTGCAGTCCATCGAACTCAATGC TAAAAATATGGGGAAAATATGGTTAATTCTTTGTGTTTTGCTACACACAA AAATTAAGGACCGGCCCAGTCTCAGCCAAGAATTACTTTATCTGATATTT CGATGACGGGTTGGCGGCCGCCCACGCTAAAGCTCTAAAGGAGCGGGCCA ATTTCCCATCGAAGAGGAGTGATCGTCGGCCTATGATGTGCCGCATCACC AGTCGTGTTCAACTACCCTTGTGCATAAAGCTAAAAATATTTCGGTTGGA CCCTCCAATTCCCAAAAACGATGACTGGGTTACCAGACCTCCTGCTGCAA AATTCTTGACGCGGTCTTGCAAAATTCCGTAATGTAAACCTTCCAGATGT CGAAATGTTTTCCAACCTTCAGAGCTTTAGCGTGTCGAATGAAAATTTCT ACATCTTCGTAATCTGTTTTTTATTTACTTCCCAGAAACTAAAACAGAAG AAGGTAAGAAAGAGAAGAGCACAACATTATCTCCTGGTAAACGATTGTTA TCAAACAGTGGTCTCAAATGGAATAACATTAATGCTGCTCTGGAAGAAGC AAAGGAAAGGTAAAGGTTGTTTTTTGAGTACGATATCAAAGTTGCTTTAA TCGGATTAAATTTCGCGTGAATTTAATTTCGCGAATAAGCCTGAAAACAG CTGAAAATAGGCATTTTTTTGCCACAAATGGAGACTTTGGATTGGTTTCT CCGCCGGAAATTCGATTTAAAAAGTTTTGCGATAGATTTGATTTCGCGAG TGAGGAATTTTGCGCGTTTTTGCGAGTTTTAATTTTACGAATGGCAAAAA CTCGCAACATCGTGAAATTTAATCTCGCGAAAGTTAATCCGGTTAAAGTA TACCATATGGAAGTAGTCAAAGAAAGGTTTTTTGTCTGAAACGGAAAACG AATTTTACACAGCAATAAATAAGTGCATATTCTTGAACTTTTGGTGAAGT ATGCAGAATTTTGAGACCGAAAATACTTCTTTATATACTTTAATAGGATA AACTTTCGNTGGTGAAGTATGCAGAATTTTGAGACCGAAAATACTTCTTT ATATACTTTAATGGGATAAACTTTCGCGGGGATTAAATTTAACGGTTACG CCTATCCGCGAAATTCAAAAACTTCGCGGGGACTTAATTTCGCGGGTGGC ACTATTGGGTGTCAATATTTTCACGATTTTGTGACTTTCACTGTCAAATC ATACATGTTAGTTGTTGAAATACANNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNTTTTGAGTTTTGTTTAGAAATATTTCGCGGATGAAGCCCTT CCAAATTTCCATTGGGACTTAATTTTGCGGATTTTCGCGGATGACACCAA AATCCGCGAAATCCACGAAATTTAGTCCCCGCGAAAGTTTATCCCATTAA AGTACTTCACTGTGATGGAAATCTGCCTGCCTGAAACGGAAGAACGTGTT GTATGTTCCATTCATGATACTGTATTCATATTGTCATACCGTAGTTTCGT GATATGAAAGCTTTGCCAGTAGTGCACGCTTTGACCTTGACACAAGCCAT AATGCTCTCTTTTTTTCTTTTATAGCCAAAAGCCAATTATGTTCTTAGTT CATCGCACAACTTGCCCCGCTTGTAAAGGTATTCAATATTTCGGAATCGC ATTTGTAAATTTTTGCATCAATCAACTCTAATTTCTGCCTCATTTACTCA AAATTATTACCAATATCTATATAATGGGCTCTTCCAGAAAATCAGTTCGT TGGGGGTGGAGAATATATTATTTTGTCAATTCAATTACCCCTGGACATTT TCATTTTTCACTCCCATGGGTTGTCATCAATTTAACACCTGGACACCAAA ATTTACCCCTGAACATAGCAGATTTACCCCCTGGACAATGCAATTCTTAG GACTGTTTTTGGGACCCCTGGGCAATTCAACCCTCCCCCATGGACGGACT TTTTTCTGGAAGAGCCCAATGCAAATTAATATAATTTAAAGACAAGGACA GAAATCCGAATTTTTACTGAGTTTTCATAAAATTCTTATTGAATGAAAAA TGATGATTTTTCTTTTGATAGCTACTATCAAGATGATTGTGAGAGATGAA GAGTTCAAAGAGAAATCTCAAGGATTCATCCTTGCTGACATTGAGGTAAA ATTTGTTAAGGGAGATAGTTGAAGCATTGAAAATTATAATATCAATTAAG AGACACACATGCATATATCCATATAAGGGATTCTGTCATTCAAACCAGAA ATTTGAACAATCTTTGAACAACTGGACACTGCTTCATTTTGAGGTTAGTT TAAAAAACAGTGGGATAAAATTAGAACATATCTACCGGGACACTAAGACA AAGGGGTCTACTTGGNAATATCAATTAAGAGATATACATGCATATATCCA TATAAGGAATTCTGTCATTCAAACCAGAAATTGCAGTGTATCTTTGAACA ACTGGACACTGCTTCATTTTGAGGTTAGTTTAAAAAATAGTGGGATAAAG TGGGACCATTTGAAACAATTGTTTTCTCCCTTTTAAAAACCTTAAGGACG ACGTTGATGATGAATTAGCTGATTCTTTTGATATCGATGGAACGTATGTA CCGAGAATTTATTTCTTGGATCCTGAAGGCAAGATATGGAAAGATTTATG GAACGTGGGTACAAGTTATTTGGACAACAAGTTCTACTTCTTCGAAAGCT CAGCAAGTAAGTTGTCTGTTTAATCTAAATAAGTTTGCATTTATCGACCC AGTGATATTCATATTGGAAGTTTATCGTGGCTTGGATCAAGAGATTTACG TTTGGCTACGTTTCGAGAGATTCTTCTCTCATCATAAGTTGTCTGTGTAG AATTTGATAATGTTGTCTGTGTTTTCACCATAGTATAAGAAGTATAACTA TGTTTTCACCCCCTACTAGAAAACTACCGTATGTGCATACAAAATTGAAC CCTTAGAGAATATCTGGTCAAACAGGGTCAAATATAAATAAATTTGGGCA AAAAATCGACCCTTACAGTGCATTTTCTTCAAACATTTATTTGTCAATCT TCAGGTATATGGCCAGATTTTTCAAAATTTTGCACAAAAATAAATGGTTT TTCTCACATTTGACACTCTTACAATGCACTTTGAGAAGTCTGAAATAAAC TTCCAATAAGTGGGCCGATAAACTTAAACTTTAGCTTTAATTTCTTTTTG GACCTATCTCGGAGGTCTAAATTAATAATCTAGTCTTAAATTAATACATT TAAAACTATTTTTCCAACGGGGTATCGTGATTTGTCCTTCAAGAGTTATG TATCAAAATGTACAGACTTGAAATATTATTGGAACAAACTTTAGTATTGG AAAGACTTGAGTCTAATGAAATTCGAGGGTTTTGATTGTTATTGCTAGTG TTATCAACTATTTCAATTTTCTTTTTAGTCTATCGAGCAATGGAAAAAGC CAAGGAAAAGATGTCAGCGTGGAAACCAGGGGACCAGTCTGAAGAGACTA ATCGAGTTGTCAAAAAACCAAAAGATGAATTATAGTTTTAAATTTCTATT TCTAATTTAAGTTAATTTTTGTACTTTTATTTCCTGATTTTATTTATTTT TCTTTTTTTTTTTATTTCAACCATGATCATGTTTTTTTGTTCTGGTTTTG TTTTTGATGTTTCTGAATCTGCTTTTTG

Coding sequence (CDS) from alignment at sc0000010:965417..981344-

>TCONS_00001510 ID=TCONS_00001510|Name=TCONS_00001510|organism=Clytia hemisphaerica|type=CDS|length=80214bp|location=Sequence derived from alignment at sc0000010:965417..981344- (Clytia hemisphaerica)
TCTATCGAGCAATGGAAAAAGCCAAGGAAAAGATGTCAGCGTGGAAACCA
GGGGACCAGTCTGAAGAGACTAATCGAGTTGTCAAAAAACCAAAAGATGA
ATTATAGGACGACGTTGATGATGAATTAGCTGATTCTTTTGATATCGATG
GAACGTATGTACCGAGAATTTATTTCTTGGATCCTGAAGGCAAGATATGG
AAAGATTTATGGAACGTGGGTACAAGTTATTTGGACAACAAGTTCTACTT
CTTCGAAAGCTCAGCAACTACTATCAAGATGATTGTGAGAGATGAAGAGT
TCAAAGAGAAATCTCAAGGATTCATCCTTGCTGACATTGAGCCAAAAGCC
AATTATGTTCTTAGTTCATCGCACAACTTGCCCCGCTTGTAAAGAAACTA
AAACAGAAGAAGGTAAGAAAGAGAAGAGCACAACATTATCTCCTGGTAAA
CGATTGTTATCAAACAGTGGTCTCAAATGGAATAACATTAATGCTGCTCT
GGAAGAAGCAAAGGAAAGTCTTGCAAACGATGAAATTTGCTGTTGGGAAG
TTTTATAACACACAAAACACTGCACAACAAAACACACAACAACAAACCAC
ACAACAACAAGAAAAACAACAACAAAAACAGGATTCTCAAGGCAAAGTAC
ACCATGACCTTCACAACAGAGATCCCGCCTTCTTGAAATACAAATTTTCA
TTCGCCTATGAAGAACAAAGATTCAGAGGAGCCTCATGACGAACAATATT
TCATTGATGGTGGATATTATCCAAGAATTTATTTCTTAGATCCTGATGAG
AACGTCCAGGTCAATCTCAACAACAGTTTGATCGACTCACCATACGATTC
CACCCTCTTTTACTACGGTACCGATAAAGAGATTCTCAGCATGATGAAAA
GCGCCCAACAAACAATGAATATCACCCTCGGGCGGGGATTTGGTGAATAC
ATTGACTGGGTGGCCTATCCAAGGGCGTTGGAGTTATGCAAGGAGAAAAA
TATGCCAATGATGTTAATTATCCATAAAACGTGGTGTGGTGCATGTAAAT
CTTTGAAACCAACGATCAAAGATTCGAGACCTATCTGGGAATTGAGCAAA
TATTTCATCATGGTTAATACTGAGGAAGAGGAAGCGAAAGAAACGAAAGA
AAAATATGATGTCGATGGAAAATATTCACCAAGGATGTTCTTTATCGACA
TGAAAGAGCAGCTCAATGAATCACCAGAGATCACTGAACTTTCTAACAAA
TTTGTTATGATTCGTGTCAGCGTTTTGGCACCAACATCAGATGGTACAAT
TATACAGTTGGAGTACAACAAGTGAAGAAGAATCACATGATTGGTCTTGT
CGTATTCTACAATAACTATTGTGAATTCGCTCGATTGATGACTAACATGA
ACAAAGCTTTGGAGATGAAACTTGGTGAACGAACAGAGGATCACCAATAC
ACACAACAACAACAACAACAACAACAACAACAAGATTCTCAGAACACTCA
ACAAGAATCGCAGAACACTCAACAAGAACAAACACAAACTCAGCAACAAC
CAAAAGAAGAAGCCAAGCAGAAAACTGATGACAGCAATGGTAAAGTTGAC
GAATCCCTACGCAATGAAGGAAAATCTTTCAAAAAATCACGATACGCTTA
TGGAAATGTTGACCAATGATGATGATGAACCAGATGAAGATCAATTTGAT
GTTGATGGTGCCTACATTCCAAGAATATTCTTCTTAGCTCTCAAACCAAG
AATTCAAAGAAGTAAAGAATTTGCTGAGCTCAGCAAGAAATTTGTCATGG
TTACTGTTGAAGAAGAAGCCAATGATGTTAATCATCACCAAATCTTATTG
TGGTGCTTGTAAAGATCTTGGAAAACACATCAAATGGGTTACTTACAAAA
AAGGATTACAACTTGTTAAAACTTTTCCGCGCATCAATGGACCGAGTCAT
TGGAAATATCACCGAAGCTCAAAACGTCAAAGACAATGACAGCGATGGTG
ATTTGATTGAAGAAGAATTGAATTATGGAACAAAACATAAACATGTTCTT
CATTATTATGGTTCAGGAAAAGAAAGAAGATGACATTGTGAAAGAAAGTG
ATAAATACAGAGCTGATGGAGAATACTATCCCAAAATATTATTTATTGGA
TTGAAACCATCATTCGCAGCTTCAGATGAGATCAAAGAAGTAGCGGACAA
GTTCATCATGATTAATACTGACGAATAAGCCAATTCTTGCTGTTTTCCAT
CAAGACTGGTGTGGTGCTTGCCAACTTTTGATCAGTATGGAAGTATGTTT
GGAGCACCAGTTCTTGGATAGTGGTTTCGGTAAAGACTATGTGTGGTATG
AGTGGACCTCAGGCTTGGCGGCTGCAAAACAACAATCACAATGGTGTCAT
GATGCGGGAATTGGACAACAAGAATAAGAAATCCGATAAAACAAAATACT
TCTACAAAAAAGTTTCTGATGAACTGATCGAAGATTTCGAAGCGTCCAGT
GAGTTTGTTGAACAAAGCAAGAAATTCCTACTGGCAAAAGCTGAAGATAA
AGAGATTGGCAAATTGGGTGCATATAAAAGCGAAGGAAAATATGTCCCTA
AAATCGTATTCATTAGACGCTTCCAATCTTATTGTTGAGTACTCGTTCTA
AATGTAAACCCTGCAAAAAATTGACATGGCTGAAACTTGATGATGCATTA
TCCCAAGCTAAAGAAAAATGTGGGCCCTTTGGTTCTTGTTTTCGATTGTT
GCTACATCAGCATCAGTCTATCGAGCAATGGAAAAAGCCAAGGAAAAGAT
GTCAGCGTGGAAACCAGGGGACCAGTCTGAAGAGACTAATCGAGTTGTCA
AAAAACCAAAAGATGAATTATAGGACGACGTTGATGATGAATTAGCTGAT
TCTTTTGATATCGATGGAACGTATGTACCGAGAATTTATTTCTTGGATCC
TGAAGGCAAGATATGGAAAGATTTATGGAACGTGGGTACAAGTTATTTGG
ACAACAAGTTCTACTTCTTCGAAAGCTCAGCAACTACTATCAAGATGATT
GTGAGAGATGAAGAGTTCAAAGAGAAATCTCAAGGATTCATCCTTGCTGA
CATTGAGCCAAAAGCCAATTATGTTCTTAGTTCATCGCACAACTTGCCCC
GCTTGTAAAGAAACTAAAACAGAAGAAGGTAAGAAAGAGAAGAGCACAAC
ATTATCTCCTGGTAAACGATTGTTATCAAACAGTGGTCTCAAATGGAATA
ACATTAATGCTGCTCTGGAAGAAGCAAAGGAAAGTCTTGCAAACGATGAA
ATTTGCTGTTGGGAAGTTTTATAACACACAAAACACTGCACAACAAAACA
CACAACAACAAACCACACAACAACAAGAAAAACAACAACAAAAACAGGAT
TCTCAAGGCAAAGTACACCATGACCTTCACAACAGAGATCCCGCCTTCTT
GAAATACAAATTTTCATTCGCCTATGAAGAACAAAGATTCAGAGGAGCCT
CATGACGAACAATATTTCATTGATGGTGGATATTATCCAAGAATTTATTT
CTTAGATCCTGATGAGAACGTCCAGGTCAATCTCAACAACAGTTTGATCG
ACTCACCATACGATTCCACCCTCTTTTACTACGGTACCGATAAAGAGATT
CTCAGCATGATGAAAAGCGCCCAACAAACAATGAATATCACCCTCGGGCG
GGGATTTGGTGAATACATTGACTGGGTGGCCTATCCAAGGGCGTTGGAGT
TATGCAAGGAGAAAAATATGCCAATGATGTTAATTATCCATAAAACGTGG
TGTGGTGCATGTAAATCTTTGAAACCAACGATCAAAGATTCGAGACCTAT
CTGGGAATTGAGCAAATATTTCATCATGGTTAATACTGAGGAAGAGGAAG
CGAAAGAAACGAAAGAAAAATATGATGTCGATGGAAAATATTCACCAAGG
ATGTTCTTTATCGACATGAAAGAGCAGCTCAATGAATCACCAGAGATCAC
TGAACTTTCTAACAAATTTGTTATGATTCGTGTCAGCGTTTTGGCACCAA
CATCAGATGGTACAATTATACAGTTGGAGTACAACAAGTGAAGAAGAATC
ACATGATTGGTCTTGTCGTATTCTACAATAACTATTGTGAATTCGCTCGA
TTGATGACTAACATGAACAAAGCTTTGGAGATGAAACTTGGTGAACGAAC
AGAGGATCACCAATACACACAACAACAACAACAACAACAACAACAACAAG
ATTCTCAGAACACTCAACAAGAATCGCAGAACACTCAACAAGAACAAACA
CAAACTCAGCAACAACCAAAAGAAGAAGCCAAGCAGAAAACTGATGACAG
CAATGGTAAAGTTGACGAATCCCTACGCAATGAAGGAAAATCTTTCAAAA
AATCACGATACGCTTATGGAAATGTTGACCAATGATGATGATGAACCAGA
TGAAGATCAATTTGATGTTGATGGTGCCTACATTCCAAGAATATTCTTCT
TAGCTCTCAAACCAAGAATTCAAAGAAGTAAAGAATTTGCTGAGCTCAGC
AAGAAATTTGTCATGGTTACTGTTGAAGAAGAAGCCAATGATGTTAATCA
TCACCAAATCTTATTGTGGTGCTTGTAAAGATCTTGGAAAACACATCAAA
TGGGTTACTTACAAAAAAGGATTACAACTTGTTAAAACTTTTCCGCGCAT
CAATGGACCGAGTCATTGGAAATATCACCGAAGCTCAAAACGTCAAAGAC
AATGACAGCGATGGTGATTTGATTGAAGAAGAATTGAATTATGGAACAAA
ACATAAACATGTTCTTCATTATTATGGTTCAGGAAAAGAAAGAAGATGAC
ATTGTGAAAGAAAGTGATAAATACAGAGCTGATGGAGAATACTATCCCAA
AATATTATTTATTGGATTGAAACCATCATTCGCAGCTTCAGATGAGATCA
AAGAAGTAGCGGACAAGTTCATCATGATTAATACTGACGAATAAGCCAAT
TCTTGCTGTTTTCCATCAAGACTGGTGTGGTGCTTGCCAACTTTTGATCA
GTATGGAAGTATGTTTGGAGCACCAGTTCTTGGATAGTGGTTTCGGTAAA
GACTATGTGTGGTATGAGTGGACCTCAGGCTTGGCGGCTGCAAAACAACA
ATCACAATGGTGTCATGATGCGGGAATTGGACAACAAGAATAAGAAATCC
GATAAAACAAAATACTTCTACAAAAAAGTTTCTGATGAACTGATCGAAGA
TTTCGAAGCGTCCAGTGAGTTTGTTGAACAAAGCAAGAAATTCCTACTGG
CAAAAGCTGAAGATAAAGAGATTGGCAAATTGGGTGCATATAAAAGCGAA
GGAAAATATGTCCCTAAAATCGTATTCATTAGACGCTTCCAATCTTATTG
TTGAGTACTCGTTCTAAATGTAAACCCTGCAAAAAATTGACATGGCTGAA
ACTTGATGATGCATTATCCCAAGCTAAAGAAAAATGTGGGCCCTTTGGTT
CTTGTTTTCGATTGTTGCTACATCAGCATCAGTCTATCGAGCAATGGAAA
AAGCCAAGGAAAAGATGTCAGCGTGGAAACCAGGGGACCAGTCTGAAGAG
ACTAATCGAGTTGTCAAAAAACCAAAAGATGAATTATAGGACGACGTTGA
TGATGAATTAGCTGATTCTTTTGATATCGATGGAACGTATGTACCGAGAA
TTTATTTCTTGGATCCTGAAGGCAAGATATGGAAAGATTTATGGAACGTG
GGTACAAGTTATTTGGACAACAAGTTCTACTTCTTCGAAAGCTCAGCAAC
TACTATCAAGATGATTGTGAGAGATGAAGAGTTCAAAGAGAAATCTCAAG
GATTCATCCTTGCTGACATTGAGCCAAAAGCCAATTATGTTCTTAGTTCA
TCGCACAACTTGCCCCGCTTGTAAAGAAACTAAAACAGAAGAAGGTAAGA
AAGAGAAGAGCACAACATTATCTCCTGGTAAACGATTGTTATCAAACAGT
GGTCTCAAATGGAATAACATTAATGCTGCTCTGGAAGAAGCAAAGGAAAG
TCTTGCAAACGATGAAATTTGCTGTTGGGAAGTTTTATAACACACAAAAC
ACTGCACAACAAAACACACAACAACAAACCACACAACAACAAGAAAAACA
ACAACAAAAACAGGATTCTCAAGGCAAAGTACACCATGACCTTCACAACA
GAGATCCCGCCTTCTTGAAATACAAATTTTCATTCGCCTATGAAGAACAA
AGATTCAGAGGAGCCTCATGACGAACAATATTTCATTGATGGTGGATATT
ATCCAAGAATTTATTTCTTAGATCCTGATGAGAACGTCCAGGTCAATCTC
AACAACAGTTTGATCGACTCACCATACGATTCCACCCTCTTTTACTACGG
TACCGATAAAGAGATTCTCAGCATGATGAAAAGCGCCCAACAAACAATGA
ATATCACCCTCGGGCGGGGATTTGGTGAATACATTGACTGGGTGGCCTAT
CCAAGGGCGTTGGAGTTATGCAAGGAGAAAAATATGCCAATGATGTTAAT
TATCCATAAAACGTGGTGTGGTGCATGTAAATCTTTGAAACCAACGATCA
AAGATTCGAGACCTATCTGGGAATTGAGCAAATATTTCATCATGGTTAAT
ACTGAGGAAGAGGAAGCGAAAGAAACGAAAGAAAAATATGATGTCGATGG
AAAATATTCACCAAGGATGTTCTTTATCGACATGAAAGAGCAGCTCAATG
AATCACCAGAGATCACTGAACTTTCTAACAAATTTGTTATGATTCGTGTC
AGCGTTTTGGCACCAACATCAGATGGTACAATTATACAGTTGGAGTACAA
CAAGTGAAGAAGAATCACATGATTGGTCTTGTCGTATTCTACAATAACTA
TTGTGAATTCGCTCGATTGATGACTAACATGAACAAAGCTTTGGAGATGA
AACTTGGTGAACGAACAGAGGATCACCAATACACACAACAACAACAACAA
CAACAACAACAACAAGATTCTCAGAACACTCAACAAGAATCGCAGAACAC
TCAACAAGAACAAACACAAACTCAGCAACAACCAAAAGAAGAAGCCAAGC
AGAAAACTGATGACAGCAATGGTAAAGTTGACGAATCCCTACGCAATGAA
GGAAAATCTTTCAAAAAATCACGATACGCTTATGGAAATGTTGACCAATG
ATGATGATGAACCAGATGAAGATCAATTTGATGTTGATGGTGCCTACATT
CCAAGAATATTCTTCTTAGCTCTCAAACCAAGAATTCAAAGAAGTAAAGA
ATTTGCTGAGCTCAGCAAGAAATTTGTCATGGTTACTGTTGAAGAAGAAG
CCAATGATGTTAATCATCACCAAATCTTATTGTGGTGCTTGTAAAGATCT
TGGAAAACACATCAAATGGGTTACTTACAAAAAAGGATTACAACTTGTTA
AAACTTTTCCGCGCATCAATGGACCGAGTCATTGGAAATATCACCGAAGC
TCAAAACGTCAAAGACAATGACAGCGATGGTGATTTGATTGAAGAAGAAT
TGAATTATGGAACAAAACATAAACATGTTCTTCATTATTATGGTTCAGGA
AAAGAAAGAAGATGACATTGTGAAAGAAAGTGATAAATACAGAGCTGATG
GAGAATACTATCCCAAAATATTATTTATTGGATTGAAACCATCATTCGCA
GCTTCAGATGAGATCAAAGAAGTAGCGGACAAGTTCATCATGATTAATAC
TGACGAATAAGCCAATTCTTGCTGTTTTCCATCAAGACTGGTGTGGTGCT
TGCCAACTTTTGATCAGTATGGAAGTATGTTTGGAGCACCAGTTCTTGGA
TAGTGGTTTCGGTAAAGACTATGTGTGGTATGAGTGGACCTCAGGCTTGG
CGGCTGCAAAACAACAATCACAATGGTGTCATGATGCGGGAATTGGACAA
CAAGAATAAGAAATCCGATAAAACAAAATACTTCTACAAAAAAGTTTCTG
ATGAACTGATCGAAGATTTCGAAGCGTCCAGTGAGTTTGTTGAACAAAGC
AAGAAATTCCTACTGGCAAAAGCTGAAGATAAAGAGATTGGCAAATTGGG
TGCATATAAAAGCGAAGGAAAATATGTCCCTAAAATCGTATTCATTAGAC
GCTTCCAATCTTATTGTTGAGTACTCGTTCTAAATGTAAACCCTGCAAAA
AATTGACATGGCTGAAACTTGATGATGCATTATCCCAAGCTAAAGAAAAA
TGTGGGCCCTTTGGTTCTTGTTTTCGATTGTTGCTACATCAGCATCAGTC
TATCGAGCAATGGAAAAAGCCAAGGAAAAGATGTCAGCGTGGAAACCAGG
GGACCAGTCTGAAGAGACTAATCGAGTTGTCAAAAAACCAAAAGATGAAT
TATAGGACGACGTTGATGATGAATTAGCTGATTCTTTTGATATCGATGGA
ACGTATGTACCGAGAATTTATTTCTTGGATCCTGAAGGCAAGATATGGAA
AGATTTATGGAACGTGGGTACAAGTTATTTGGACAACAAGTTCTACTTCT
TCGAAAGCTCAGCAACTACTATCAAGATGATTGTGAGAGATGAAGAGTTC
AAAGAGAAATCTCAAGGATTCATCCTTGCTGACATTGAGCCAAAAGCCAA
TTATGTTCTTAGTTCATCGCACAACTTGCCCCGCTTGTAAAGAAACTAAA
ACAGAAGAAGGTAAGAAAGAGAAGAGCACAACATTATCTCCTGGTAAACG
ATTGTTATCAAACAGTGGTCTCAAATGGAATAACATTAATGCTGCTCTGG
AAGAAGCAAAGGAAAGTCTTGCAAACGATGAAATTTGCTGTTGGGAAGTT
TTATAACACACAAAACACTGCACAACAAAACACACAACAACAAACCACAC
AACAACAAGAAAAACAACAACAAAAACAGGATTCTCAAGGCAAAGTACAC
CATGACCTTCACAACAGAGATCCCGCCTTCTTGAAATACAAATTTTCATT
CGCCTATGAAGAACAAAGATTCAGAGGAGCCTCATGACGAACAATATTTC
ATTGATGGTGGATATTATCCAAGAATTTATTTCTTAGATCCTGATGAGAA
CGTCCAGGTCAATCTCAACAACAGTTTGATCGACTCACCATACGATTCCA
CCCTCTTTTACTACGGTACCGATAAAGAGATTCTCAGCATGATGAAAAGC
GCCCAACAAACAATGAATATCACCCTCGGGCGGGGATTTGGTGAATACAT
TGACTGGGTGGCCTATCCAAGGGCGTTGGAGTTATGCAAGGAGAAAAATA
TGCCAATGATGTTAATTATCCATAAAACGTGGTGTGGTGCATGTAAATCT
TTGAAACCAACGATCAAAGATTCGAGACCTATCTGGGAATTGAGCAAATA
TTTCATCATGGTTAATACTGAGGAAGAGGAAGCGAAAGAAACGAAAGAAA
AATATGATGTCGATGGAAAATATTCACCAAGGATGTTCTTTATCGACATG
AAAGAGCAGCTCAATGAATCACCAGAGATCACTGAACTTTCTAACAAATT
TGTTATGATTCGTGTCAGCGTTTTGGCACCAACATCAGATGGTACAATTA
TACAGTTGGAGTACAACAAGTGAAGAAGAATCACATGATTGGTCTTGTCG
TATTCTACAATAACTATTGTGAATTCGCTCGATTGATGACTAACATGAAC
AAAGCTTTGGAGATGAAACTTGGTGAACGAACAGAGGATCACCAATACAC
ACAACAACAACAACAACAACAACAACAACAAGATTCTCAGAACACTCAAC
AAGAATCGCAGAACACTCAACAAGAACAAACACAAACTCAGCAACAACCA
AAAGAAGAAGCCAAGCAGAAAACTGATGACAGCAATGGTAAAGTTGACGA
ATCCCTACGCAATGAAGGAAAATCTTTCAAAAAATCACGATACGCTTATG
GAAATGTTGACCAATGATGATGATGAACCAGATGAAGATCAATTTGATGT
TGATGGTGCCTACATTCCAAGAATATTCTTCTTAGCTCTCAAACCAAGAA
TTCAAAGAAGTAAAGAATTTGCTGAGCTCAGCAAGAAATTTGTCATGGTT
ACTGTTGAAGAAGAAGCCAATGATGTTAATCATCACCAAATCTTATTGTG
GTGCTTGTAAAGATCTTGGAAAACACATCAAATGGGTTACTTACAAAAAA
GGATTACAACTTGTTAAAACTTTTCCGCGCATCAATGGACCGAGTCATTG
GAAATATCACCGAAGCTCAAAACGTCAAAGACAATGACAGCGATGGTGAT
TTGATTGAAGAAGAATTGAATTATGGAACAAAACATAAACATGTTCTTCA
TTATTATGGTTCAGGAAAAGAAAGAAGATGACATTGTGAAAGAAAGTGAT
AAATACAGAGCTGATGGAGAATACTATCCCAAAATATTATTTATTGGATT
GAAACCATCATTCGCAGCTTCAGATGAGATCAAAGAAGTAGCGGACAAGT
TCATCATGATTAATACTGACGAATAAGCCAATTCTTGCTGTTTTCCATCA
AGACTGGTGTGGTGCTTGCCAACTTTTGATCAGTATGGAAGTATGTTTGG
AGCACCAGTTCTTGGATAGTGGTTTCGGTAAAGACTATGTGTGGTATGAG
TGGACCTCAGGCTTGGCGGCTGCAAAACAACAATCACAATGGTGTCATGA
TGCGGGAATTGGACAACAAGAATAAGAAATCCGATAAAACAAAATACTTC
TACAAAAAAGTTTCTGATGAACTGATCGAAGATTTCGAAGCGTCCAGTGA
GTTTGTTGAACAAAGCAAGAAATTCCTACTGGCAAAAGCTGAAGATAAAG
AGATTGGCAAATTGGGTGCATATAAAAGCGAAGGAAAATATGTCCCTAAA
ATCGTATTCATTAGACGCTTCCAATCTTATTGTTGAGTACTCGTTCTAAA
TGTAAACCCTGCAAAAAATTGACATGGCTGAAACTTGATGATGCATTATC
CCAAGCTAAAGAAAAATGTGGGCCCTTTGGTTCTTGTTTTCGATTGTTGC
TACATCAGCATCAGTCTATCGAGCAATGGAAAAAGCCAAGGAAAAGATGT
CAGCGTGGAAACCAGGGGACCAGTCTGAAGAGACTAATCGAGTTGTCAAA
AAACCAAAAGATGAATTATAGGACGACGTTGATGATGAATTAGCTGATTC
TTTTGATATCGATGGAACGTATGTACCGAGAATTTATTTCTTGGATCCTG
AAGGCAAGATATGGAAAGATTTATGGAACGTGGGTACAAGTTATTTGGAC
AACAAGTTCTACTTCTTCGAAAGCTCAGCAACTACTATCAAGATGATTGT
GAGAGATGAAGAGTTCAAAGAGAAATCTCAAGGATTCATCCTTGCTGACA
TTGAGCCAAAAGCCAATTATGTTCTTAGTTCATCGCACAACTTGCCCCGC
TTGTAAAGAAACTAAAACAGAAGAAGGTAAGAAAGAGAAGAGCACAACAT
TATCTCCTGGTAAACGATTGTTATCAAACAGTGGTCTCAAATGGAATAAC
ATTAATGCTGCTCTGGAAGAAGCAAAGGAAAGTCTTGCAAACGATGAAAT
TTGCTGTTGGGAAGTTTTATAACACACAAAACACTGCACAACAAAACACA
CAACAACAAACCACACAACAACAAGAAAAACAACAACAAAAACAGGATTC
TCAAGGCAAAGTACACCATGACCTTCACAACAGAGATCCCGCCTTCTTGA
AATACAAATTTTCATTCGCCTATGAAGAACAAAGATTCAGAGGAGCCTCA
TGACGAACAATATTTCATTGATGGTGGATATTATCCAAGAATTTATTTCT
TAGATCCTGATGAGAACGTCCAGGTCAATCTCAACAACAGTTTGATCGAC
TCACCATACGATTCCACCCTCTTTTACTACGGTACCGATAAAGAGATTCT
CAGCATGATGAAAAGCGCCCAACAAACAATGAATATCACCCTCGGGCGGG
GATTTGGTGAATACATTGACTGGGTGGCCTATCCAAGGGCGTTGGAGTTA
TGCAAGGAGAAAAATATGCCAATGATGTTAATTATCCATAAAACGTGGTG
TGGTGCATGTAAATCTTTGAAACCAACGATCAAAGATTCGAGACCTATCT
GGGAATTGAGCAAATATTTCATCATGGTTAATACTGAGGAAGAGGAAGCG
AAAGAAACGAAAGAAAAATATGATGTCGATGGAAAATATTCACCAAGGAT
GTTCTTTATCGACATGAAAGAGCAGCTCAATGAATCACCAGAGATCACTG
AACTTTCTAACAAATTTGTTATGATTCGTGTCAGCGTTTTGGCACCAACA
TCAGATGGTACAATTATACAGTTGGAGTACAACAAGTGAAGAAGAATCAC
ATGATTGGTCTTGTCGTATTCTACAATAACTATTGTGAATTCGCTCGATT
GATGACTAACATGAACAAAGCTTTGGAGATGAAACTTGGTGAACGAACAG
AGGATCACCAATACACACAACAACAACAACAACAACAACAACAACAAGAT
TCTCAGAACACTCAACAAGAATCGCAGAACACTCAACAAGAACAAACACA
AACTCAGCAACAACCAAAAGAAGAAGCCAAGCAGAAAACTGATGACAGCA
ATGGTAAAGTTGACGAATCCCTACGCAATGAAGGAAAATCTTTCAAAAAA
TCACGATACGCTTATGGAAATGTTGACCAATGATGATGATGAACCAGATG
AAGATCAATTTGATGTTGATGGTGCCTACATTCCAAGAATATTCTTCTTA
GCTCTCAAACCAAGAATTCAAAGAAGTAAAGAATTTGCTGAGCTCAGCAA
GAAATTTGTCATGGTTACTGTTGAAGAAGAAGCCAATGATGTTAATCATC
ACCAAATCTTATTGTGGTGCTTGTAAAGATCTTGGAAAACACATCAAATG
GGTTACTTACAAAAAAGGATTACAACTTGTTAAAACTTTTCCGCGCATCA
ATGGACCGAGTCATTGGAAATATCACCGAAGCTCAAAACGTCAAAGACAA
TGACAGCGATGGTGATTTGATTGAAGAAGAATTGAATTATGGAACAAAAC
ATAAACATGTTCTTCATTATTATGGTTCAGGAAAAGAAAGAAGATGACAT
TGTGAAAGAAAGTGATAAATACAGAGCTGATGGAGAATACTATCCCAAAA
TATTATTTATTGGATTGAAACCATCATTCGCAGCTTCAGATGAGATCAAA
GAAGTAGCGGACAAGTTCATCATGATTAATACTGACGAATAAGCCAATTC
TTGCTGTTTTCCATCAAGACTGGTGTGGTGCTTGCCAACTTTTGATCAGT
ATGGAAGTATGTTTGGAGCACCAGTTCTTGGATAGTGGTTTCGGTAAAGA
CTATGTGTGGTATGAGTGGACCTCAGGCTTGGCGGCTGCAAAACAACAAT
CACAATGGTGTCATGATGCGGGAATTGGACAACAAGAATAAGAAATCCGA
TAAAACAAAATACTTCTACAAAAAAGTTTCTGATGAACTGATCGAAGATT
TCGAAGCGTCCAGTGAGTTTGTTGAACAAAGCAAGAAATTCCTACTGGCA
AAAGCTGAAGATAAAGAGATTGGCAAATTGGGTGCATATAAAAGCGAAGG
AAAATATGTCCCTAAAATCGTATTCATTAGACGCTTCCAATCTTATTGTT
GAGTACTCGTTCTAAATGTAAACCCTGCAAAAAATTGACATGGCTGAAAC
TTGATGATGCATTATCCCAAGCTAAAGAAAAATGTGGGCCCTTTGGTTCT
TGTTTTCGATTGTTGCTACATCAGCATCAGTCTATCGAGCAATGGAAAAA
GCCAAGGAAAAGATGTCAGCGTGGAAACCAGGGGACCAGTCTGAAGAGAC
TAATCGAGTTGTCAAAAAACCAAAAGATGAATTATAGGACGACGTTGATG
ATGAATTAGCTGATTCTTTTGATATCGATGGAACGTATGTACCGAGAATT
TATTTCTTGGATCCTGAAGGCAAGATATGGAAAGATTTATGGAACGTGGG
TACAAGTTATTTGGACAACAAGTTCTACTTCTTCGAAAGCTCAGCAACTA
CTATCAAGATGATTGTGAGAGATGAAGAGTTCAAAGAGAAATCTCAAGGA
TTCATCCTTGCTGACATTGAGCCAAAAGCCAATTATGTTCTTAGTTCATC
GCACAACTTGCCCCGCTTGTAAAGAAACTAAAACAGAAGAAGGTAAGAAA
GAGAAGAGCACAACATTATCTCCTGGTAAACGATTGTTATCAAACAGTGG
TCTCAAATGGAATAACATTAATGCTGCTCTGGAAGAAGCAAAGGAAAGTC
TTGCAAACGATGAAATTTGCTGTTGGGAAGTTTTATAACACACAAAACAC
TGCACAACAAAACACACAACAACAAACCACACAACAACAAGAAAAACAAC
AACAAAAACAGGATTCTCAAGGCAAAGTACACCATGACCTTCACAACAGA
GATCCCGCCTTCTTGAAATACAAATTTTCATTCGCCTATGAAGAACAAAG
ATTCAGAGGAGCCTCATGACGAACAATATTTCATTGATGGTGGATATTAT
CCAAGAATTTATTTCTTAGATCCTGATGAGAACGTCCAGGTCAATCTCAA
CAACAGTTTGATCGACTCACCATACGATTCCACCCTCTTTTACTACGGTA
CCGATAAAGAGATTCTCAGCATGATGAAAAGCGCCCAACAAACAATGAAT
ATCACCCTCGGGCGGGGATTTGGTGAATACATTGACTGGGTGGCCTATCC
AAGGGCGTTGGAGTTATGCAAGGAGAAAAATATGCCAATGATGTTAATTA
TCCATAAAACGTGGTGTGGTGCATGTAAATCTTTGAAACCAACGATCAAA
GATTCGAGACCTATCTGGGAATTGAGCAAATATTTCATCATGGTTAATAC
TGAGGAAGAGGAAGCGAAAGAAACGAAAGAAAAATATGATGTCGATGGAA
AATATTCACCAAGGATGTTCTTTATCGACATGAAAGAGCAGCTCAATGAA
TCACCAGAGATCACTGAACTTTCTAACAAATTTGTTATGATTCGTGTCAG
CGTTTTGGCACCAACATCAGATGGTACAATTATACAGTTGGAGTACAACA
AGTGAAGAAGAATCACATGATTGGTCTTGTCGTATTCTACAATAACTATT
GTGAATTCGCTCGATTGATGACTAACATGAACAAAGCTTTGGAGATGAAA
CTTGGTGAACGAACAGAGGATCACCAATACACACAACAACAACAACAACA
ACAACAACAACAAGATTCTCAGAACACTCAACAAGAATCGCAGAACACTC
AACAAGAACAAACACAAACTCAGCAACAACCAAAAGAAGAAGCCAAGCAG
AAAACTGATGACAGCAATGGTAAAGTTGACGAATCCCTACGCAATGAAGG
AAAATCTTTCAAAAAATCACGATACGCTTATGGAAATGTTGACCAATGAT
GATGATGAACCAGATGAAGATCAATTTGATGTTGATGGTGCCTACATTCC
AAGAATATTCTTCTTAGCTCTCAAACCAAGAATTCAAAGAAGTAAAGAAT
TTGCTGAGCTCAGCAAGAAATTTGTCATGGTTACTGTTGAAGAAGAAGCC
AATGATGTTAATCATCACCAAATCTTATTGTGGTGCTTGTAAAGATCTTG
GAAAACACATCAAATGGGTTACTTACAAAAAAGGATTACAACTTGTTAAA
ACTTTTCCGCGCATCAATGGACCGAGTCATTGGAAATATCACCGAAGCTC
AAAACGTCAAAGACAATGACAGCGATGGTGATTTGATTGAAGAAGAATTG
AATTATGGAACAAAACATAAACATGTTCTTCATTATTATGGTTCAGGAAA
AGAAAGAAGATGACATTGTGAAAGAAAGTGATAAATACAGAGCTGATGGA
GAATACTATCCCAAAATATTATTTATTGGATTGAAACCATCATTCGCAGC
TTCAGATGAGATCAAAGAAGTAGCGGACAAGTTCATCATGATTAATACTG
ACGAATAAGCCAATTCTTGCTGTTTTCCATCAAGACTGGTGTGGTGCTTG
CCAACTTTTGATCAGTATGGAAGTATGTTTGGAGCACCAGTTCTTGGATA
GTGGTTTCGGTAAAGACTATGTGTGGTATGAGTGGACCTCAGGCTTGGCG
GCTGCAAAACAACAATCACAATGGTGTCATGATGCGGGAATTGGACAACA
AGAATAAGAAATCCGATAAAACAAAATACTTCTACAAAAAAGTTTCTGAT
GAACTGATCGAAGATTTCGAAGCGTCCAGTGAGTTTGTTGAACAAAGCAA
GAAATTCCTACTGGCAAAAGCTGAAGATAAAGAGATTGGCAAATTGGGTG
CATATAAAAGCGAAGGAAAATATGTCCCTAAAATCGTATTCATTAGACGC
TTCCAATCTTATTGTTGAGTACTCGTTCTAAATGTAAACCCTGCAAAAAA
TTGACATGGCTGAAACTTGATGATGCATTATCCCAAGCTAAAGAAAAATG
TGGGCCCTTTGGTTCTTGTTTTCGATTGTTGCTACATCAGCATCAGTCTA
TCGAGCAATGGAAAAAGCCAAGGAAAAGATGTCAGCGTGGAAACCAGGGG
ACCAGTCTGAAGAGACTAATCGAGTTGTCAAAAAACCAAAAGATGAATTA
TAGGACGACGTTGATGATGAATTAGCTGATTCTTTTGATATCGATGGAAC
GTATGTACCGAGAATTTATTTCTTGGATCCTGAAGGCAAGATATGGAAAG
ATTTATGGAACGTGGGTACAAGTTATTTGGACAACAAGTTCTACTTCTTC
GAAAGCTCAGCAACTACTATCAAGATGATTGTGAGAGATGAAGAGTTCAA
AGAGAAATCTCAAGGATTCATCCTTGCTGACATTGAGCCAAAAGCCAATT
ATGTTCTTAGTTCATCGCACAACTTGCCCCGCTTGTAAAGAAACTAAAAC
AGAAGAAGGTAAGAAAGAGAAGAGCACAACATTATCTCCTGGTAAACGAT
TGTTATCAAACAGTGGTCTCAAATGGAATAACATTAATGCTGCTCTGGAA
GAAGCAAAGGAAAGTCTTGCAAACGATGAAATTTGCTGTTGGGAAGTTTT
ATAACACACAAAACACTGCACAACAAAACACACAACAACAAACCACACAA
CAACAAGAAAAACAACAACAAAAACAGGATTCTCAAGGCAAAGTACACCA
TGACCTTCACAACAGAGATCCCGCCTTCTTGAAATACAAATTTTCATTCG
CCTATGAAGAACAAAGATTCAGAGGAGCCTCATGACGAACAATATTTCAT
TGATGGTGGATATTATCCAAGAATTTATTTCTTAGATCCTGATGAGAACG
TCCAGGTCAATCTCAACAACAGTTTGATCGACTCACCATACGATTCCACC
CTCTTTTACTACGGTACCGATAAAGAGATTCTCAGCATGATGAAAAGCGC
CCAACAAACAATGAATATCACCCTCGGGCGGGGATTTGGTGAATACATTG
ACTGGGTGGCCTATCCAAGGGCGTTGGAGTTATGCAAGGAGAAAAATATG
CCAATGATGTTAATTATCCATAAAACGTGGTGTGGTGCATGTAAATCTTT
GAAACCAACGATCAAAGATTCGAGACCTATCTGGGAATTGAGCAAATATT
TCATCATGGTTAATACTGAGGAAGAGGAAGCGAAAGAAACGAAAGAAAAA
TATGATGTCGATGGAAAATATTCACCAAGGATGTTCTTTATCGACATGAA
AGAGCAGCTCAATGAATCACCAGAGATCACTGAACTTTCTAACAAATTTG
TTATGATTCGTGTCAGCGTTTTGGCACCAACATCAGATGGTACAATTATA
CAGTTGGAGTACAACAAGTGAAGAAGAATCACATGATTGGTCTTGTCGTA
TTCTACAATAACTATTGTGAATTCGCTCGATTGATGACTAACATGAACAA
AGCTTTGGAGATGAAACTTGGTGAACGAACAGAGGATCACCAATACACAC
AACAACAACAACAACAACAACAACAACAAGATTCTCAGAACACTCAACAA
GAATCGCAGAACACTCAACAAGAACAAACACAAACTCAGCAACAACCAAA
AGAAGAAGCCAAGCAGAAAACTGATGACAGCAATGGTAAAGTTGACGAAT
CCCTACGCAATGAAGGAAAATCTTTCAAAAAATCACGATACGCTTATGGA
AATGTTGACCAATGATGATGATGAACCAGATGAAGATCAATTTGATGTTG
ATGGTGCCTACATTCCAAGAATATTCTTCTTAGCTCTCAAACCAAGAATT
CAAAGAAGTAAAGAATTTGCTGAGCTCAGCAAGAAATTTGTCATGGTTAC
TGTTGAAGAAGAAGCCAATGATGTTAATCATCACCAAATCTTATTGTGGT
GCTTGTAAAGATCTTGGAAAACACATCAAATGGGTTACTTACAAAAAAGG
ATTACAACTTGTTAAAACTTTTCCGCGCATCAATGGACCGAGTCATTGGA
AATATCACCGAAGCTCAAAACGTCAAAGACAATGACAGCGATGGTGATTT
GATTGAAGAAGAATTGAATTATGGAACAAAACATAAACATGTTCTTCATT
ATTATGGTTCAGGAAAAGAAAGAAGATGACATTGTGAAAGAAAGTGATAA
ATACAGAGCTGATGGAGAATACTATCCCAAAATATTATTTATTGGATTGA
AACCATCATTCGCAGCTTCAGATGAGATCAAAGAAGTAGCGGACAAGTTC
ATCATGATTAATACTGACGAATAAGCCAATTCTTGCTGTTTTCCATCAAG
ACTGGTGTGGTGCTTGCCAACTTTTGATCAGTATGGAAGTATGTTTGGAG
CACCAGTTCTTGGATAGTGGTTTCGGTAAAGACTATGTGTGGTATGAGTG
GACCTCAGGCTTGGCGGCTGCAAAACAACAATCACAATGGTGTCATGATG
CGGGAATTGGACAACAAGAATAAGAAATCCGATAAAACAAAATACTTCTA
CAAAAAAGTTTCTGATGAACTGATCGAAGATTTCGAAGCGTCCAGTGAGT
TTGTTGAACAAAGCAAGAAATTCCTACTGGCAAAAGCTGAAGATAAAGAG
ATTGGCAAATTGGGTGCATATAAAAGCGAAGGAAAATATGTCCCTAAAAT
CGTATTCATTAGACGCTTCCAATCTTATTGTTGAGTACTCGTTCTAAATG
TAAACCCTGCAAAAAATTGACATGGCTGAAACTTGATGATGCATTATCCC
AAGCTAAAGAAAAATGTGGGCCCTTTGGTTCTTGTTTTCGATTGTTGCTA
CATCAGCATCAGTCTATCGAGCAATGGAAAAAGCCAAGGAAAAGATGTCA
GCGTGGAAACCAGGGGACCAGTCTGAAGAGACTAATCGAGTTGTCAAAAA
ACCAAAAGATGAATTATAGGACGACGTTGATGATGAATTAGCTGATTCTT
TTGATATCGATGGAACGTATGTACCGAGAATTTATTTCTTGGATCCTGAA
GGCAAGATATGGAAAGATTTATGGAACGTGGGTACAAGTTATTTGGACAA
CAAGTTCTACTTCTTCGAAAGCTCAGCAACTACTATCAAGATGATTGTGA
GAGATGAAGAGTTCAAAGAGAAATCTCAAGGATTCATCCTTGCTGACATT
GAGCCAAAAGCCAATTATGTTCTTAGTTCATCGCACAACTTGCCCCGCTT
GTAAAGAAACTAAAACAGAAGAAGGTAAGAAAGAGAAGAGCACAACATTA
TCTCCTGGTAAACGATTGTTATCAAACAGTGGTCTCAAATGGAATAACAT
TAATGCTGCTCTGGAAGAAGCAAAGGAAAGTCTTGCAAACGATGAAATTT
GCTGTTGGGAAGTTTTATAACACACAAAACACTGCACAACAAAACACACA
ACAACAAACCACACAACAACAAGAAAAACAACAACAAAAACAGGATTCTC
AAGGCAAAGTACACCATGACCTTCACAACAGAGATCCCGCCTTCTTGAAA
TACAAATTTTCATTCGCCTATGAAGAACAAAGATTCAGAGGAGCCTCATG
ACGAACAATATTTCATTGATGGTGGATATTATCCAAGAATTTATTTCTTA
GATCCTGATGAGAACGTCCAGGTCAATCTCAACAACAGTTTGATCGACTC
ACCATACGATTCCACCCTCTTTTACTACGGTACCGATAAAGAGATTCTCA
GCATGATGAAAAGCGCCCAACAAACAATGAATATCACCCTCGGGCGGGGA
TTTGGTGAATACATTGACTGGGTGGCCTATCCAAGGGCGTTGGAGTTATG
CAAGGAGAAAAATATGCCAATGATGTTAATTATCCATAAAACGTGGTGTG
GTGCATGTAAATCTTTGAAACCAACGATCAAAGATTCGAGACCTATCTGG
GAATTGAGCAAATATTTCATCATGGTTAATACTGAGGAAGAGGAAGCGAA
AGAAACGAAAGAAAAATATGATGTCGATGGAAAATATTCACCAAGGATGT
TCTTTATCGACATGAAAGAGCAGCTCAATGAATCACCAGAGATCACTGAA
CTTTCTAACAAATTTGTTATGATTCGTGTCAGCGTTTTGGCACCAACATC
AGATGGTACAATTATACAGTTGGAGTACAACAAGTGAAGAAGAATCACAT
GATTGGTCTTGTCGTATTCTACAATAACTATTGTGAATTCGCTCGATTGA
TGACTAACATGAACAAAGCTTTGGAGATGAAACTTGGTGAACGAACAGAG
GATCACCAATACACACAACAACAACAACAACAACAACAACAACAAGATTC
TCAGAACACTCAACAAGAATCGCAGAACACTCAACAAGAACAAACACAAA
CTCAGCAACAACCAAAAGAAGAAGCCAAGCAGAAAACTGATGACAGCAAT
GGTAAAGTTGACGAATCCCTACGCAATGAAGGAAAATCTTTCAAAAAATC
ACGATACGCTTATGGAAATGTTGACCAATGATGATGATGAACCAGATGAA
GATCAATTTGATGTTGATGGTGCCTACATTCCAAGAATATTCTTCTTAGC
TCTCAAACCAAGAATTCAAAGAAGTAAAGAATTTGCTGAGCTCAGCAAGA
AATTTGTCATGGTTACTGTTGAAGAAGAAGCCAATGATGTTAATCATCAC
CAAATCTTATTGTGGTGCTTGTAAAGATCTTGGAAAACACATCAAATGGG
TTACTTACAAAAAAGGATTACAACTTGTTAAAACTTTTCCGCGCATCAAT
GGACCGAGTCATTGGAAATATCACCGAAGCTCAAAACGTCAAAGACAATG
ACAGCGATGGTGATTTGATTGAAGAAGAATTGAATTATGGAACAAAACAT
AAACATGTTCTTCATTATTATGGTTCAGGAAAAGAAAGAAGATGACATTG
TGAAAGAAAGTGATAAATACAGAGCTGATGGAGAATACTATCCCAAAATA
TTATTTATTGGATTGAAACCATCATTCGCAGCTTCAGATGAGATCAAAGA
AGTAGCGGACAAGTTCATCATGATTAATACTGACGAATAAGCCAATTCTT
GCTGTTTTCCATCAAGACTGGTGTGGTGCTTGCCAACTTTTGATCAGTAT
GGAAGTATGTTTGGAGCACCAGTTCTTGGATAGTGGTTTCGGTAAAGACT
ATGTGTGGTATGAGTGGACCTCAGGCTTGGCGGCTGCAAAACAACAATCA
CAATGGTGTCATGATGCGGGAATTGGACAACAAGAATAAGAAATCCGATA
AAACAAAATACTTCTACAAAAAAGTTTCTGATGAACTGATCGAAGATTTC
GAAGCGTCCAGTGAGTTTGTTGAACAAAGCAAGAAATTCCTACTGGCAAA
AGCTGAAGATAAAGAGATTGGCAAATTGGGTGCATATAAAAGCGAAGGAA
AATATGTCCCTAAAATCGTATTCATTAGACGCTTCCAATCTTATTGTTGA
GTACTCGTTCTAAATGTAAACCCTGCAAAAAATTGACATGGCTGAAACTT
GATGATGCATTATCCCAAGCTAAAGAAAAATGTGGGCCCTTTGGTTCTTG
TTTTCGATTGTTGCTACATCAGCATCAGTCTATCGAGCAATGGAAAAAGC
CAAGGAAAAGATGTCAGCGTGGAAACCAGGGGACCAGTCTGAAGAGACTA
ATCGAGTTGTCAAAAAACCAAAAGATGAATTATAGGACGACGTTGATGAT
GAATTAGCTGATTCTTTTGATATCGATGGAACGTATGTACCGAGAATTTA
TTTCTTGGATCCTGAAGGCAAGATATGGAAAGATTTATGGAACGTGGGTA
CAAGTTATTTGGACAACAAGTTCTACTTCTTCGAAAGCTCAGCAACTACT
ATCAAGATGATTGTGAGAGATGAAGAGTTCAAAGAGAAATCTCAAGGATT
CATCCTTGCTGACATTGAGCCAAAAGCCAATTATGTTCTTAGTTCATCGC
ACAACTTGCCCCGCTTGTAAAGAAACTAAAACAGAAGAAGGTAAGAAAGA
GAAGAGCACAACATTATCTCCTGGTAAACGATTGTTATCAAACAGTGGTC
TCAAATGGAATAACATTAATGCTGCTCTGGAAGAAGCAAAGGAAAGTCTT
GCAAACGATGAAATTTGCTGTTGGGAAGTTTTATAACACACAAAACACTG
CACAACAAAACACACAACAACAAACCACACAACAACAAGAAAAACAACAA
CAAAAACAGGATTCTCAAGGCAAAGTACACCATGACCTTCACAACAGAGA
TCCCGCCTTCTTGAAATACAAATTTTCATTCGCCTATGAAGAACAAAGAT
TCAGAGGAGCCTCATGACGAACAATATTTCATTGATGGTGGATATTATCC
AAGAATTTATTTCTTAGATCCTGATGAGAACGTCCAGGTCAATCTCAACA
ACAGTTTGATCGACTCACCATACGATTCCACCCTCTTTTACTACGGTACC
GATAAAGAGATTCTCAGCATGATGAAAAGCGCCCAACAAACAATGAATAT
CACCCTCGGGCGGGGATTTGGTGAATACATTGACTGGGTGGCCTATCCAA
GGGCGTTGGAGTTATGCAAGGAGAAAAATATGCCAATGATGTTAATTATC
CATAAAACGTGGTGTGGTGCATGTAAATCTTTGAAACCAACGATCAAAGA
TTCGAGACCTATCTGGGAATTGAGCAAATATTTCATCATGGTTAATACTG
AGGAAGAGGAAGCGAAAGAAACGAAAGAAAAATATGATGTCGATGGAAAA
TATTCACCAAGGATGTTCTTTATCGACATGAAAGAGCAGCTCAATGAATC
ACCAGAGATCACTGAACTTTCTAACAAATTTGTTATGATTCGTGTCAGCG
TTTTGGCACCAACATCAGATGGTACAATTATACAGTTGGAGTACAACAAG
TGAAGAAGAATCACATGATTGGTCTTGTCGTATTCTACAATAACTATTGT
GAATTCGCTCGATTGATGACTAACATGAACAAAGCTTTGGAGATGAAACT
TGGTGAACGAACAGAGGATCACCAATACACACAACAACAACAACAACAAC
AACAACAACAAGATTCTCAGAACACTCAACAAGAATCGCAGAACACTCAA
CAAGAACAAACACAAACTCAGCAACAACCAAAAGAAGAAGCCAAGCAGAA
AACTGATGACAGCAATGGTAAAGTTGACGAATCCCTACGCAATGAAGGAA
AATCTTTCAAAAAATCACGATACGCTTATGGAAATGTTGACCAATGATGA
TGATGAACCAGATGAAGATCAATTTGATGTTGATGGTGCCTACATTCCAA
GAATATTCTTCTTAGCTCTCAAACCAAGAATTCAAAGAAGTAAAGAATTT
GCTGAGCTCAGCAAGAAATTTGTCATGGTTACTGTTGAAGAAGAAGCCAA
TGATGTTAATCATCACCAAATCTTATTGTGGTGCTTGTAAAGATCTTGGA
AAACACATCAAATGGGTTACTTACAAAAAAGGATTACAACTTGTTAAAAC
TTTTCCGCGCATCAATGGACCGAGTCATTGGAAATATCACCGAAGCTCAA
AACGTCAAAGACAATGACAGCGATGGTGATTTGATTGAAGAAGAATTGAA
TTATGGAACAAAACATAAACATGTTCTTCATTATTATGGTTCAGGAAAAG
AAAGAAGATGACATTGTGAAAGAAAGTGATAAATACAGAGCTGATGGAGA
ATACTATCCCAAAATATTATTTATTGGATTGAAACCATCATTCGCAGCTT
CAGATGAGATCAAAGAAGTAGCGGACAAGTTCATCATGATTAATACTGAC
GAATAAGCCAATTCTTGCTGTTTTCCATCAAGACTGGTGTGGTGCTTGCC
AACTTTTGATCAGTATGGAAGTATGTTTGGAGCACCAGTTCTTGGATAGT
GGTTTCGGTAAAGACTATGTGTGGTATGAGTGGACCTCAGGCTTGGCGGC
TGCAAAACAACAATCACAATGGTGTCATGATGCGGGAATTGGACAACAAG
AATAAGAAATCCGATAAAACAAAATACTTCTACAAAAAAGTTTCTGATGA
ACTGATCGAAGATTTCGAAGCGTCCAGTGAGTTTGTTGAACAAAGCAAGA
AATTCCTACTGGCAAAAGCTGAAGATAAAGAGATTGGCAAATTGGGTGCA
TATAAAAGCGAAGGAAAATATGTCCCTAAAATCGTATTCATTAGACGCTT
CCAATCTTATTGTTGAGTACTCGTTCTAAATGTAAACCCTGCAAAAAATT
GACATGGCTGAAACTTGATGATGCATTATCCCAAGCTAAAGAAAAATGTG
GGCCCTTTGGTTCTTGTTTTCGATTGTTGCTACATCAGCATCAGTCTATC
GAGCAATGGAAAAAGCCAAGGAAAAGATGTCAGCGTGGAAACCAGGGGAC
CAGTCTGAAGAGACTAATCGAGTTGTCAAAAAACCAAAAGATGAATTATA
GGACGACGTTGATGATGAATTAGCTGATTCTTTTGATATCGATGGAACGT
ATGTACCGAGAATTTATTTCTTGGATCCTGAAGGCAAGATATGGAAAGAT
TTATGGAACGTGGGTACAAGTTATTTGGACAACAAGTTCTACTTCTTCGA
AAGCTCAGCAACTACTATCAAGATGATTGTGAGAGATGAAGAGTTCAAAG
AGAAATCTCAAGGATTCATCCTTGCTGACATTGAGCCAAAAGCCAATTAT
GTTCTTAGTTCATCGCACAACTTGCCCCGCTTGTAAAGAAACTAAAACAG
AAGAAGGTAAGAAAGAGAAGAGCACAACATTATCTCCTGGTAAACGATTG
TTATCAAACAGTGGTCTCAAATGGAATAACATTAATGCTGCTCTGGAAGA
AGCAAAGGAAAGTCTTGCAAACGATGAAATTTGCTGTTGGGAAGTTTTAT
AACACACAAAACACTGCACAACAAAACACACAACAACAAACCACACAACA
ACAAGAAAAACAACAACAAAAACAGGATTCTCAAGGCAAAGTACACCATG
ACCTTCACAACAGAGATCCCGCCTTCTTGAAATACAAATTTTCATTCGCC
TATGAAGAACAAAGATTCAGAGGAGCCTCATGACGAACAATATTTCATTG
ATGGTGGATATTATCCAAGAATTTATTTCTTAGATCCTGATGAGAACGTC
CAGGTCAATCTCAACAACAGTTTGATCGACTCACCATACGATTCCACCCT
CTTTTACTACGGTACCGATAAAGAGATTCTCAGCATGATGAAAAGCGCCC
AACAAACAATGAATATCACCCTCGGGCGGGGATTTGGTGAATACATTGAC
TGGGTGGCCTATCCAAGGGCGTTGGAGTTATGCAAGGAGAAAAATATGCC
AATGATGTTAATTATCCATAAAACGTGGTGTGGTGCATGTAAATCTTTGA
AACCAACGATCAAAGATTCGAGACCTATCTGGGAATTGAGCAAATATTTC
ATCATGGTTAATACTGAGGAAGAGGAAGCGAAAGAAACGAAAGAAAAATA
TGATGTCGATGGAAAATATTCACCAAGGATGTTCTTTATCGACATGAAAG
AGCAGCTCAATGAATCACCAGAGATCACTGAACTTTCTAACAAATTTGTT
ATGATTCGTGTCAGCGTTTTGGCACCAACATCAGATGGTACAATTATACA
GTTGGAGTACAACAAGTGAAGAAGAATCACATGATTGGTCTTGTCGTATT
CTACAATAACTATTGTGAATTCGCTCGATTGATGACTAACATGAACAAAG
CTTTGGAGATGAAACTTGGTGAACGAACAGAGGATCACCAATACACACAA
CAACAACAACAACAACAACAACAACAAGATTCTCAGAACACTCAACAAGA
ATCGCAGAACACTCAACAAGAACAAACACAAACTCAGCAACAACCAAAAG
AAGAAGCCAAGCAGAAAACTGATGACAGCAATGGTAAAGTTGACGAATCC
CTACGCAATGAAGGAAAATCTTTCAAAAAATCACGATACGCTTATGGAAA
TGTTGACCAATGATGATGATGAACCAGATGAAGATCAATTTGATGTTGAT
GGTGCCTACATTCCAAGAATATTCTTCTTAGCTCTCAAACCAAGAATTCA
AAGAAGTAAAGAATTTGCTGAGCTCAGCAAGAAATTTGTCATGGTTACTG
TTGAAGAAGAAGCCAATGATGTTAATCATCACCAAATCTTATTGTGGTGC
TTGTAAAGATCTTGGAAAACACATCAAATGGGTTACTTACAAAAAAGGAT
TACAACTTGTTAAAACTTTTCCGCGCATCAATGGACCGAGTCATTGGAAA
TATCACCGAAGCTCAAAACGTCAAAGACAATGACAGCGATGGTGATTTGA
TTGAAGAAGAATTGAATTATGGAACAAAACATAAACATGTTCTTCATTAT
TATGGTTCAGGAAAAGAAAGAAGATGACATTGTGAAAGAAAGTGATAAAT
ACAGAGCTGATGGAGAATACTATCCCAAAATATTATTTATTGGATTGAAA
CCATCATTCGCAGCTTCAGATGAGATCAAAGAAGTAGCGGACAAGTTCAT
CATGATTAATACTGACGAATAAGCCAATTCTTGCTGTTTTCCATCAAGAC
TGGTGTGGTGCTTGCCAACTTTTGATCAGTATGGAAGTATGTTTGGAGCA
CCAGTTCTTGGATAGTGGTTTCGGTAAAGACTATGTGTGGTATGAGTGGA
CCTCAGGCTTGGCGGCTGCAAAACAACAATCACAATGGTGTCATGATGCG
GGAATTGGACAACAAGAATAAGAAATCCGATAAAACAAAATACTTCTACA
AAAAAGTTTCTGATGAACTGATCGAAGATTTCGAAGCGTCCAGTGAGTTT
GTTGAACAAAGCAAGAAATTCCTACTGGCAAAAGCTGAAGATAAAGAGAT
TGGCAAATTGGGTGCATATAAAAGCGAAGGAAAATATGTCCCTAAAATCG
TATTCATTAGACGCTTCCAATCTTATTGTTGAGTACTCGTTCTAAATGTA
AACCCTGCAAAAAATTGACATGGCTGAAACTTGATGATGCATTATCCCAA
GCTAAAGAAAAATGTGGGCCCTTTGGTTCTTGTTTTCGATTGTTGCTACA
TCAGCATCAGTCTATCGAGCAATGGAAAAAGCCAAGGAAAAGATGTCAGC
GTGGAAACCAGGGGACCAGTCTGAAGAGACTAATCGAGTTGTCAAAAAAC
CAAAAGATGAATTATAGGACGACGTTGATGATGAATTAGCTGATTCTTTT
GATATCGATGGAACGTATGTACCGAGAATTTATTTCTTGGATCCTGAAGG
CAAGATATGGAAAGATTTATGGAACGTGGGTACAAGTTATTTGGACAACA
AGTTCTACTTCTTCGAAAGCTCAGCAACTACTATCAAGATGATTGTGAGA
GATGAAGAGTTCAAAGAGAAATCTCAAGGATTCATCCTTGCTGACATTGA
GCCAAAAGCCAATTATGTTCTTAGTTCATCGCACAACTTGCCCCGCTTGT
AAAGAAACTAAAACAGAAGAAGGTAAGAAAGAGAAGAGCACAACATTATC
TCCTGGTAAACGATTGTTATCAAACAGTGGTCTCAAATGGAATAACATTA
ATGCTGCTCTGGAAGAAGCAAAGGAAAGTCTTGCAAACGATGAAATTTGC
TGTTGGGAAGTTTTATAACACACAAAACACTGCACAACAAAACACACAAC
AACAAACCACACAACAACAAGAAAAACAACAACAAAAACAGGATTCTCAA
GGCAAAGTACACCATGACCTTCACAACAGAGATCCCGCCTTCTTGAAATA
CAAATTTTCATTCGCCTATGAAGAACAAAGATTCAGAGGAGCCTCATGAC
GAACAATATTTCATTGATGGTGGATATTATCCAAGAATTTATTTCTTAGA
TCCTGATGAGAACGTCCAGGTCAATCTCAACAACAGTTTGATCGACTCAC
CATACGATTCCACCCTCTTTTACTACGGTACCGATAAAGAGATTCTCAGC
ATGATGAAAAGCGCCCAACAAACAATGAATATCACCCTCGGGCGGGGATT
TGGTGAATACATTGACTGGGTGGCCTATCCAAGGGCGTTGGAGTTATGCA
AGGAGAAAAATATGCCAATGATGTTAATTATCCATAAAACGTGGTGTGGT
GCATGTAAATCTTTGAAACCAACGATCAAAGATTCGAGACCTATCTGGGA
ATTGAGCAAATATTTCATCATGGTTAATACTGAGGAAGAGGAAGCGAAAG
AAACGAAAGAAAAATATGATGTCGATGGAAAATATTCACCAAGGATGTTC
TTTATCGACATGAAAGAGCAGCTCAATGAATCACCAGAGATCACTGAACT
TTCTAACAAATTTGTTATGATTCGTGTCAGCGTTTTGGCACCAACATCAG
ATGGTACAATTATACAGTTGGAGTACAACAAGTGAAGAAGAATCACATGA
TTGGTCTTGTCGTATTCTACAATAACTATTGTGAATTCGCTCGATTGATG
ACTAACATGAACAAAGCTTTGGAGATGAAACTTGGTGAACGAACAGAGGA
TCACCAATACACACAACAACAACAACAACAACAACAACAACAAGATTCTC
AGAACACTCAACAAGAATCGCAGAACACTCAACAAGAACAAACACAAACT
CAGCAACAACCAAAAGAAGAAGCCAAGCAGAAAACTGATGACAGCAATGG
TAAAGTTGACGAATCCCTACGCAATGAAGGAAAATCTTTCAAAAAATCAC
GATACGCTTATGGAAATGTTGACCAATGATGATGATGAACCAGATGAAGA
TCAATTTGATGTTGATGGTGCCTACATTCCAAGAATATTCTTCTTAGCTC
TCAAACCAAGAATTCAAAGAAGTAAAGAATTTGCTGAGCTCAGCAAGAAA
TTTGTCATGGTTACTGTTGAAGAAGAAGCCAATGATGTTAATCATCACCA
AATCTTATTGTGGTGCTTGTAAAGATCTTGGAAAACACATCAAATGGGTT
ACTTACAAAAAAGGATTACAACTTGTTAAAACTTTTCCGCGCATCAATGG
ACCGAGTCATTGGAAATATCACCGAAGCTCAAAACGTCAAAGACAATGAC
AGCGATGGTGATTTGATTGAAGAAGAATTGAATTATGGAACAAAACATAA
ACATGTTCTTCATTATTATGGTTCAGGAAAAGAAAGAAGATGACATTGTG
AAAGAAAGTGATAAATACAGAGCTGATGGAGAATACTATCCCAAAATATT
ATTTATTGGATTGAAACCATCATTCGCAGCTTCAGATGAGATCAAAGAAG
TAGCGGACAAGTTCATCATGATTAATACTGACGAATAAGCCAATTCTTGC
TGTTTTCCATCAAGACTGGTGTGGTGCTTGCCAACTTTTGATCAGTATGG
AAGTATGTTTGGAGCACCAGTTCTTGGATAGTGGTTTCGGTAAAGACTAT
GTGTGGTATGAGTGGACCTCAGGCTTGGCGGCTGCAAAACAACAATCACA
ATGGTGTCATGATGCGGGAATTGGACAACAAGAATAAGAAATCCGATAAA
ACAAAATACTTCTACAAAAAAGTTTCTGATGAACTGATCGAAGATTTCGA
AGCGTCCAGTGAGTTTGTTGAACAAAGCAAGAAATTCCTACTGGCAAAAG
CTGAAGATAAAGAGATTGGCAAATTGGGTGCATATAAAAGCGAAGGAAAA
TATGTCCCTAAAATCGTATTCATTAGACGCTTCCAATCTTATTGTTGAGT
ACTCGTTCTAAATGTAAACCCTGCAAAAAATTGACATGGCTGAAACTTGA
TGATGCATTATCCCAAGCTAAAGAAAAATGTGGGCCCTTTGGTTCTTGTT
TTCGATTGTTGCTACATCAGCATCAGTCTATCGAGCAATGGAAAAAGCCA
AGGAAAAGATGTCAGCGTGGAAACCAGGGGACCAGTCTGAAGAGACTAAT
CGAGTTGTCAAAAAACCAAAAGATGAATTATAGGACGACGTTGATGATGA
ATTAGCTGATTCTTTTGATATCGATGGAACGTATGTACCGAGAATTTATT
TCTTGGATCCTGAAGGCAAGATATGGAAAGATTTATGGAACGTGGGTACA
AGTTATTTGGACAACAAGTTCTACTTCTTCGAAAGCTCAGCAACTACTAT
CAAGATGATTGTGAGAGATGAAGAGTTCAAAGAGAAATCTCAAGGATTCA
TCCTTGCTGACATTGAGCCAAAAGCCAATTATGTTCTTAGTTCATCGCAC
AACTTGCCCCGCTTGTAAAGAAACTAAAACAGAAGAAGGTAAGAAAGAGA
AGAGCACAACATTATCTCCTGGTAAACGATTGTTATCAAACAGTGGTCTC
AAATGGAATAACATTAATGCTGCTCTGGAAGAAGCAAAGGAAAGTCTTGC
AAACGATGAAATTTGCTGTTGGGAAGTTTTATAACACACAAAACACTGCA
CAACAAAACACACAACAACAAACCACACAACAACAAGAAAAACAACAACA
AAAACAGGATTCTCAAGGCAAAGTACACCATGACCTTCACAACAGAGATC
CCGCCTTCTTGAAATACAAATTTTCATTCGCCTATGAAGAACAAAGATTC
AGAGGAGCCTCATGACGAACAATATTTCATTGATGGTGGATATTATCCAA
GAATTTATTTCTTAGATCCTGATGAGAACGTCCAGGTCAATCTCAACAAC
AGTTTGATCGACTCACCATACGATTCCACCCTCTTTTACTACGGTACCGA
TAAAGAGATTCTCAGCATGATGAAAAGCGCCCAACAAACAATGAATATCA
CCCTCGGGCGGGGATTTGGTGAATACATTGACTGGGTGGCCTATCCAAGG
GCGTTGGAGTTATGCAAGGAGAAAAATATGCCAATGATGTTAATTATCCA
TAAAACGTGGTGTGGTGCATGTAAATCTTTGAAACCAACGATCAAAGATT
CGAGACCTATCTGGGAATTGAGCAAATATTTCATCATGGTTAATACTGAG
GAAGAGGAAGCGAAAGAAACGAAAGAAAAATATGATGTCGATGGAAAATA
TTCACCAAGGATGTTCTTTATCGACATGAAAGAGCAGCTCAATGAATCAC
CAGAGATCACTGAACTTTCTAACAAATTTGTTATGATTCGTGTCAGCGTT
TTGGCACCAACATCAGATGGTACAATTATACAGTTGGAGTACAACAAGTG
AAGAAGAATCACATGATTGGTCTTGTCGTATTCTACAATAACTATTGTGA
ATTCGCTCGATTGATGACTAACATGAACAAAGCTTTGGAGATGAAACTTG
GTGAACGAACAGAGGATCACCAATACACACAACAACAACAACAACAACAA
CAACAACAAGATTCTCAGAACACTCAACAAGAATCGCAGAACACTCAACA
AGAACAAACACAAACTCAGCAACAACCAAAAGAAGAAGCCAAGCAGAAAA
CTGATGACAGCAATGGTAAAGTTGACGAATCCCTACGCAATGAAGGAAAA
TCTTTCAAAAAATCACGATACGCTTATGGAAATGTTGACCAATGATGATG
ATGAACCAGATGAAGATCAATTTGATGTTGATGGTGCCTACATTCCAAGA
ATATTCTTCTTAGCTCTCAAACCAAGAATTCAAAGAAGTAAAGAATTTGC
TGAGCTCAGCAAGAAATTTGTCATGGTTACTGTTGAAGAAGAAGCCAATG
ATGTTAATCATCACCAAATCTTATTGTGGTGCTTGTAAAGATCTTGGAAA
ACACATCAAATGGGTTACTTACAAAAAAGGATTACAACTTGTTAAAACTT
TTCCGCGCATCAATGGACCGAGTCATTGGAAATATCACCGAAGCTCAAAA
CGTCAAAGACAATGACAGCGATGGTGATTTGATTGAAGAAGAATTGAATT
ATGGAACAAAACATAAACATGTTCTTCATTATTATGGTTCAGGAAAAGAA
AGAAGATGACATTGTGAAAGAAAGTGATAAATACAGAGCTGATGGAGAAT
ACTATCCCAAAATATTATTTATTGGATTGAAACCATCATTCGCAGCTTCA
GATGAGATCAAAGAAGTAGCGGACAAGTTCATCATGATTAATACTGACGA
ATAAGCCAATTCTTGCTGTTTTCCATCAAGACTGGTGTGGTGCTTGCCAA
CTTTTGATCAGTATGGAAGTATGTTTGGAGCACCAGTTCTTGGATAGTGG
TTTCGGTAAAGACTATGTGTGGTATGAGTGGACCTCAGGCTTGGCGGCTG
CAAAACAACAATCACAATGGTGTCATGATGCGGGAATTGGACAACAAGAA
TAAGAAATCCGATAAAACAAAATACTTCTACAAAAAAGTTTCTGATGAAC
TGATCGAAGATTTCGAAGCGTCCAGTGAGTTTGTTGAACAAAGCAAGAAA
TTCCTACTGGCAAAAGCTGAAGATAAAGAGATTGGCAAATTGGGTGCATA
TAAAAGCGAAGGAAAATATGTCCCTAAAATCGTATTCATTAGACGCTTCC
AATCTTATTGTTGAGTACTCGTTCTAAATGTAAACCCTGCAAAAAATTGA
CATGGCTGAAACTTGATGATGCATTATCCCAAGCTAAAGAAAAATGTGGG
CCCTTTGGTTCTTGTTTTCGATTGTTGCTACATCAGCATCAGTCTATCGA
GCAATGGAAAAAGCCAAGGAAAAGATGTCAGCGTGGAAACCAGGGGACCA
GTCTGAAGAGACTAATCGAGTTGTCAAAAAACCAAAAGATGAATTATAGG
ACGACGTTGATGATGAATTAGCTGATTCTTTTGATATCGATGGAACGTAT
GTACCGAGAATTTATTTCTTGGATCCTGAAGGCAAGATATGGAAAGATTT
ATGGAACGTGGGTACAAGTTATTTGGACAACAAGTTCTACTTCTTCGAAA
GCTCAGCAACTACTATCAAGATGATTGTGAGAGATGAAGAGTTCAAAGAG
AAATCTCAAGGATTCATCCTTGCTGACATTGAGCCAAAAGCCAATTATGT
TCTTAGTTCATCGCACAACTTGCCCCGCTTGTAAAGAAACTAAAACAGAA
GAAGGTAAGAAAGAGAAGAGCACAACATTATCTCCTGGTAAACGATTGTT
ATCAAACAGTGGTCTCAAATGGAATAACATTAATGCTGCTCTGGAAGAAG
CAAAGGAAAGTCTTGCAAACGATGAAATTTGCTGTTGGGAAGTTTTATAA
CACACAAAACACTGCACAACAAAACACACAACAACAAACCACACAACAAC
AAGAAAAACAACAACAAAAACAGGATTCTCAAGGCAAAGTACACCATGAC
CTTCACAACAGAGATCCCGCCTTCTTGAAATACAAATTTTCATTCGCCTA
TGAAGAACAAAGATTCAGAGGAGCCTCATGACGAACAATATTTCATTGAT
GGTGGATATTATCCAAGAATTTATTTCTTAGATCCTGATGAGAACGTCCA
GGTCAATCTCAACAACAGTTTGATCGACTCACCATACGATTCCACCCTCT
TTTACTACGGTACCGATAAAGAGATTCTCAGCATGATGAAAAGCGCCCAA
CAAACAATGAATATCACCCTCGGGCGGGGATTTGGTGAATACATTGACTG
GGTGGCCTATCCAAGGGCGTTGGAGTTATGCAAGGAGAAAAATATGCCAA
TGATGTTAATTATCCATAAAACGTGGTGTGGTGCATGTAAATCTTTGAAA
CCAACGATCAAAGATTCGAGACCTATCTGGGAATTGAGCAAATATTTCAT
CATGGTTAATACTGAGGAAGAGGAAGCGAAAGAAACGAAAGAAAAATATG
ATGTCGATGGAAAATATTCACCAAGGATGTTCTTTATCGACATGAAAGAG
CAGCTCAATGAATCACCAGAGATCACTGAACTTTCTAACAAATTTGTTAT
GATTCGTGTCAGCGTTTTGGCACCAACATCAGATGGTACAATTATACAGT
TGGAGTACAACAAGTGAAGAAGAATCACATGATTGGTCTTGTCGTATTCT
ACAATAACTATTGTGAATTCGCTCGATTGATGACTAACATGAACAAAGCT
TTGGAGATGAAACTTGGTGAACGAACAGAGGATCACCAATACACACAACA
ACAACAACAACAACAACAACAACAAGATTCTCAGAACACTCAACAAGAAT
CGCAGAACACTCAACAAGAACAAACACAAACTCAGCAACAACCAAAAGAA
GAAGCCAAGCAGAAAACTGATGACAGCAATGGTAAAGTTGACGAATCCCT
ACGCAATGAAGGAAAATCTTTCAAAAAATCACGATACGCTTATGGAAATG
TTGACCAATGATGATGATGAACCAGATGAAGATCAATTTGATGTTGATGG
TGCCTACATTCCAAGAATATTCTTCTTAGCTCTCAAACCAAGAATTCAAA
GAAGTAAAGAATTTGCTGAGCTCAGCAAGAAATTTGTCATGGTTACTGTT
GAAGAAGAAGCCAATGATGTTAATCATCACCAAATCTTATTGTGGTGCTT
GTAAAGATCTTGGAAAACACATCAAATGGGTTACTTACAAAAAAGGATTA
CAACTTGTTAAAACTTTTCCGCGCATCAATGGACCGAGTCATTGGAAATA
TCACCGAAGCTCAAAACGTCAAAGACAATGACAGCGATGGTGATTTGATT
GAAGAAGAATTGAATTATGGAACAAAACATAAACATGTTCTTCATTATTA
TGGTTCAGGAAAAGAAAGAAGATGACATTGTGAAAGAAAGTGATAAATAC
AGAGCTGATGGAGAATACTATCCCAAAATATTATTTATTGGATTGAAACC
ATCATTCGCAGCTTCAGATGAGATCAAAGAAGTAGCGGACAAGTTCATCA
TGATTAATACTGACGAATAAGCCAATTCTTGCTGTTTTCCATCAAGACTG
GTGTGGTGCTTGCCAACTTTTGATCAGTATGGAAGTATGTTTGGAGCACC
AGTTCTTGGATAGTGGTTTCGGTAAAGACTATGTGTGGTATGAGTGGACC
TCAGGCTTGGCGGCTGCAAAACAACAATCACAATGGTGTCATGATGCGGG
AATTGGACAACAAGAATAAGAAATCCGATAAAACAAAATACTTCTACAAA
AAAGTTTCTGATGAACTGATCGAAGATTTCGAAGCGTCCAGTGAGTTTGT
TGAACAAAGCAAGAAATTCCTACTGGCAAAAGCTGAAGATAAAGAGATTG
GCAAATTGGGTGCATATAAAAGCGAAGGAAAATATGTCCCTAAAATCGTA
TTCATTAGACGCTTCCAATCTTATTGTTGAGTACTCGTTCTAAATGTAAA
CCCTGCAAAAAATTGACATGGCTGAAACTTGATGATGCATTATCCCAAGC
TAAAGAAAAATGTGGGCCCTTTGGTTCTTGTTTTCGATTGTTGCTACATC
AGCATCAGTCTATCGAGCAATGGAAAAAGCCAAGGAAAAGATGTCAGCGT
GGAAACCAGGGGACCAGTCTGAAGAGACTAATCGAGTTGTCAAAAAACCA
AAAGATGAATTATAGGACGACGTTGATGATGAATTAGCTGATTCTTTTGA
TATCGATGGAACGTATGTACCGAGAATTTATTTCTTGGATCCTGAAGGCA
AGATATGGAAAGATTTATGGAACGTGGGTACAAGTTATTTGGACAACAAG
TTCTACTTCTTCGAAAGCTCAGCAACTACTATCAAGATGATTGTGAGAGA
TGAAGAGTTCAAAGAGAAATCTCAAGGATTCATCCTTGCTGACATTGAGC
CAAAAGCCAATTATGTTCTTAGTTCATCGCACAACTTGCCCCGCTTGTAA
AGAAACTAAAACAGAAGAAGGTAAGAAAGAGAAGAGCACAACATTATCTC
CTGGTAAACGATTGTTATCAAACAGTGGTCTCAAATGGAATAACATTAAT
GCTGCTCTGGAAGAAGCAAAGGAAAGTCTTGCAAACGATGAAATTTGCTG
TTGGGAAGTTTTATAACACACAAAACACTGCACAACAAAACACACAACAA
CAAACCACACAACAACAAGAAAAACAACAACAAAAACAGGATTCTCAAGG
CAAAGTACACCATGACCTTCACAACAGAGATCCCGCCTTCTTGAAATACA
AATTTTCATTCGCCTATGAAGAACAAAGATTCAGAGGAGCCTCATGACGA
ACAATATTTCATTGATGGTGGATATTATCCAAGAATTTATTTCTTAGATC
CTGATGAGAACGTCCAGGTCAATCTCAACAACAGTTTGATCGACTCACCA
TACGATTCCACCCTCTTTTACTACGGTACCGATAAAGAGATTCTCAGCAT
GATGAAAAGCGCCCAACAAACAATGAATATCACCCTCGGGCGGGGATTTG
GTGAATACATTGACTGGGTGGCCTATCCAAGGGCGTTGGAGTTATGCAAG
GAGAAAAATATGCCAATGATGTTAATTATCCATAAAACGTGGTGTGGTGC
ATGTAAATCTTTGAAACCAACGATCAAAGATTCGAGACCTATCTGGGAAT
TGAGCAAATATTTCATCATGGTTAATACTGAGGAAGAGGAAGCGAAAGAA
ACGAAAGAAAAATATGATGTCGATGGAAAATATTCACCAAGGATGTTCTT
TATCGACATGAAAGAGCAGCTCAATGAATCACCAGAGATCACTGAACTTT
CTAACAAATTTGTTATGATTCGTGTCAGCGTTTTGGCACCAACATCAGAT
GGTACAATTATACAGTTGGAGTACAACAAGTGAAGAAGAATCACATGATT
GGTCTTGTCGTATTCTACAATAACTATTGTGAATTCGCTCGATTGATGAC
TAACATGAACAAAGCTTTGGAGATGAAACTTGGTGAACGAACAGAGGATC
ACCAATACACACAACAACAACAACAACAACAACAACAACAAGATTCTCAG
AACACTCAACAAGAATCGCAGAACACTCAACAAGAACAAACACAAACTCA
GCAACAACCAAAAGAAGAAGCCAAGCAGAAAACTGATGACAGCAATGGTA
AAGTTGACGAATCCCTACGCAATGAAGGAAAATCTTTCAAAAAATCACGA
TACGCTTATGGAAATGTTGACCAATGATGATGATGAACCAGATGAAGATC
AATTTGATGTTGATGGTGCCTACATTCCAAGAATATTCTTCTTAGCTCTC
AAACCAAGAATTCAAAGAAGTAAAGAATTTGCTGAGCTCAGCAAGAAATT
TGTCATGGTTACTGTTGAAGAAGAAGCCAATGATGTTAATCATCACCAAA
TCTTATTGTGGTGCTTGTAAAGATCTTGGAAAACACATCAAATGGGTTAC
TTACAAAAAAGGATTACAACTTGTTAAAACTTTTCCGCGCATCAATGGAC
CGAGTCATTGGAAATATCACCGAAGCTCAAAACGTCAAAGACAATGACAG
CGATGGTGATTTGATTGAAGAAGAATTGAATTATGGAACAAAACATAAAC
ATGTTCTTCATTATTATGGTTCAGGAAAAGAAAGAAGATGACATTGTGAA
AGAAAGTGATAAATACAGAGCTGATGGAGAATACTATCCCAAAATATTAT
TTATTGGATTGAAACCATCATTCGCAGCTTCAGATGAGATCAAAGAAGTA
GCGGACAAGTTCATCATGATTAATACTGACGAATAAGCCAATTCTTGCTG
TTTTCCATCAAGACTGGTGTGGTGCTTGCCAACTTTTGATCAGTATGGAA
GTATGTTTGGAGCACCAGTTCTTGGATAGTGGTTTCGGTAAAGACTATGT
GTGGTATGAGTGGACCTCAGGCTTGGCGGCTGCAAAACAACAATCACAAT
GGTGTCATGATGCGGGAATTGGACAACAAGAATAAGAAATCCGATAAAAC
AAAATACTTCTACAAAAAAGTTTCTGATGAACTGATCGAAGATTTCGAAG
CGTCCAGTGAGTTTGTTGAACAAAGCAAGAAATTCCTACTGGCAAAAGCT
GAAGATAAAGAGATTGGCAAATTGGGTGCATATAAAAGCGAAGGAAAATA
TGTCCCTAAAATCGTATTCATTAGACGCTTCCAATCTTATTGTTGAGTAC
TCGTTCTAAATGTAAACCCTGCAAAAAATTGACATGGCTGAAACTTGATG
ATGCATTATCCCAAGCTAAAGAAAAATGTGGGCCCTTTGGTTCTTGTTTT
CGATTGTTGCTACATCAGCATCAGTCTATCGAGCAATGGAAAAAGCCAAG
GAAAAGATGTCAGCGTGGAAACCAGGGGACCAGTCTGAAGAGACTAATCG
AGTTGTCAAAAAACCAAAAGATGAATTATAGGACGACGTTGATGATGAAT
TAGCTGATTCTTTTGATATCGATGGAACGTATGTACCGAGAATTTATTTC
TTGGATCCTGAAGGCAAGATATGGAAAGATTTATGGAACGTGGGTACAAG
TTATTTGGACAACAAGTTCTACTTCTTCGAAAGCTCAGCAACTACTATCA
AGATGATTGTGAGAGATGAAGAGTTCAAAGAGAAATCTCAAGGATTCATC
CTTGCTGACATTGAGCCAAAAGCCAATTATGTTCTTAGTTCATCGCACAA
CTTGCCCCGCTTGTAAAGAAACTAAAACAGAAGAAGGTAAGAAAGAGAAG
AGCACAACATTATCTCCTGGTAAACGATTGTTATCAAACAGTGGTCTCAA
ATGGAATAACATTAATGCTGCTCTGGAAGAAGCAAAGGAAAGTCTTGCAA
ACGATGAAATTTGCTGTTGGGAAGTTTTATAACACACAAAACACTGCACA
ACAAAACACACAACAACAAACCACACAACAACAAGAAAAACAACAACAAA
AACAGGATTCTCAAGGCAAAGTACACCATGACCTTCACAACAGAGATCCC
GCCTTCTTGAAATACAAATTTTCATTCGCCTATGAAGAACAAAGATTCAG
AGGAGCCTCATGACGAACAATATTTCATTGATGGTGGATATTATCCAAGA
ATTTATTTCTTAGATCCTGATGAGAACGTCCAGGTCAATCTCAACAACAG
TTTGATCGACTCACCATACGATTCCACCCTCTTTTACTACGGTACCGATA
AAGAGATTCTCAGCATGATGAAAAGCGCCCAACAAACAATGAATATCACC
CTCGGGCGGGGATTTGGTGAATACATTGACTGGGTGGCCTATCCAAGGGC
GTTGGAGTTATGCAAGGAGAAAAATATGCCAATGATGTTAATTATCCATA
AAACGTGGTGTGGTGCATGTAAATCTTTGAAACCAACGATCAAAGATTCG
AGACCTATCTGGGAATTGAGCAAATATTTCATCATGGTTAATACTGAGGA
AGAGGAAGCGAAAGAAACGAAAGAAAAATATGATGTCGATGGAAAATATT
CACCAAGGATGTTCTTTATCGACATGAAAGAGCAGCTCAATGAATCACCA
GAGATCACTGAACTTTCTAACAAATTTGTTATGATTCGTGTCAGCGTTTT
GGCACCAACATCAGATGGTACAATTATACAGTTGGAGTACAACAAGTGAA
GAAGAATCACATGATTGGTCTTGTCGTATTCTACAATAACTATTGTGAAT
TCGCTCGATTGATGACTAACATGAACAAAGCTTTGGAGATGAAACTTGGT
GAACGAACAGAGGATCACCAATACACACAACAACAACAACAACAACAACA
ACAACAAGATTCTCAGAACACTCAACAAGAATCGCAGAACACTCAACAAG
AACAAACACAAACTCAGCAACAACCAAAAGAAGAAGCCAAGCAGAAAACT
GATGACAGCAATGGTAAAGTTGACGAATCCCTACGCAATGAAGGAAAATC
TTTCAAAAAATCACGATACGCTTATGGAAATGTTGACCAATGATGATGAT
GAACCAGATGAAGATCAATTTGATGTTGATGGTGCCTACATTCCAAGAAT
ATTCTTCTTAGCTCTCAAACCAAGAATTCAAAGAAGTAAAGAATTTGCTG
AGCTCAGCAAGAAATTTGTCATGGTTACTGTTGAAGAAGAAGCCAATGAT
GTTAATCATCACCAAATCTTATTGTGGTGCTTGTAAAGATCTTGGAAAAC
ACATCAAATGGGTTACTTACAAAAAAGGATTACAACTTGTTAAAACTTTT
CCGCGCATCAATGGACCGAGTCATTGGAAATATCACCGAAGCTCAAAACG
TCAAAGACAATGACAGCGATGGTGATTTGATTGAAGAAGAATTGAATTAT
GGAACAAAACATAAACATGTTCTTCATTATTATGGTTCAGGAAAAGAAAG
AAGATGACATTGTGAAAGAAAGTGATAAATACAGAGCTGATGGAGAATAC
TATCCCAAAATATTATTTATTGGATTGAAACCATCATTCGCAGCTTCAGA
TGAGATCAAAGAAGTAGCGGACAAGTTCATCATGATTAATACTGACGAAT
AAGCCAATTCTTGCTGTTTTCCATCAAGACTGGTGTGGTGCTTGCCAACT
TTTGATCAGTATGGAAGTATGTTTGGAGCACCAGTTCTTGGATAGTGGTT
TCGGTAAAGACTATGTGTGGTATGAGTGGACCTCAGGCTTGGCGGCTGCA
AAACAACAATCACAATGGTGTCATGATGCGGGAATTGGACAACAAGAATA
AGAAATCCGATAAAACAAAATACTTCTACAAAAAAGTTTCTGATGAACTG
ATCGAAGATTTCGAAGCGTCCAGTGAGTTTGTTGAACAAAGCAAGAAATT
CCTACTGGCAAAAGCTGAAGATAAAGAGATTGGCAAATTGGGTGCATATA
AAAGCGAAGGAAAATATGTCCCTAAAATCGTATTCATTAGACGCTTCCAA
TCTTATTGTTGAGTACTCGTTCTAAATGTAAACCCTGCAAAAAATTGACA
TGGCTGAAACTTGATGATGCATTATCCCAAGCTAAAGAAAAATGTGGGCC
CTTTGGTTCTTGTTTTCGATTGTTGCTACATCAGCATCAGTCTATCGAGC
AATGGAAAAAGCCAAGGAAAAGATGTCAGCGTGGAAACCAGGGGACCAGT
CTGAAGAGACTAATCGAGTTGTCAAAAAACCAAAAGATGAATTATAGGAC
GACGTTGATGATGAATTAGCTGATTCTTTTGATATCGATGGAACGTATGT
ACCGAGAATTTATTTCTTGGATCCTGAAGGCAAGATATGGAAAGATTTAT
GGAACGTGGGTACAAGTTATTTGGACAACAAGTTCTACTTCTTCGAAAGC
TCAGCAACTACTATCAAGATGATTGTGAGAGATGAAGAGTTCAAAGAGAA
ATCTCAAGGATTCATCCTTGCTGACATTGAGCCAAAAGCCAATTATGTTC
TTAGTTCATCGCACAACTTGCCCCGCTTGTAAAGAAACTAAAACAGAAGA
AGGTAAGAAAGAGAAGAGCACAACATTATCTCCTGGTAAACGATTGTTAT
CAAACAGTGGTCTCAAATGGAATAACATTAATGCTGCTCTGGAAGAAGCA
AAGGAAAGTCTTGCAAACGATGAAATTTGCTGTTGGGAAGTTTTATAACA
CACAAAACACTGCACAACAAAACACACAACAACAAACCACACAACAACAA
GAAAAACAACAACAAAAACAGGATTCTCAAGGCAAAGTACACCATGACCT
TCACAACAGAGATCCCGCCTTCTTGAAATACAAATTTTCATTCGCCTATG
AAGAACAAAGATTCAGAGGAGCCTCATGACGAACAATATTTCATTGATGG
TGGATATTATCCAAGAATTTATTTCTTAGATCCTGATGAGAACGTCCAGG
TCAATCTCAACAACAGTTTGATCGACTCACCATACGATTCCACCCTCTTT
TACTACGGTACCGATAAAGAGATTCTCAGCATGATGAAAAGCGCCCAACA
AACAATGAATATCACCCTCGGGCGGGGATTTGGTGAATACATTGACTGGG
TGGCCTATCCAAGGGCGTTGGAGTTATGCAAGGAGAAAAATATGCCAATG
ATGTTAATTATCCATAAAACGTGGTGTGGTGCATGTAAATCTTTGAAACC
AACGATCAAAGATTCGAGACCTATCTGGGAATTGAGCAAATATTTCATCA
TGGTTAATACTGAGGAAGAGGAAGCGAAAGAAACGAAAGAAAAATATGAT
GTCGATGGAAAATATTCACCAAGGATGTTCTTTATCGACATGAAAGAGCA
GCTCAATGAATCACCAGAGATCACTGAACTTTCTAACAAATTTGTTATGA
TTCGTGTCAGCGTTTTGGCACCAACATCAGATGGTACAATTATACAGTTG
GAGTACAACAAGTGAAGAAGAATCACATGATTGGTCTTGTCGTATTCTAC
AATAACTATTGTGAATTCGCTCGATTGATGACTAACATGAACAAAGCTTT
GGAGATGAAACTTGGTGAACGAACAGAGGATCACCAATACACACAACAAC
AACAACAACAACAACAACAACAAGATTCTCAGAACACTCAACAAGAATCG
CAGAACACTCAACAAGAACAAACACAAACTCAGCAACAACCAAAAGAAGA
AGCCAAGCAGAAAACTGATGACAGCAATGGTAAAGTTGACGAATCCCTAC
GCAATGAAGGAAAATCTTTCAAAAAATCACGATACGCTTATGGAAATGTT
GACCAATGATGATGATGAACCAGATGAAGATCAATTTGATGTTGATGGTG
CCTACATTCCAAGAATATTCTTCTTAGCTCTCAAACCAAGAATTCAAAGA
AGTAAAGAATTTGCTGAGCTCAGCAAGAAATTTGTCATGGTTACTGTTGA
AGAAGAAGCCAATGATGTTAATCATCACCAAATCTTATTGTGGTGCTTGT
AAAGATCTTGGAAAACACATCAAATGGGTTACTTACAAAAAAGGATTACA
ACTTGTTAAAACTTTTCCGCGCATCAATGGACCGAGTCATTGGAAATATC
ACCGAAGCTCAAAACGTCAAAGACAATGACAGCGATGGTGATTTGATTGA
AGAAGAATTGAATTATGGAACAAAACATAAACATGTTCTTCATTATTATG
GTTCAGGAAAAGAAAGAAGATGACATTGTGAAAGAAAGTGATAAATACAG
AGCTGATGGAGAATACTATCCCAAAATATTATTTATTGGATTGAAACCAT
CATTCGCAGCTTCAGATGAGATCAAAGAAGTAGCGGACAAGTTCATCATG
ATTAATACTGACGAATAAGCCAATTCTTGCTGTTTTCCATCAAGACTGGT
GTGGTGCTTGCCAACTTTTGATCAGTATGGAAGTATGTTTGGAGCACCAG
TTCTTGGATAGTGGTTTCGGTAAAGACTATGTGTGGTATGAGTGGACCTC
AGGCTTGGCGGCTGCAAAACAACAATCACAATGGTGTCATGATGCGGGAA
TTGGACAACAAGAATAAGAAATCCGATAAAACAAAATACTTCTACAAAAA
AGTTTCTGATGAACTGATCGAAGATTTCGAAGCGTCCAGTGAGTTTGTTG
AACAAAGCAAGAAATTCCTACTGGCAAAAGCTGAAGATAAAGAGATTGGC
AAATTGGGTGCATATAAAAGCGAAGGAAAATATGTCCCTAAAATCGTATT
CATTAGACGCTTCCAATCTTATTGTTGAGTACTCGTTCTAAATGTAAACC
CTGCAAAAAATTGACATGGCTGAAACTTGATGATGCATTATCCCAAGCTA
AAGAAAAATGTGGGCCCTTTGGTTCTTGTTTTCGATTGTTGCTACATCAG
CATCAGTCTATCGAGCAATGGAAAAAGCCAAGGAAAAGATGTCAGCGTGG
AAACCAGGGGACCAGTCTGAAGAGACTAATCGAGTTGTCAAAAAACCAAA
AGATGAATTATAGGACGACGTTGATGATGAATTAGCTGATTCTTTTGATA
TCGATGGAACGTATGTACCGAGAATTTATTTCTTGGATCCTGAAGGCAAG
ATATGGAAAGATTTATGGAACGTGGGTACAAGTTATTTGGACAACAAGTT
CTACTTCTTCGAAAGCTCAGCAACTACTATCAAGATGATTGTGAGAGATG
AAGAGTTCAAAGAGAAATCTCAAGGATTCATCCTTGCTGACATTGAGCCA
AAAGCCAATTATGTTCTTAGTTCATCGCACAACTTGCCCCGCTTGTAAAG
AAACTAAAACAGAAGAAGGTAAGAAAGAGAAGAGCACAACATTATCTCCT
GGTAAACGATTGTTATCAAACAGTGGTCTCAAATGGAATAACATTAATGC
TGCTCTGGAAGAAGCAAAGGAAAGTCTTGCAAACGATGAAATTTGCTGTT
GGGAAGTTTTATAACACACAAAACACTGCACAACAAAACACACAACAACA
AACCACACAACAACAAGAAAAACAACAACAAAAACAGGATTCTCAAGGCA
AAGTACACCATGACCTTCACAACAGAGATCCCGCCTTCTTGAAATACAAA
TTTTCATTCGCCTATGAAGAACAAAGATTCAGAGGAGCCTCATGACGAAC
AATATTTCATTGATGGTGGATATTATCCAAGAATTTATTTCTTAGATCCT
GATGAGAACGTCCAGGTCAATCTCAACAACAGTTTGATCGACTCACCATA
CGATTCCACCCTCTTTTACTACGGTACCGATAAAGAGATTCTCAGCATGA
TGAAAAGCGCCCAACAAACAATGAATATCACCCTCGGGCGGGGATTTGGT
GAATACATTGACTGGGTGGCCTATCCAAGGGCGTTGGAGTTATGCAAGGA
GAAAAATATGCCAATGATGTTAATTATCCATAAAACGTGGTGTGGTGCAT
GTAAATCTTTGAAACCAACGATCAAAGATTCGAGACCTATCTGGGAATTG
AGCAAATATTTCATCATGGTTAATACTGAGGAAGAGGAAGCGAAAGAAAC
GAAAGAAAAATATGATGTCGATGGAAAATATTCACCAAGGATGTTCTTTA
TCGACATGAAAGAGCAGCTCAATGAATCACCAGAGATCACTGAACTTTCT
AACAAATTTGTTATGATTCGTGTCAGCGTTTTGGCACCAACATCAGATGG
TACAATTATACAGTTGGAGTACAACAAGTGAAGAAGAATCACATGATTGG
TCTTGTCGTATTCTACAATAACTATTGTGAATTCGCTCGATTGATGACTA
ACATGAACAAAGCTTTGGAGATGAAACTTGGTGAACGAACAGAGGATCAC
CAATACACACAACAACAACAACAACAACAACAACAACAAGATTCTCAGAA
CACTCAACAAGAATCGCAGAACACTCAACAAGAACAAACACAAACTCAGC
AACAACCAAAAGAAGAAGCCAAGCAGAAAACTGATGACAGCAATGGTAAA
GTTGACGAATCCCTACGCAATGAAGGAAAATCTTTCAAAAAATCACGATA
CGCTTATGGAAATGTTGACCAATGATGATGATGAACCAGATGAAGATCAA
TTTGATGTTGATGGTGCCTACATTCCAAGAATATTCTTCTTAGCTCTCAA
ACCAAGAATTCAAAGAAGTAAAGAATTTGCTGAGCTCAGCAAGAAATTTG
TCATGGTTACTGTTGAAGAAGAAGCCAATGATGTTAATCATCACCAAATC
TTATTGTGGTGCTTGTAAAGATCTTGGAAAACACATCAAATGGGTTACTT
ACAAAAAAGGATTACAACTTGTTAAAACTTTTCCGCGCATCAATGGACCG
AGTCATTGGAAATATCACCGAAGCTCAAAACGTCAAAGACAATGACAGCG
ATGGTGATTTGATTGAAGAAGAATTGAATTATGGAACAAAACATAAACAT
GTTCTTCATTATTATGGTTCAGGAAAAGAAAGAAGATGACATTGTGAAAG
AAAGTGATAAATACAGAGCTGATGGAGAATACTATCCCAAAATATTATTT
ATTGGATTGAAACCATCATTCGCAGCTTCAGATGAGATCAAAGAAGTAGC
GGACAAGTTCATCATGATTAATACTGACGAATAAGCCAATTCTTGCTGTT
TTCCATCAAGACTGGTGTGGTGCTTGCCAACTTTTGATCAGTATGGAAGT
ATGTTTGGAGCACCAGTTCTTGGATAGTGGTTTCGGTAAAGACTATGTGT
GGTATGAGTGGACCTCAGGCTTGGCGGCTGCAAAACAACAATCACAATGG
TGTCATGATGCGGGAATTGGACAACAAGAATAAGAAATCCGATAAAACAA
AATACTTCTACAAAAAAGTTTCTGATGAACTGATCGAAGATTTCGAAGCG
TCCAGTGAGTTTGTTGAACAAAGCAAGAAATTCCTACTGGCAAAAGCTGA
AGATAAAGAGATTGGCAAATTGGGTGCATATAAAAGCGAAGGAAAATATG
TCCCTAAAATCGTATTCATTAGACGCTTCCAATCTTATTGTTGAGTACTC
GTTCTAAATGTAAACCCTGCAAAAAATTGACATGGCTGAAACTTGATGAT
GCATTATCCCAAGCTAAAGAAAAATGTGGGCCCTTTGGTTCTTGTTTTCG
ATTGTTGCTACATCAGCATCAGTCTATCGAGCAATGGAAAAAGCCAAGGA
AAAGATGTCAGCGTGGAAACCAGGGGACCAGTCTGAAGAGACTAATCGAG
TTGTCAAAAAACCAAAAGATGAATTATAGGACGACGTTGATGATGAATTA
GCTGATTCTTTTGATATCGATGGAACGTATGTACCGAGAATTTATTTCTT
GGATCCTGAAGGCAAGATATGGAAAGATTTATGGAACGTGGGTACAAGTT
ATTTGGACAACAAGTTCTACTTCTTCGAAAGCTCAGCAACTACTATCAAG
ATGATTGTGAGAGATGAAGAGTTCAAAGAGAAATCTCAAGGATTCATCCT
TGCTGACATTGAGCCAAAAGCCAATTATGTTCTTAGTTCATCGCACAACT
TGCCCCGCTTGTAAAGAAACTAAAACAGAAGAAGGTAAGAAAGAGAAGAG
CACAACATTATCTCCTGGTAAACGATTGTTATCAAACAGTGGTCTCAAAT
GGAATAACATTAATGCTGCTCTGGAAGAAGCAAAGGAAAGTCTTGCAAAC
GATGAAATTTGCTGTTGGGAAGTTTTATAACACACAAAACACTGCACAAC
AAAACACACAACAACAAACCACACAACAACAAGAAAAACAACAACAAAAA
CAGGATTCTCAAGGCAAAGTACACCATGACCTTCACAACAGAGATCCCGC
CTTCTTGAAATACAAATTTTCATTCGCCTATGAAGAACAAAGATTCAGAG
GAGCCTCATGACGAACAATATTTCATTGATGGTGGATATTATCCAAGAAT
TTATTTCTTAGATCCTGATGAGAACGTCCAGGTCAATCTCAACAACAGTT
TGATCGACTCACCATACGATTCCACCCTCTTTTACTACGGTACCGATAAA
GAGATTCTCAGCATGATGAAAAGCGCCCAACAAACAATGAATATCACCCT
CGGGCGGGGATTTGGTGAATACATTGACTGGGTGGCCTATCCAAGGGCGT
TGGAGTTATGCAAGGAGAAAAATATGCCAATGATGTTAATTATCCATAAA
ACGTGGTGTGGTGCATGTAAATCTTTGAAACCAACGATCAAAGATTCGAG
ACCTATCTGGGAATTGAGCAAATATTTCATCATGGTTAATACTGAGGAAG
AGGAAGCGAAAGAAACGAAAGAAAAATATGATGTCGATGGAAAATATTCA
CCAAGGATGTTCTTTATCGACATGAAAGAGCAGCTCAATGAATCACCAGA
GATCACTGAACTTTCTAACAAATTTGTTATGATTCGTGTCAGCGTTTTGG
CACCAACATCAGATGGTACAATTATACAGTTGGAGTACAACAAGTGAAGA
AGAATCACATGATTGGTCTTGTCGTATTCTACAATAACTATTGTGAATTC
GCTCGATTGATGACTAACATGAACAAAGCTTTGGAGATGAAACTTGGTGA
ACGAACAGAGGATCACCAATACACACAACAACAACAACAACAACAACAAC
AACAAGATTCTCAGAACACTCAACAAGAATCGCAGAACACTCAACAAGAA
CAAACACAAACTCAGCAACAACCAAAAGAAGAAGCCAAGCAGAAAACTGA
TGACAGCAATGGTAAAGTTGACGAATCCCTACGCAATGAAGGAAAATCTT
TCAAAAAATCACGATACGCTTATGGAAATGTTGACCAATGATGATGATGA
ACCAGATGAAGATCAATTTGATGTTGATGGTGCCTACATTCCAAGAATAT
TCTTCTTAGCTCTCAAACCAAGAATTCAAAGAAGTAAAGAATTTGCTGAG
CTCAGCAAGAAATTTGTCATGGTTACTGTTGAAGAAGAAGCCAATGATGT
TAATCATCACCAAATCTTATTGTGGTGCTTGTAAAGATCTTGGAAAACAC
ATCAAATGGGTTACTTACAAAAAAGGATTACAACTTGTTAAAACTTTTCC
GCGCATCAATGGACCGAGTCATTGGAAATATCACCGAAGCTCAAAACGTC
AAAGACAATGACAGCGATGGTGATTTGATTGAAGAAGAATTGAATTATGG
AACAAAACATAAACATGTTCTTCATTATTATGGTTCAGGAAAAGAAAGAA
GATGACATTGTGAAAGAAAGTGATAAATACAGAGCTGATGGAGAATACTA
TCCCAAAATATTATTTATTGGATTGAAACCATCATTCGCAGCTTCAGATG
AGATCAAAGAAGTAGCGGACAAGTTCATCATGATTAATACTGACGAATAA
GCCAATTCTTGCTGTTTTCCATCAAGACTGGTGTGGTGCTTGCCAACTTT
TGATCAGTATGGAAGTATGTTTGGAGCACCAGTTCTTGGATAGTGGTTTC
GGTAAAGACTATGTGTGGTATGAGTGGACCTCAGGCTTGGCGGCTGCAAA
ACAACAATCACAATGGTGTCATGATGCGGGAATTGGACAACAAGAATAAG
AAATCCGATAAAACAAAATACTTCTACAAAAAAGTTTCTGATGAACTGAT
CGAAGATTTCGAAGCGTCCAGTGAGTTTGTTGAACAAAGCAAGAAATTCC
TACTGGCAAAAGCTGAAGATAAAGAGATTGGCAAATTGGGTGCATATAAA
AGCGAAGGAAAATATGTCCCTAAAATCGTATTCATTAGACGCTTCCAATC
TTATTGTTGAGTACTCGTTCTAAATGTAAACCCTGCAAAAAATTGACATG
GCTGAAACTTGATGATGCATTATCCCAAGCTAAAGAAAAATGTGGGCCCT
TTGGTTCTTGTTTTCGATTGTTGCTACATCAGCATCAGTCTATCGAGCAA
TGGAAAAAGCCAAGGAAAAGATGTCAGCGTGGAAACCAGGGGACCAGTCT
GAAGAGACTAATCGAGTTGTCAAAAAACCAAAAGATGAATTATAGGACGA
CGTTGATGATGAATTAGCTGATTCTTTTGATATCGATGGAACGTATGTAC
CGAGAATTTATTTCTTGGATCCTGAAGGCAAGATATGGAAAGATTTATGG
AACGTGGGTACAAGTTATTTGGACAACAAGTTCTACTTCTTCGAAAGCTC
AGCAACTACTATCAAGATGATTGTGAGAGATGAAGAGTTCAAAGAGAAAT
CTCAAGGATTCATCCTTGCTGACATTGAGCCAAAAGCCAATTATGTTCTT
AGTTCATCGCACAACTTGCCCCGCTTGTAAAGAAACTAAAACAGAAGAAG
GTAAGAAAGAGAAGAGCACAACATTATCTCCTGGTAAACGATTGTTATCA
AACAGTGGTCTCAAATGGAATAACATTAATGCTGCTCTGGAAGAAGCAAA
GGAAAGTCTTGCAAACGATGAAATTTGCTGTTGGGAAGTTTTATAACACA
CAAAACACTGCACAACAAAACACACAACAACAAACCACACAACAACAAGA
AAAACAACAACAAAAACAGGATTCTCAAGGCAAAGTACACCATGACCTTC
ACAACAGAGATCCCGCCTTCTTGAAATACAAATTTTCATTCGCCTATGAA
GAACAAAGATTCAGAGGAGCCTCATGACGAACAATATTTCATTGATGGTG
GATATTATCCAAGAATTTATTTCTTAGATCCTGATGAGAACGTCCAGGTC
AATCTCAACAACAGTTTGATCGACTCACCATACGATTCCACCCTCTTTTA
CTACGGTACCGATAAAGAGATTCTCAGCATGATGAAAAGCGCCCAACAAA
CAATGAATATCACCCTCGGGCGGGGATTTGGTGAATACATTGACTGGGTG
GCCTATCCAAGGGCGTTGGAGTTATGCAAGGAGAAAAATATGCCAATGAT
GTTAATTATCCATAAAACGTGGTGTGGTGCATGTAAATCTTTGAAACCAA
CGATCAAAGATTCGAGACCTATCTGGGAATTGAGCAAATATTTCATCATG
GTTAATACTGAGGAAGAGGAAGCGAAAGAAACGAAAGAAAAATATGATGT
CGATGGAAAATATTCACCAAGGATGTTCTTTATCGACATGAAAGAGCAGC
TCAATGAATCACCAGAGATCACTGAACTTTCTAACAAATTTGTTATGATT
CGTGTCAGCGTTTTGGCACCAACATCAGATGGTACAATTATACAGTTGGA
GTACAACAAGTGAAGAAGAATCACATGATTGGTCTTGTCGTATTCTACAA
TAACTATTGTGAATTCGCTCGATTGATGACTAACATGAACAAAGCTTTGG
AGATGAAACTTGGTGAACGAACAGAGGATCACCAATACACACAACAACAA
CAACAACAACAACAACAACAAGATTCTCAGAACACTCAACAAGAATCGCA
GAACACTCAACAAGAACAAACACAAACTCAGCAACAACCAAAAGAAGAAG
CCAAGCAGAAAACTGATGACAGCAATGGTAAAGTTGACGAATCCCTACGC
AATGAAGGAAAATCTTTCAAAAAATCACGATACGCTTATGGAAATGTTGA
CCAATGATGATGATGAACCAGATGAAGATCAATTTGATGTTGATGGTGCC
TACATTCCAAGAATATTCTTCTTAGCTCTCAAACCAAGAATTCAAAGAAG
TAAAGAATTTGCTGAGCTCAGCAAGAAATTTGTCATGGTTACTGTTGAAG
AAGAAGCCAATGATGTTAATCATCACCAAATCTTATTGTGGTGCTTGTAA
AGATCTTGGAAAACACATCAAATGGGTTACTTACAAAAAAGGATTACAAC
TTGTTAAAACTTTTCCGCGCATCAATGGACCGAGTCATTGGAAATATCAC
CGAAGCTCAAAACGTCAAAGACAATGACAGCGATGGTGATTTGATTGAAG
AAGAATTGAATTATGGAACAAAACATAAACATGTTCTTCATTATTATGGT
TCAGGAAAAGAAAGAAGATGACATTGTGAAAGAAAGTGATAAATACAGAG
CTGATGGAGAATACTATCCCAAAATATTATTTATTGGATTGAAACCATCA
TTCGCAGCTTCAGATGAGATCAAAGAAGTAGCGGACAAGTTCATCATGAT
TAATACTGACGAATAAGCCAATTCTTGCTGTTTTCCATCAAGACTGGTGT
GGTGCTTGCCAACTTTTGATCAGTATGGAAGTATGTTTGGAGCACCAGTT
CTTGGATAGTGGTTTCGGTAAAGACTATGTGTGGTATGAGTGGACCTCAG
GCTTGGCGGCTGCAAAACAACAATCACAATGGTGTCATGATGCGGGAATT
GGACAACAAGAATAAGAAATCCGATAAAACAAAATACTTCTACAAAAAAG
TTTCTGATGAACTGATCGAAGATTTCGAAGCGTCCAGTGAGTTTGTTGAA
CAAAGCAAGAAATTCCTACTGGCAAAAGCTGAAGATAAAGAGATTGGCAA
ATTGGGTGCATATAAAAGCGAAGGAAAATATGTCCCTAAAATCGTATTCA
TTAGACGCTTCCAATCTTATTGTTGAGTACTCGTTCTAAATGTAAACCCT
GCAAAAAATTGACATGGCTGAAACTTGATGATGCATTATCCCAAGCTAAA
GAAAAATGTGGGCCCTTTGGTTCTTGTTTTCGATTGTTGCTACATCAGCA
TCAGTCTATCGAGCAATGGAAAAAGCCAAGGAAAAGATGTCAGCGTGGAA
ACCAGGGGACCAGTCTGAAGAGACTAATCGAGTTGTCAAAAAACCAAAAG
ATGAATTATAGGACGACGTTGATGATGAATTAGCTGATTCTTTTGATATC
GATGGAACGTATGTACCGAGAATTTATTTCTTGGATCCTGAAGGCAAGAT
ATGGAAAGATTTATGGAACGTGGGTACAAGTTATTTGGACAACAAGTTCT
ACTTCTTCGAAAGCTCAGCAACTACTATCAAGATGATTGTGAGAGATGAA
GAGTTCAAAGAGAAATCTCAAGGATTCATCCTTGCTGACATTGAGCCAAA
AGCCAATTATGTTCTTAGTTCATCGCACAACTTGCCCCGCTTGTAAAGAA
ACTAAAACAGAAGAAGGTAAGAAAGAGAAGAGCACAACATTATCTCCTGG
TAAACGATTGTTATCAAACAGTGGTCTCAAATGGAATAACATTAATGCTG
CTCTGGAAGAAGCAAAGGAAAGTCTTGCAAACGATGAAATTTGCTGTTGG
GAAGTTTTATAACACACAAAACACTGCACAACAAAACACACAACAACAAA
CCACACAACAACAAGAAAAACAACAACAAAAACAGGATTCTCAAGGCAAA
GTACACCATGACCTTCACAACAGAGATCCCGCCTTCTTGAAATACAAATT
TTCATTCGCCTATGAAGAACAAAGATTCAGAGGAGCCTCATGACGAACAA
TATTTCATTGATGGTGGATATTATCCAAGAATTTATTTCTTAGATCCTGA
TGAGAACGTCCAGGTCAATCTCAACAACAGTTTGATCGACTCACCATACG
ATTCCACCCTCTTTTACTACGGTACCGATAAAGAGATTCTCAGCATGATG
AAAAGCGCCCAACAAACAATGAATATCACCCTCGGGCGGGGATTTGGTGA
ATACATTGACTGGGTGGCCTATCCAAGGGCGTTGGAGTTATGCAAGGAGA
AAAATATGCCAATGATGTTAATTATCCATAAAACGTGGTGTGGTGCATGT
AAATCTTTGAAACCAACGATCAAAGATTCGAGACCTATCTGGGAATTGAG
CAAATATTTCATCATGGTTAATACTGAGGAAGAGGAAGCGAAAGAAACGA
AAGAAAAATATGATGTCGATGGAAAATATTCACCAAGGATGTTCTTTATC
GACATGAAAGAGCAGCTCAATGAATCACCAGAGATCACTGAACTTTCTAA
CAAATTTGTTATGATTCGTGTCAGCGTTTTGGCACCAACATCAGATGGTA
CAATTATACAGTTGGAGTACAACAAGTGAAGAAGAATCACATGATTGGTC
TTGTCGTATTCTACAATAACTATTGTGAATTCGCTCGATTGATGACTAAC
ATGAACAAAGCTTTGGAGATGAAACTTGGTGAACGAACAGAGGATCACCA
ATACACACAACAACAACAACAACAACAACAACAACAAGATTCTCAGAACA
CTCAACAAGAATCGCAGAACACTCAACAAGAACAAACACAAACTCAGCAA
CAACCAAAAGAAGAAGCCAAGCAGAAAACTGATGACAGCAATGGTAAAGT
TGACGAATCCCTACGCAATGAAGGAAAATCTTTCAAAAAATCACGATACG
CTTATGGAAATGTTGACCAATGATGATGATGAACCAGATGAAGATCAATT
TGATGTTGATGGTGCCTACATTCCAAGAATATTCTTCTTAGCTCTCAAAC
CAAGAATTCAAAGAAGTAAAGAATTTGCTGAGCTCAGCAAGAAATTTGTC
ATGGTTACTGTTGAAGAAGAAGCCAATGATGTTAATCATCACCAAATCTT
ATTGTGGTGCTTGTAAAGATCTTGGAAAACACATCAAATGGGTTACTTAC
AAAAAAGGATTACAACTTGTTAAAACTTTTCCGCGCATCAATGGACCGAG
TCATTGGAAATATCACCGAAGCTCAAAACGTCAAAGACAATGACAGCGAT
GGTGATTTGATTGAAGAAGAATTGAATTATGGAACAAAACATAAACATGT
TCTTCATTATTATGGTTCAGGAAAAGAAAGAAGATGACATTGTGAAAGAA
AGTGATAAATACAGAGCTGATGGAGAATACTATCCCAAAATATTATTTAT
TGGATTGAAACCATCATTCGCAGCTTCAGATGAGATCAAAGAAGTAGCGG
ACAAGTTCATCATGATTAATACTGACGAATAAGCCAATTCTTGCTGTTTT
CCATCAAGACTGGTGTGGTGCTTGCCAACTTTTGATCAGTATGGAAGTAT
GTTTGGAGCACCAGTTCTTGGATAGTGGTTTCGGTAAAGACTATGTGTGG
TATGAGTGGACCTCAGGCTTGGCGGCTGCAAAACAACAATCACAATGGTG
TCATGATGCGGGAATTGGACAACAAGAATAAGAAATCCGATAAAACAAAA
TACTTCTACAAAAAAGTTTCTGATGAACTGATCGAAGATTTCGAAGCGTC
CAGTGAGTTTGTTGAACAAAGCAAGAAATTCCTACTGGCAAAAGCTGAAG
ATAAAGAGATTGGCAAATTGGGTGCATATAAAAGCGAAGGAAAATATGTC
CCTAAAATCGTATTCATTAGACGCTTCCAATCTTATTGTTGAGTACTCGT
TCTAAATGTAAACCCTGCAAAAAATTGACATGGCTGAAACTTGATGATGC
ATTATCCCAAGCTAAAGAAAAATGTGGGCCCTTTGGTTCTTGTTTTCGAT
TGTTGCTACATCAGCATCAGTCTATCGAGCAATGGAAAAAGCCAAGGAAA
AGATGTCAGCGTGGAAACCAGGGGACCAGTCTGAAGAGACTAATCGAGTT
GTCAAAAAACCAAAAGATGAATTATAGGACGACGTTGATGATGAATTAGC
TGATTCTTTTGATATCGATGGAACGTATGTACCGAGAATTTATTTCTTGG
ATCCTGAAGGCAAGATATGGAAAGATTTATGGAACGTGGGTACAAGTTAT
TTGGACAACAAGTTCTACTTCTTCGAAAGCTCAGCAACTACTATCAAGAT
GATTGTGAGAGATGAAGAGTTCAAAGAGAAATCTCAAGGATTCATCCTTG
CTGACATTGAGCCAAAAGCCAATTATGTTCTTAGTTCATCGCACAACTTG
CCCCGCTTGTAAAGAAACTAAAACAGAAGAAGGTAAGAAAGAGAAGAGCA
CAACATTATCTCCTGGTAAACGATTGTTATCAAACAGTGGTCTCAAATGG
AATAACATTAATGCTGCTCTGGAAGAAGCAAAGGAAAGTCTTGCAAACGA
TGAAATTTGCTGTTGGGAAGTTTTATAACACACAAAACACTGCACAACAA
AACACACAACAACAAACCACACAACAACAAGAAAAACAACAACAAAAACA
GGATTCTCAAGGCAAAGTACACCATGACCTTCACAACAGAGATCCCGCCT
TCTTGAAATACAAATTTTCATTCGCCTATGAAGAACAAAGATTCAGAGGA
GCCTCATGACGAACAATATTTCATTGATGGTGGATATTATCCAAGAATTT
ATTTCTTAGATCCTGATGAGAACGTCCAGGTCAATCTCAACAACAGTTTG
ATCGACTCACCATACGATTCCACCCTCTTTTACTACGGTACCGATAAAGA
GATTCTCAGCATGATGAAAAGCGCCCAACAAACAATGAATATCACCCTCG
GGCGGGGATTTGGTGAATACATTGACTGGGTGGCCTATCCAAGGGCGTTG
GAGTTATGCAAGGAGAAAAATATGCCAATGATGTTAATTATCCATAAAAC
GTGGTGTGGTGCATGTAAATCTTTGAAACCAACGATCAAAGATTCGAGAC
CTATCTGGGAATTGAGCAAATATTTCATCATGGTTAATACTGAGGAAGAG
GAAGCGAAAGAAACGAAAGAAAAATATGATGTCGATGGAAAATATTCACC
AAGGATGTTCTTTATCGACATGAAAGAGCAGCTCAATGAATCACCAGAGA
TCACTGAACTTTCTAACAAATTTGTTATGATTCGTGTCAGCGTTTTGGCA
CCAACATCAGATGGTACAATTATACAGTTGGAGTACAACAAGTGAAGAAG
AATCACATGATTGGTCTTGTCGTATTCTACAATAACTATTGTGAATTCGC
TCGATTGATGACTAACATGAACAAAGCTTTGGAGATGAAACTTGGTGAAC
GAACAGAGGATCACCAATACACACAACAACAACAACAACAACAACAACAA
CAAGATTCTCAGAACACTCAACAAGAATCGCAGAACACTCAACAAGAACA
AACACAAACTCAGCAACAACCAAAAGAAGAAGCCAAGCAGAAAACTGATG
ACAGCAATGGTAAAGTTGACGAATCCCTACGCAATGAAGGAAAATCTTTC
AAAAAATCACGATACGCTTATGGAAATGTTGACCAATGATGATGATGAAC
CAGATGAAGATCAATTTGATGTTGATGGTGCCTACATTCCAAGAATATTC
TTCTTAGCTCTCAAACCAAGAATTCAAAGAAGTAAAGAATTTGCTGAGCT
CAGCAAGAAATTTGTCATGGTTACTGTTGAAGAAGAAGCCAATGATGTTA
ATCATCACCAAATCTTATTGTGGTGCTTGTAAAGATCTTGGAAAACACAT
CAAATGGGTTACTTACAAAAAAGGATTACAACTTGTTAAAACTTTTCCGC
GCATCAATGGACCGAGTCATTGGAAATATCACCGAAGCTCAAAACGTCAA
AGACAATGACAGCGATGGTGATTTGATTGAAGAAGAATTGAATTATGGAA
CAAAACATAAACATGTTCTTCATTATTATGGTTCAGGAAAAGAAAGAAGA
TGACATTGTGAAAGAAAGTGATAAATACAGAGCTGATGGAGAATACTATC
CCAAAATATTATTTATTGGATTGAAACCATCATTCGCAGCTTCAGATGAG
ATCAAAGAAGTAGCGGACAAGTTCATCATGATTAATACTGACGAATAAGC
CAATTCTTGCTGTTTTCCATCAAGACTGGTGTGGTGCTTGCCAACTTTTG
ATCAGTATGGAAGTATGTTTGGAGCACCAGTTCTTGGATAGTGGTTTCGG
TAAAGACTATGTGTGGTATGAGTGGACCTCAGGCTTGGCGGCTGCAAAAC
AACAATCACAATGGTGTCATGATGCGGGAATTGGACAACAAGAATAAGAA
ATCCGATAAAACAAAATACTTCTACAAAAAAGTTTCTGATGAACTGATCG
AAGATTTCGAAGCGTCCAGTGAGTTTGTTGAACAAAGCAAGAAATTCCTA
CTGGCAAAAGCTGAAGATAAAGAGATTGGCAAATTGGGTGCATATAAAAG
CGAAGGAAAATATGTCCCTAAAATCGTATTCATTAGACGCTTCCAATCTT
ATTGTTGAGTACTCGTTCTAAATGTAAACCCTGCAAAAAATTGACATGGC
TGAAACTTGATGATGCATTATCCCAAGCTAAAGAAAAATGTGGGCCCTTT
GGTTCTTGTTTTCGATTGTTGCTACATCAGCATCAGTCTATCGAGCAATG
GAAAAAGCCAAGGAAAAGATGTCAGCGTGGAAACCAGGGGACCAGTCTGA
AGAGACTAATCGAGTTGTCAAAAAACCAAAAGATGAATTATAGGACGACG
TTGATGATGAATTAGCTGATTCTTTTGATATCGATGGAACGTATGTACCG
AGAATTTATTTCTTGGATCCTGAAGGCAAGATATGGAAAGATTTATGGAA
CGTGGGTACAAGTTATTTGGACAACAAGTTCTACTTCTTCGAAAGCTCAG
CAACTACTATCAAGATGATTGTGAGAGATGAAGAGTTCAAAGAGAAATCT
CAAGGATTCATCCTTGCTGACATTGAGCCAAAAGCCAATTATGTTCTTAG
TTCATCGCACAACTTGCCCCGCTTGTAAAGAAACTAAAACAGAAGAAGGT
AAGAAAGAGAAGAGCACAACATTATCTCCTGGTAAACGATTGTTATCAAA
CAGTGGTCTCAAATGGAATAACATTAATGCTGCTCTGGAAGAAGCAAAGG
AAAGTCTTGCAAACGATGAAATTTGCTGTTGGGAAGTTTTATAACACACA
AAACACTGCACAACAAAACACACAACAACAAACCACACAACAACAAGAAA
AACAACAACAAAAACAGGATTCTCAAGGCAAAGTACACCATGACCTTCAC
AACAGAGATCCCGCCTTCTTGAAATACAAATTTTCATTCGCCTATGAAGA
ACAAAGATTCAGAGGAGCCTCATGACGAACAATATTTCATTGATGGTGGA
TATTATCCAAGAATTTATTTCTTAGATCCTGATGAGAACGTCCAGGTCAA
TCTCAACAACAGTTTGATCGACTCACCATACGATTCCACCCTCTTTTACT
ACGGTACCGATAAAGAGATTCTCAGCATGATGAAAAGCGCCCAACAAACA
ATGAATATCACCCTCGGGCGGGGATTTGGTGAATACATTGACTGGGTGGC
CTATCCAAGGGCGTTGGAGTTATGCAAGGAGAAAAATATGCCAATGATGT
TAATTATCCATAAAACGTGGTGTGGTGCATGTAAATCTTTGAAACCAACG
ATCAAAGATTCGAGACCTATCTGGGAATTGAGCAAATATTTCATCATGGT
TAATACTGAGGAAGAGGAAGCGAAAGAAACGAAAGAAAAATATGATGTCG
ATGGAAAATATTCACCAAGGATGTTCTTTATCGACATGAAAGAGCAGCTC
AATGAATCACCAGAGATCACTGAACTTTCTAACAAATTTGTTATGATTCG
TGTCAGCGTTTTGGCACCAACATCAGATGGTACAATTATACAGTTGGAGT
ACAACAAGTGAAGAAGAATCACATGATTGGTCTTGTCGTATTCTACAATA
ACTATTGTGAATTCGCTCGATTGATGACTAACATGAACAAAGCTTTGGAG
ATGAAACTTGGTGAACGAACAGAGGATCACCAATACACACAACAACAACA
ACAACAACAACAACAACAAGATTCTCAGAACACTCAACAAGAATCGCAGA
ACACTCAACAAGAACAAACACAAACTCAGCAACAACCAAAAGAAGAAGCC
AAGCAGAAAACTGATGACAGCAATGGTAAAGTTGACGAATCCCTACGCAA
TGAAGGAAAATCTTTCAAAAAATCACGATACGCTTATGGAAATGTTGACC
AATGATGATGATGAACCAGATGAAGATCAATTTGATGTTGATGGTGCCTA
CATTCCAAGAATATTCTTCTTAGCTCTCAAACCAAGAATTCAAAGAAGTA
AAGAATTTGCTGAGCTCAGCAAGAAATTTGTCATGGTTACTGTTGAAGAA
GAAGCCAATGATGTTAATCATCACCAAATCTTATTGTGGTGCTTGTAAAG
ATCTTGGAAAACACATCAAATGGGTTACTTACAAAAAAGGATTACAACTT
GTTAAAACTTTTCCGCGCATCAATGGACCGAGTCATTGGAAATATCACCG
AAGCTCAAAACGTCAAAGACAATGACAGCGATGGTGATTTGATTGAAGAA
GAATTGAATTATGGAACAAAACATAAACATGTTCTTCATTATTATGGTTC
AGGAAAAGAAAGAAGATGACATTGTGAAAGAAAGTGATAAATACAGAGCT
GATGGAGAATACTATCCCAAAATATTATTTATTGGATTGAAACCATCATT
CGCAGCTTCAGATGAGATCAAAGAAGTAGCGGACAAGTTCATCATGATTA
ATACTGACGAATAAGCCAATTCTTGCTGTTTTCCATCAAGACTGGTGTGG
TGCTTGCCAACTTTTGATCAGTATGGAAGTATGTTTGGAGCACCAGTTCT
TGGATAGTGGTTTCGGTAAAGACTATGTGTGGTATGAGTGGACCTCAGGC
TTGGCGGCTGCAAAACAACAATCACAATGGTGTCATGATGCGGGAATTGG
ACAACAAGAATAAGAAATCCGATAAAACAAAATACTTCTACAAAAAAGTT
TCTGATGAACTGATCGAAGATTTCGAAGCGTCCAGTGAGTTTGTTGAACA
AAGCAAGAAATTCCTACTGGCAAAAGCTGAAGATAAAGAGATTGGCAAAT
TGGGTGCATATAAAAGCGAAGGAAAATATGTCCCTAAAATCGTATTCATT
AGACGCTTCCAATCTTATTGTTGAGTACTCGTTCTAAATGTAAACCCTGC
AAAAAATTGACATGGCTGAAACTTGATGATGCATTATCCCAAGCTAAAGA
AAAATGTGGGCCCTTTGGTTCTTGTTTTCGATTGTTGCTACATCAGCATC
AGTCTATCGAGCAATGGAAAAAGCCAAGGAAAAGATGTCAGCGTGGAAAC
CAGGGGACCAGTCTGAAGAGACTAATCGAGTTGTCAAAAAACCAAAAGAT
GAATTATAGGACGACGTTGATGATGAATTAGCTGATTCTTTTGATATCGA
TGGAACGTATGTACCGAGAATTTATTTCTTGGATCCTGAAGGCAAGATAT
GGAAAGATTTATGGAACGTGGGTACAAGTTATTTGGACAACAAGTTCTAC
TTCTTCGAAAGCTCAGCAACTACTATCAAGATGATTGTGAGAGATGAAGA
GTTCAAAGAGAAATCTCAAGGATTCATCCTTGCTGACATTGAGCCAAAAG
CCAATTATGTTCTTAGTTCATCGCACAACTTGCCCCGCTTGTAAAGAAAC
TAAAACAGAAGAAGGTAAGAAAGAGAAGAGCACAACATTATCTCCTGGTA
AACGATTGTTATCAAACAGTGGTCTCAAATGGAATAACATTAATGCTGCT
CTGGAAGAAGCAAAGGAAAGTCTTGCAAACGATGAAATTTGCTGTTGGGA
AGTTTTATAACACACAAAACACTGCACAACAAAACACACAACAACAAACC
ACACAACAACAAGAAAAACAACAACAAAAACAGGATTCTCAAGGCAAAGT
ACACCATGACCTTCACAACAGAGATCCCGCCTTCTTGAAATACAAATTTT
CATTCGCCTATGAAGAACAAAGATTCAGAGGAGCCTCATGACGAACAATA
TTTCATTGATGGTGGATATTATCCAAGAATTTATTTCTTAGATCCTGATG
AGAACGTCCAGGTCAATCTCAACAACAGTTTGATCGACTCACCATACGAT
TCCACCCTCTTTTACTACGGTACCGATAAAGAGATTCTCAGCATGATGAA
AAGCGCCCAACAAACAATGAATATCACCCTCGGGCGGGGATTTGGTGAAT
ACATTGACTGGGTGGCCTATCCAAGGGCGTTGGAGTTATGCAAGGAGAAA
AATATGCCAATGATGTTAATTATCCATAAAACGTGGTGTGGTGCATGTAA
ATCTTTGAAACCAACGATCAAAGATTCGAGACCTATCTGGGAATTGAGCA
AATATTTCATCATGGTTAATACTGAGGAAGAGGAAGCGAAAGAAACGAAA
GAAAAATATGATGTCGATGGAAAATATTCACCAAGGATGTTCTTTATCGA
CATGAAAGAGCAGCTCAATGAATCACCAGAGATCACTGAACTTTCTAACA
AATTTGTTATGATTCGTGTCAGCGTTTTGGCACCAACATCAGATGGTACA
ATTATACAGTTGGAGTACAACAAGTGAAGAAGAATCACATGATTGGTCTT
GTCGTATTCTACAATAACTATTGTGAATTCGCTCGATTGATGACTAACAT
GAACAAAGCTTTGGAGATGAAACTTGGTGAACGAACAGAGGATCACCAAT
ACACACAACAACAACAACAACAACAACAACAACAAGATTCTCAGAACACT
CAACAAGAATCGCAGAACACTCAACAAGAACAAACACAAACTCAGCAACA
ACCAAAAGAAGAAGCCAAGCAGAAAACTGATGACAGCAATGGTAAAGTTG
ACGAATCCCTACGCAATGAAGGAAAATCTTTCAAAAAATCACGATACGCT
TATGGAAATGTTGACCAATGATGATGATGAACCAGATGAAGATCAATTTG
ATGTTGATGGTGCCTACATTCCAAGAATATTCTTCTTAGCTCTCAAACCA
AGAATTCAAAGAAGTAAAGAATTTGCTGAGCTCAGCAAGAAATTTGTCAT
GGTTACTGTTGAAGAAGAAGCCAATGATGTTAATCATCACCAAATCTTAT
TGTGGTGCTTGTAAAGATCTTGGAAAACACATCAAATGGGTTACTTACAA
AAAAGGATTACAACTTGTTAAAACTTTTCCGCGCATCAATGGACCGAGTC
ATTGGAAATATCACCGAAGCTCAAAACGTCAAAGACAATGACAGCGATGG
TGATTTGATTGAAGAAGAATTGAATTATGGAACAAAACATAAACATGTTC
TTCATTATTATGGTTCAGGAAAAGAAAGAAGATGACATTGTGAAAGAAAG
TGATAAATACAGAGCTGATGGAGAATACTATCCCAAAATATTATTTATTG
GATTGAAACCATCATTCGCAGCTTCAGATGAGATCAAAGAAGTAGCGGAC
AAGTTCATCATGATTAATACTGACGAATAAGCCAATTCTTGCTGTTTTCC
ATCAAGACTGGTGTGGTGCTTGCCAACTTTTGATCAGTATGGAAGTATGT
TTGGAGCACCAGTTCTTGGATAGTGGTTTCGGTAAAGACTATGTGTGGTA
TGAGTGGACCTCAGGCTTGGCGGCTGCAAAACAACAATCACAATGGTGTC
ATGATGCGGGAATTGGACAACAAGAATAAGAAATCCGATAAAACAAAATA
CTTCTACAAAAAAGTTTCTGATGAACTGATCGAAGATTTCGAAGCGTCCA
GTGAGTTTGTTGAACAAAGCAAGAAATTCCTACTGGCAAAAGCTGAAGAT
AAAGAGATTGGCAAATTGGGTGCATATAAAAGCGAAGGAAAATATGTCCC
TAAAATCGTATTCATTAGACGCTTCCAATCTTATTGTTGAGTACTCGTTC
TAAATGTAAACCCTGCAAAAAATTGACATGGCTGAAACTTGATGATGCAT
TATCCCAAGCTAAAGAAAAATGTGGGCCCTTTGGTTCTTGTTTTCGATTG
TTGCTACATCAGCATCAGTCTATCGAGCAATGGAAAAAGCCAAGGAAAAG
ATGTCAGCGTGGAAACCAGGGGACCAGTCTGAAGAGACTAATCGAGTTGT
CAAAAAACCAAAAGATGAATTATAGGACGACGTTGATGATGAATTAGCTG
ATTCTTTTGATATCGATGGAACGTATGTACCGAGAATTTATTTCTTGGAT
CCTGAAGGCAAGATATGGAAAGATTTATGGAACGTGGGTACAAGTTATTT
GGACAACAAGTTCTACTTCTTCGAAAGCTCAGCAACTACTATCAAGATGA
TTGTGAGAGATGAAGAGTTCAAAGAGAAATCTCAAGGATTCATCCTTGCT
GACATTGAGCCAAAAGCCAATTATGTTCTTAGTTCATCGCACAACTTGCC
CCGCTTGTAAAGAAACTAAAACAGAAGAAGGTAAGAAAGAGAAGAGCACA
ACATTATCTCCTGGTAAACGATTGTTATCAAACAGTGGTCTCAAATGGAA
TAACATTAATGCTGCTCTGGAAGAAGCAAAGGAAAGTCTTGCAAACGATG
AAATTTGCTGTTGGGAAGTTTTATAACACACAAAACACTGCACAACAAAA
CACACAACAACAAACCACACAACAACAAGAAAAACAACAACAAAAACAGG
ATTCTCAAGGCAAAGTACACCATGACCTTCACAACAGAGATCCCGCCTTC
TTGAAATACAAATTTTCATTCGCCTATGAAGAACAAAGATTCAGAGGAGC
CTCATGACGAACAATATTTCATTGATGGTGGATATTATCCAAGAATTTAT
TTCTTAGATCCTGATGAGAACGTCCAGGTCAATCTCAACAACAGTTTGAT
CGACTCACCATACGATTCCACCCTCTTTTACTACGGTACCGATAAAGAGA
TTCTCAGCATGATGAAAAGCGCCCAACAAACAATGAATATCACCCTCGGG
CGGGGATTTGGTGAATACATTGACTGGGTGGCCTATCCAAGGGCGTTGGA
GTTATGCAAGGAGAAAAATATGCCAATGATGTTAATTATCCATAAAACGT
GGTGTGGTGCATGTAAATCTTTGAAACCAACGATCAAAGATTCGAGACCT
ATCTGGGAATTGAGCAAATATTTCATCATGGTTAATACTGAGGAAGAGGA
AGCGAAAGAAACGAAAGAAAAATATGATGTCGATGGAAAATATTCACCAA
GGATGTTCTTTATCGACATGAAAGAGCAGCTCAATGAATCACCAGAGATC
ACTGAACTTTCTAACAAATTTGTTATGATTCGTGTCAGCGTTTTGGCACC
AACATCAGATGGTACAATTATACAGTTGGAGTACAACAAGTGAAGAAGAA
TCACATGATTGGTCTTGTCGTATTCTACAATAACTATTGTGAATTCGCTC
GATTGATGACTAACATGAACAAAGCTTTGGAGATGAAACTTGGTGAACGA
ACAGAGGATCACCAATACACACAACAACAACAACAACAACAACAACAACA
AGATTCTCAGAACACTCAACAAGAATCGCAGAACACTCAACAAGAACAAA
CACAAACTCAGCAACAACCAAAAGAAGAAGCCAAGCAGAAAACTGATGAC
AGCAATGGTAAAGTTGACGAATCCCTACGCAATGAAGGAAAATCTTTCAA
AAAATCACGATACGCTTATGGAAATGTTGACCAATGATGATGATGAACCA
GATGAAGATCAATTTGATGTTGATGGTGCCTACATTCCAAGAATATTCTT
CTTAGCTCTCAAACCAAGAATTCAAAGAAGTAAAGAATTTGCTGAGCTCA
GCAAGAAATTTGTCATGGTTACTGTTGAAGAAGAAGCCAATGATGTTAAT
CATCACCAAATCTTATTGTGGTGCTTGTAAAGATCTTGGAAAACACATCA
AATGGGTTACTTACAAAAAAGGATTACAACTTGTTAAAACTTTTCCGCGC
ATCAATGGACCGAGTCATTGGAAATATCACCGAAGCTCAAAACGTCAAAG
ACAATGACAGCGATGGTGATTTGATTGAAGAAGAATTGAATTATGGAACA
AAACATAAACATGTTCTTCATTATTATGGTTCAGGAAAAGAAAGAAGATG
ACATTGTGAAAGAAAGTGATAAATACAGAGCTGATGGAGAATACTATCCC
AAAATATTATTTATTGGATTGAAACCATCATTCGCAGCTTCAGATGAGAT
CAAAGAAGTAGCGGACAAGTTCATCATGATTAATACTGACGAATAAGCCA
ATTCTTGCTGTTTTCCATCAAGACTGGTGTGGTGCTTGCCAACTTTTGAT
CAGTATGGAAGTATGTTTGGAGCACCAGTTCTTGGATAGTGGTTTCGGTA
AAGACTATGTGTGGTATGAGTGGACCTCAGGCTTGGCGGCTGCAAAACAA
CAATCACAATGGTGTCATGATGCGGGAATTGGACAACAAGAATAAGAAAT
CCGATAAAACAAAATACTTCTACAAAAAAGTTTCTGATGAACTGATCGAA
GATTTCGAAGCGTCCAGTGAGTTTGTTGAACAAAGCAAGAAATTCCTACT
GGCAAAAGCTGAAGATAAAGAGATTGGCAAATTGGGTGCATATAAAAGCG
AAGGAAAATATGTCCCTAAAATCGTATTCATTAGACGCTTCCAATCTTAT
TGTTGAGTACTCGTTCTAAATGTAAACCCTGCAAAAAATTGACATGGCTG
AAACTTGATGATGCATTATCCCAAGCTAAAGAAAAATGTGGGCCCTTTGG
TTCTTGTTTTCGATTGTTGCTACATCAGCATCAGTCTATCGAGCAATGGA
AAAAGCCAAGGAAAAGATGTCAGCGTGGAAACCAGGGGACCAGTCTGAAG
AGACTAATCGAGTTGTCAAAAAACCAAAAGATGAATTATAGGACGACGTT
GATGATGAATTAGCTGATTCTTTTGATATCGATGGAACGTATGTACCGAG
AATTTATTTCTTGGATCCTGAAGGCAAGATATGGAAAGATTTATGGAACG
TGGGTACAAGTTATTTGGACAACAAGTTCTACTTCTTCGAAAGCTCAGCA
ACTACTATCAAGATGATTGTGAGAGATGAAGAGTTCAAAGAGAAATCTCA
AGGATTCATCCTTGCTGACATTGAGCCAAAAGCCAATTATGTTCTTAGTT
CATCGCACAACTTGCCCCGCTTGTAAAGAAACTAAAACAGAAGAAGGTAA
GAAAGAGAAGAGCACAACATTATCTCCTGGTAAACGATTGTTATCAAACA
GTGGTCTCAAATGGAATAACATTAATGCTGCTCTGGAAGAAGCAAAGGAA
AGTCTTGCAAACGATGAAATTTGCTGTTGGGAAGTTTTATAACACACAAA
ACACTGCACAACAAAACACACAACAACAAACCACACAACAACAAGAAAAA
CAACAACAAAAACAGGATTCTCAAGGCAAAGTACACCATGACCTTCACAA
CAGAGATCCCGCCTTCTTGAAATACAAATTTTCATTCGCCTATGAAGAAC
AAAGATTCAGAGGAGCCTCATGACGAACAATATTTCATTGATGGTGGATA
TTATCCAAGAATTTATTTCTTAGATCCTGATGAGAACGTCCAGGTCAATC
TCAACAACAGTTTGATCGACTCACCATACGATTCCACCCTCTTTTACTAC
GGTACCGATAAAGAGATTCTCAGCATGATGAAAAGCGCCCAACAAACAAT
GAATATCACCCTCGGGCGGGGATTTGGTGAATACATTGACTGGGTGGCCT
ATCCAAGGGCGTTGGAGTTATGCAAGGAGAAAAATATGCCAATGATGTTA
ATTATCCATAAAACGTGGTGTGGTGCATGTAAATCTTTGAAACCAACGAT
CAAAGATTCGAGACCTATCTGGGAATTGAGCAAATATTTCATCATGGTTA
ATACTGAGGAAGAGGAAGCGAAAGAAACGAAAGAAAAATATGATGTCGAT
GGAAAATATTCACCAAGGATGTTCTTTATCGACATGAAAGAGCAGCTCAA
TGAATCACCAGAGATCACTGAACTTTCTAACAAATTTGTTATGATTCGTG
TCAGCGTTTTGGCACCAACATCAGATGGTACAATTATACAGTTGGAGTAC
AACAAGTGAAGAAGAATCACATGATTGGTCTTGTCGTATTCTACAATAAC
TATTGTGAATTCGCTCGATTGATGACTAACATGAACAAAGCTTTGGAGAT
GAAACTTGGTGAACGAACAGAGGATCACCAATACACACAACAACAACAAC
AACAACAACAACAACAAGATTCTCAGAACACTCAACAAGAATCGCAGAAC
ACTCAACAAGAACAAACACAAACTCAGCAACAACCAAAAGAAGAAGCCAA
GCAGAAAACTGATGACAGCAATGGTAAAGTTGACGAATCCCTACGCAATG
AAGGAAAATCTTTCAAAAAATCACGATACGCTTATGGAAATGTTGACCAA
TGATGATGATGAACCAGATGAAGATCAATTTGATGTTGATGGTGCCTACA
TTCCAAGAATATTCTTCTTAGCTCTCAAACCAAGAATTCAAAGAAGTAAA
GAATTTGCTGAGCTCAGCAAGAAATTTGTCATGGTTACTGTTGAAGAAGA
AGCCAATGATGTTAATCATCACCAAATCTTATTGTGGTGCTTGTAAAGAT
CTTGGAAAACACATCAAATGGGTTACTTACAAAAAAGGATTACAACTTGT
TAAAACTTTTCCGCGCATCAATGGACCGAGTCATTGGAAATATCACCGAA
GCTCAAAACGTCAAAGACAATGACAGCGATGGTGATTTGATTGAAGAAGA
ATTGAATTATGGAACAAAACATAAACATGTTCTTCATTATTATGGTTCAG
GAAAAGAAAGAAGATGACATTGTGAAAGAAAGTGATAAATACAGAGCTGA
TGGAGAATACTATCCCAAAATATTATTTATTGGATTGAAACCATCATTCG
CAGCTTCAGATGAGATCAAAGAAGTAGCGGACAAGTTCATCATGATTAAT
ACTGACGAATAAGCCAATTCTTGCTGTTTTCCATCAAGACTGGTGTGGTG
CTTGCCAACTTTTGATCAGTATGGAAGTATGTTTGGAGCACCAGTTCTTG
GATAGTGGTTTCGGTAAAGACTATGTGTGGTATGAGTGGACCTCAGGCTT
GGCGGCTGCAAAACAACAATCACAATGGTGTCATGATGCGGGAATTGGAC
AACAAGAATAAGAAATCCGATAAAACAAAATACTTCTACAAAAAAGTTTC
TGATGAACTGATCGAAGATTTCGAAGCGTCCAGTGAGTTTGTTGAACAAA
GCAAGAAATTCCTACTGGCAAAAGCTGAAGATAAAGAGATTGGCAAATTG
GGTGCATATAAAAGCGAAGGAAAATATGTCCCTAAAATCGTATTCATTAG
ACGCTTCCAATCTTATTGTTGAGTACTCGTTCTAAATGTAAACCCTGCAA
AAAATTGACATGGCTGAAACTTGATGATGCATTATCCCAAGCTAAAGAAA
AATGTGGGCCCTTTGGTTCTTGTTTTCGATTGTTGCTACATCAGCATCAG
TCTATCGAGCAATGGAAAAAGCCAAGGAAAAGATGTCAGCGTGGAAACCA
GGGGACCAGTCTGAAGAGACTAATCGAGTTGTCAAAAAACCAAAAGATGA
ATTATAGGACGACGTTGATGATGAATTAGCTGATTCTTTTGATATCGATG
GAACGTATGTACCGAGAATTTATTTCTTGGATCCTGAAGGCAAGATATGG
AAAGATTTATGGAACGTGGGTACAAGTTATTTGGACAACAAGTTCTACTT
CTTCGAAAGCTCAGCAACTACTATCAAGATGATTGTGAGAGATGAAGAGT
TCAAAGAGAAATCTCAAGGATTCATCCTTGCTGACATTGAGCCAAAAGCC
AATTATGTTCTTAGTTCATCGCACAACTTGCCCCGCTTGTAAAGAAACTA
AAACAGAAGAAGGTAAGAAAGAGAAGAGCACAACATTATCTCCTGGTAAA
CGATTGTTATCAAACAGTGGTCTCAAATGGAATAACATTAATGCTGCTCT
GGAAGAAGCAAAGGAAAGTCTTGCAAACGATGAAATTTGCTGTTGGGAAG
TTTTATAACACACAAAACACTGCACAACAAAACACACAACAACAAACCAC
ACAACAACAAGAAAAACAACAACAAAAACAGGATTCTCAAGGCAAAGTAC
ACCATGACCTTCACAACAGAGATCCCGCCTTCTTGAAATACAAATTTTCA
TTCGCCTATGAAGAACAAAGATTCAGAGGAGCCTCATGACGAACAATATT
TCATTGATGGTGGATATTATCCAAGAATTTATTTCTTAGATCCTGATGAG
AACGTCCAGGTCAATCTCAACAACAGTTTGATCGACTCACCATACGATTC
CACCCTCTTTTACTACGGTACCGATAAAGAGATTCTCAGCATGATGAAAA
GCGCCCAACAAACAATGAATATCACCCTCGGGCGGGGATTTGGTGAATAC
ATTGACTGGGTGGCCTATCCAAGGGCGTTGGAGTTATGCAAGGAGAAAAA
TATGCCAATGATGTTAATTATCCATAAAACGTGGTGTGGTGCATGTAAAT
CTTTGAAACCAACGATCAAAGATTCGAGACCTATCTGGGAATTGAGCAAA
TATTTCATCATGGTTAATACTGAGGAAGAGGAAGCGAAAGAAACGAAAGA
AAAATATGATGTCGATGGAAAATATTCACCAAGGATGTTCTTTATCGACA
TGAAAGAGCAGCTCAATGAATCACCAGAGATCACTGAACTTTCTAACAAA
TTTGTTATGATTCGTGTCAGCGTTTTGGCACCAACATCAGATGGTACAAT
TATACAGTTGGAGTACAACAAGTGAAGAAGAATCACATGATTGGTCTTGT
CGTATTCTACAATAACTATTGTGAATTCGCTCGATTGATGACTAACATGA
ACAAAGCTTTGGAGATGAAACTTGGTGAACGAACAGAGGATCACCAATAC
ACACAACAACAACAACAACAACAACAACAACAAGATTCTCAGAACACTCA
ACAAGAATCGCAGAACACTCAACAAGAACAAACACAAACTCAGCAACAAC
CAAAAGAAGAAGCCAAGCAGAAAACTGATGACAGCAATGGTAAAGTTGAC
GAATCCCTACGCAATGAAGGAAAATCTTTCAAAAAATCACGATACGCTTA
TGGAAATGTTGACCAATGATGATGATGAACCAGATGAAGATCAATTTGAT
GTTGATGGTGCCTACATTCCAAGAATATTCTTCTTAGCTCTCAAACCAAG
AATTCAAAGAAGTAAAGAATTTGCTGAGCTCAGCAAGAAATTTGTCATGG
TTACTGTTGAAGAAGAAGCCAATGATGTTAATCATCACCAAATCTTATTG
TGGTGCTTGTAAAGATCTTGGAAAACACATCAAATGGGTTACTTACAAAA
AAGGATTACAACTTGTTAAAACTTTTCCGCGCATCAATGGACCGAGTCAT
TGGAAATATCACCGAAGCTCAAAACGTCAAAGACAATGACAGCGATGGTG
ATTTGATTGAAGAAGAATTGAATTATGGAACAAAACATAAACATGTTCTT
CATTATTATGGTTCAGGAAAAGAAAGAAGATGACATTGTGAAAGAAAGTG
ATAAATACAGAGCTGATGGAGAATACTATCCCAAAATATTATTTATTGGA
TTGAAACCATCATTCGCAGCTTCAGATGAGATCAAAGAAGTAGCGGACAA
GTTCATCATGATTAATACTGACGAATAAGCCAATTCTTGCTGTTTTCCAT
CAAGACTGGTGTGGTGCTTGCCAACTTTTGATCAGTATGGAAGTATGTTT
GGAGCACCAGTTCTTGGATAGTGGTTTCGGTAAAGACTATGTGTGGTATG
AGTGGACCTCAGGCTTGGCGGCTGCAAAACAACAATCACAATGGTGTCAT
GATGCGGGAATTGGACAACAAGAATAAGAAATCCGATAAAACAAAATACT
TCTACAAAAAAGTTTCTGATGAACTGATCGAAGATTTCGAAGCGTCCAGT
GAGTTTGTTGAACAAAGCAAGAAATTCCTACTGGCAAAAGCTGAAGATAA
AGAGATTGGCAAATTGGGTGCATATAAAAGCGAAGGAAAATATGTCCCTA
AAATCGTATTCATTAGACGCTTCCAATCTTATTGTTGAGTACTCGTTCTA
AATGTAAACCCTGCAAAAAATTGACATGGCTGAAACTTGATGATGCATTA
TCCCAAGCTAAAGAAAAATGTGGGCCCTTTGGTTCTTGTTTTCGATTGTT
GCTACATCAGCATCAGTCTATCGAGCAATGGAAAAAGCCAAGGAAAAGAT
GTCAGCGTGGAAACCAGGGGACCAGTCTGAAGAGACTAATCGAGTTGTCA
AAAAACCAAAAGATGAATTATAGGACGACGTTGATGATGAATTAGCTGAT
TCTTTTGATATCGATGGAACGTATGTACCGAGAATTTATTTCTTGGATCC
TGAAGGCAAGATATGGAAAGATTTATGGAACGTGGGTACAAGTTATTTGG
ACAACAAGTTCTACTTCTTCGAAAGCTCAGCAACTACTATCAAGATGATT
GTGAGAGATGAAGAGTTCAAAGAGAAATCTCAAGGATTCATCCTTGCTGA
CATTGAGCCAAAAGCCAATTATGTTCTTAGTTCATCGCACAACTTGCCCC
GCTTGTAAAGAAACTAAAACAGAAGAAGGTAAGAAAGAGAAGAGCACAAC
ATTATCTCCTGGTAAACGATTGTTATCAAACAGTGGTCTCAAATGGAATA
ACATTAATGCTGCTCTGGAAGAAGCAAAGGAAAGTCTTGCAAACGATGAA
ATTTGCTGTTGGGAAGTTTTATAACACACAAAACACTGCACAACAAAACA
CACAACAACAAACCACACAACAACAAGAAAAACAACAACAAAAACAGGAT
TCTCAAGGCAAAGTACACCATGACCTTCACAACAGAGATCCCGCCTTCTT
GAAATACAAATTTTCATTCGCCTATGAAGAACAAAGATTCAGAGGAGCCT
CATGACGAACAATATTTCATTGATGGTGGATATTATCCAAGAATTTATTT
CTTAGATCCTGATGAGAACGTCCAGGTCAATCTCAACAACAGTTTGATCG
ACTCACCATACGATTCCACCCTCTTTTACTACGGTACCGATAAAGAGATT
CTCAGCATGATGAAAAGCGCCCAACAAACAATGAATATCACCCTCGGGCG
GGGATTTGGTGAATACATTGACTGGGTGGCCTATCCAAGGGCGTTGGAGT
TATGCAAGGAGAAAAATATGCCAATGATGTTAATTATCCATAAAACGTGG
TGTGGTGCATGTAAATCTTTGAAACCAACGATCAAAGATTCGAGACCTAT
CTGGGAATTGAGCAAATATTTCATCATGGTTAATACTGAGGAAGAGGAAG
CGAAAGAAACGAAAGAAAAATATGATGTCGATGGAAAATATTCACCAAGG
ATGTTCTTTATCGACATGAAAGAGCAGCTCAATGAATCACCAGAGATCAC
TGAACTTTCTAACAAATTTGTTATGATTCGTGTCAGCGTTTTGGCACCAA
CATCAGATGGTACAATTATACAGTTGGAGTACAACAAGTGAAGAAGAATC
ACATGATTGGTCTTGTCGTATTCTACAATAACTATTGTGAATTCGCTCGA
TTGATGACTAACATGAACAAAGCTTTGGAGATGAAACTTGGTGAACGAAC
AGAGGATCACCAATACACACAACAACAACAACAACAACAACAACAACAAG
ATTCTCAGAACACTCAACAAGAATCGCAGAACACTCAACAAGAACAAACA
CAAACTCAGCAACAACCAAAAGAAGAAGCCAAGCAGAAAACTGATGACAG
CAATGGTAAAGTTGACGAATCCCTACGCAATGAAGGAAAATCTTTCAAAA
AATCACGATACGCTTATGGAAATGTTGACCAATGATGATGATGAACCAGA
TGAAGATCAATTTGATGTTGATGGTGCCTACATTCCAAGAATATTCTTCT
TAGCTCTCAAACCAAGAATTCAAAGAAGTAAAGAATTTGCTGAGCTCAGC
AAGAAATTTGTCATGGTTACTGTTGAAGAAGAAGCCAATGATGTTAATCA
TCACCAAATCTTATTGTGGTGCTTGTAAAGATCTTGGAAAACACATCAAA
TGGGTTACTTACAAAAAAGGATTACAACTTGTTAAAACTTTTCCGCGCAT
CAATGGACCGAGTCATTGGAAATATCACCGAAGCTCAAAACGTCAAAGAC
AATGACAGCGATGGTGATTTGATTGAAGAAGAATTGAATTATGGAACAAA
ACATAAACATGTTCTTCATTATTATGGTTCAGGAAAAGAAAGAAGATGAC
ATTGTGAAAGAAAGTGATAAATACAGAGCTGATGGAGAATACTATCCCAA
AATATTATTTATTGGATTGAAACCATCATTCGCAGCTTCAGATGAGATCA
AAGAAGTAGCGGACAAGTTCATCATGATTAATACTGACGAATAAGCCAAT
TCTTGCTGTTTTCCATCAAGACTGGTGTGGTGCTTGCCAACTTTTGATCA
GTATGGAAGTATGTTTGGAGCACCAGTTCTTGGATAGTGGTTTCGGTAAA
GACTATGTGTGGTATGAGTGGACCTCAGGCTTGGCGGCTGCAAAACAACA
ATCACAATGGTGTCATGATGCGGGAATTGGACAACAAGAATAAGAAATCC
GATAAAACAAAATACTTCTACAAAAAAGTTTCTGATGAACTGATCGAAGA
TTTCGAAGCGTCCAGTGAGTTTGTTGAACAAAGCAAGAAATTCCTACTGG
CAAAAGCTGAAGATAAAGAGATTGGCAAATTGGGTGCATATAAAAGCGAA
GGAAAATATGTCCCTAAAATCGTATTCATTAGACGCTTCCAATCTTATTG
TTGAGTACTCGTTCTAAATGTAAACCCTGCAAAAAATTGACATGGCTGAA
ACTTGATGATGCATTATCCCAAGCTAAAGAAAAATGTGGGCCCTTTGGTT
CTTGTTTTCGATTGTTGCTACATCAGCATCAGTCTATCGAGCAATGGAAA
AAGCCAAGGAAAAGATGTCAGCGTGGAAACCAGGGGACCAGTCTGAAGAG
ACTAATCGAGTTGTCAAAAAACCAAAAGATGAATTATAGGACGACGTTGA
TGATGAATTAGCTGATTCTTTTGATATCGATGGAACGTATGTACCGAGAA
TTTATTTCTTGGATCCTGAAGGCAAGATATGGAAAGATTTATGGAACGTG
GGTACAAGTTATTTGGACAACAAGTTCTACTTCTTCGAAAGCTCAGCAAC
TACTATCAAGATGATTGTGAGAGATGAAGAGTTCAAAGAGAAATCTCAAG
GATTCATCCTTGCTGACATTGAGCCAAAAGCCAATTATGTTCTTAGTTCA
TCGCACAACTTGCCCCGCTTGTAAAGAAACTAAAACAGAAGAAGGTAAGA
AAGAGAAGAGCACAACATTATCTCCTGGTAAACGATTGTTATCAAACAGT
GGTCTCAAATGGAATAACATTAATGCTGCTCTGGAAGAAGCAAAGGAAAG
TCTTGCAAACGATGAAATTTGCTGTTGGGAAGTTTTATAACACACAAAAC
ACTGCACAACAAAACACACAACAACAAACCACACAACAACAAGAAAAACA
ACAACAAAAACAGGATTCTCAAGGCAAAGTACACCATGACCTTCACAACA
GAGATCCCGCCTTCTTGAAATACAAATTTTCATTCGCCTATGAAGAACAA
AGATTCAGAGGAGCCTCATGACGAACAATATTTCATTGATGGTGGATATT
ATCCAAGAATTTATTTCTTAGATCCTGATGAGAACGTCCAGGTCAATCTC
AACAACAGTTTGATCGACTCACCATACGATTCCACCCTCTTTTACTACGG
TACCGATAAAGAGATTCTCAGCATGATGAAAAGCGCCCAACAAACAATGA
ATATCACCCTCGGGCGGGGATTTGGTGAATACATTGACTGGGTGGCCTAT
CCAAGGGCGTTGGAGTTATGCAAGGAGAAAAATATGCCAATGATGTTAAT
TATCCATAAAACGTGGTGTGGTGCATGTAAATCTTTGAAACCAACGATCA
AAGATTCGAGACCTATCTGGGAATTGAGCAAATATTTCATCATGGTTAAT
ACTGAGGAAGAGGAAGCGAAAGAAACGAAAGAAAAATATGATGTCGATGG
AAAATATTCACCAAGGATGTTCTTTATCGACATGAAAGAGCAGCTCAATG
AATCACCAGAGATCACTGAACTTTCTAACAAATTTGTTATGATTCGTGTC
AGCGTTTTGGCACCAACATCAGATGGTACAATTATACAGTTGGAGTACAA
CAAGTGAAGAAGAATCACATGATTGGTCTTGTCGTATTCTACAATAACTA
TTGTGAATTCGCTCGATTGATGACTAACATGAACAAAGCTTTGGAGATGA
AACTTGGTGAACGAACAGAGGATCACCAATACACACAACAACAACAACAA
CAACAACAACAACAAGATTCTCAGAACACTCAACAAGAATCGCAGAACAC
TCAACAAGAACAAACACAAACTCAGCAACAACCAAAAGAAGAAGCCAAGC
AGAAAACTGATGACAGCAATGGTAAAGTTGACGAATCCCTACGCAATGAA
GGAAAATCTTTCAAAAAATCACGATACGCTTATGGAAATGTTGACCAATG
ATGATGATGAACCAGATGAAGATCAATTTGATGTTGATGGTGCCTACATT
CCAAGAATATTCTTCTTAGCTCTCAAACCAAGAATTCAAAGAAGTAAAGA
ATTTGCTGAGCTCAGCAAGAAATTTGTCATGGTTACTGTTGAAGAAGAAG
CCAATGATGTTAATCATCACCAAATCTTATTGTGGTGCTTGTAAAGATCT
TGGAAAACACATCAAATGGGTTACTTACAAAAAAGGATTACAACTTGTTA
AAACTTTTCCGCGCATCAATGGACCGAGTCATTGGAAATATCACCGAAGC
TCAAAACGTCAAAGACAATGACAGCGATGGTGATTTGATTGAAGAAGAAT
TGAATTATGGAACAAAACATAAACATGTTCTTCATTATTATGGTTCAGGA
AAAGAAAGAAGATGACATTGTGAAAGAAAGTGATAAATACAGAGCTGATG
GAGAATACTATCCCAAAATATTATTTATTGGATTGAAACCATCATTCGCA
GCTTCAGATGAGATCAAAGAAGTAGCGGACAAGTTCATCATGATTAATAC
TGACGAATAAGCCAATTCTTGCTGTTTTCCATCAAGACTGGTGTGGTGCT
TGCCAACTTTTGATCAGTATGGAAGTATGTTTGGAGCACCAGTTCTTGGA
TAGTGGTTTCGGTAAAGACTATGTGTGGTATGAGTGGACCTCAGGCTTGG
CGGCTGCAAAACAACAATCACAATGGTGTCATGATGCGGGAATTGGACAA
CAAGAATAAGAAATCCGATAAAACAAAATACTTCTACAAAAAAGTTTCTG
ATGAACTGATCGAAGATTTCGAAGCGTCCAGTGAGTTTGTTGAACAAAGC
AAGAAATTCCTACTGGCAAAAGCTGAAGATAAAGAGATTGGCAAATTGGG
TGCATATAAAAGCGAAGGAAAATATGTCCCTAAAATCGTATTCATTAGAC
GCTTCCAATCTTATTGTTGAGTACTCGTTCTAAATGTAAACCCTGCAAAA
AATTGACATGGCTGAAACTTGATGATGCATTATCCCAAGCTAAAGAAAAA
TGTGGGCCCTTTGGTTCTTGTTTTCGATTGTTGCTACATCAGCATCAGTC
TATCGAGCAATGGAAAAAGCCAAGGAAAAGATGTCAGCGTGGAAACCAGG
GGACCAGTCTGAAGAGACTAATCGAGTTGTCAAAAAACCAAAAGATGAAT
TATAGGACGACGTTGATGATGAATTAGCTGATTCTTTTGATATCGATGGA
ACGTATGTACCGAGAATTTATTTCTTGGATCCTGAAGGCAAGATATGGAA
AGATTTATGGAACGTGGGTACAAGTTATTTGGACAACAAGTTCTACTTCT
TCGAAAGCTCAGCAACTACTATCAAGATGATTGTGAGAGATGAAGAGTTC
AAAGAGAAATCTCAAGGATTCATCCTTGCTGACATTGAGCCAAAAGCCAA
TTATGTTCTTAGTTCATCGCACAACTTGCCCCGCTTGTAAAGAAACTAAA
ACAGAAGAAGGTAAGAAAGAGAAGAGCACAACATTATCTCCTGGTAAACG
ATTGTTATCAAACAGTGGTCTCAAATGGAATAACATTAATGCTGCTCTGG
AAGAAGCAAAGGAAAGTCTTGCAAACGATGAAATTTGCTGTTGGGAAGTT
TTATAACACACAAAACACTGCACAACAAAACACACAACAACAAACCACAC
AACAACAAGAAAAACAACAACAAAAACAGGATTCTCAAGGCAAAGTACAC
CATGACCTTCACAACAGAGATCCCGCCTTCTTGAAATACAAATTTTCATT
CGCCTATGAAGAACAAAGATTCAGAGGAGCCTCATGACGAACAATATTTC
ATTGATGGTGGATATTATCCAAGAATTTATTTCTTAGATCCTGATGAGAA
CGTCCAGGTCAATCTCAACAACAGTTTGATCGACTCACCATACGATTCCA
CCCTCTTTTACTACGGTACCGATAAAGAGATTCTCAGCATGATGAAAAGC
GCCCAACAAACAATGAATATCACCCTCGGGCGGGGATTTGGTGAATACAT
TGACTGGGTGGCCTATCCAAGGGCGTTGGAGTTATGCAAGGAGAAAAATA
TGCCAATGATGTTAATTATCCATAAAACGTGGTGTGGTGCATGTAAATCT
TTGAAACCAACGATCAAAGATTCGAGACCTATCTGGGAATTGAGCAAATA
TTTCATCATGGTTAATACTGAGGAAGAGGAAGCGAAAGAAACGAAAGAAA
AATATGATGTCGATGGAAAATATTCACCAAGGATGTTCTTTATCGACATG
AAAGAGCAGCTCAATGAATCACCAGAGATCACTGAACTTTCTAACAAATT
TGTTATGATTCGTGTCAGCGTTTTGGCACCAACATCAGATGGTACAATTA
TACAGTTGGAGTACAACAAGTGAAGAAGAATCACATGATTGGTCTTGTCG
TATTCTACAATAACTATTGTGAATTCGCTCGATTGATGACTAACATGAAC
AAAGCTTTGGAGATGAAACTTGGTGAACGAACAGAGGATCACCAATACAC
ACAACAACAACAACAACAACAACAACAACAAGATTCTCAGAACACTCAAC
AAGAATCGCAGAACACTCAACAAGAACAAACACAAACTCAGCAACAACCA
AAAGAAGAAGCCAAGCAGAAAACTGATGACAGCAATGGTAAAGTTGACGA
ATCCCTACGCAATGAAGGAAAATCTTTCAAAAAATCACGATACGCTTATG
GAAATGTTGACCAATGATGATGATGAACCAGATGAAGATCAATTTGATGT
TGATGGTGCCTACATTCCAAGAATATTCTTCTTAGCTCTCAAACCAAGAA
TTCAAAGAAGTAAAGAATTTGCTGAGCTCAGCAAGAAATTTGTCATGGTT
ACTGTTGAAGAAGAAGCCAATGATGTTAATCATCACCAAATCTTATTGTG
GTGCTTGTAAAGATCTTGGAAAACACATCAAATGGGTTACTTACAAAAAA
GGATTACAACTTGTTAAAACTTTTCCGCGCATCAATGGACCGAGTCATTG
GAAATATCACCGAAGCTCAAAACGTCAAAGACAATGACAGCGATGGTGAT
TTGATTGAAGAAGAATTGAATTATGGAACAAAACATAAACATGTTCTTCA
TTATTATGGTTCAGGAAAAGAAAGAAGATGACATTGTGAAAGAAAGTGAT
AAATACAGAGCTGATGGAGAATACTATCCCAAAATATTATTTATTGGATT
GAAACCATCATTCGCAGCTTCAGATGAGATCAAAGAAGTAGCGGACAAGT
TCATCATGATTAATACTGACGAATAAGCCAATTCTTGCTGTTTTCCATCA
AGACTGGTGTGGTGCTTGCCAACTTTTGATCAGTATGGAAGTATGTTTGG
AGCACCAGTTCTTGGATAGTGGTTTCGGTAAAGACTATGTGTGGTATGAG
TGGACCTCAGGCTTGGCGGCTGCAAAACAACAATCACAATGGTGTCATGA
TGCGGGAATTGGACAACAAGAATAAGAAATCCGATAAAACAAAATACTTC
TACAAAAAAGTTTCTGATGAACTGATCGAAGATTTCGAAGCGTCCAGTGA
GTTTGTTGAACAAAGCAAGAAATTCCTACTGGCAAAAGCTGAAGATAAAG
AGATTGGCAAATTGGGTGCATATAAAAGCGAAGGAAAATATGTCCCTAAA
ATCGTATTCATTAGACGCTTCCAATCTTATTGTTGAGTACTCGTTCTAAA
TGTAAACCCTGCAAAAAATTGACATGGCTGAAACTTGATGATGCATTATC
CCAAGCTAAAGAAAAATGTGGGCCCTTTGGTTCTTGTTTTCGATTGTTGC
TACATCAGCATCAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000769XLOC_000769Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001510-exon-sc0000010-1575043694:981203..981344TCONS_00001510-exon-sc0000010-1575043694:981203..981344Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1575043694:980874..980922TCONS_00001510-exon-sc0000010-1575043694:980874..980922Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1575043694:980597..980649TCONS_00001510-exon-sc0000010-1575043694:980597..980649Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1575043694:980119..980262TCONS_00001510-exon-sc0000010-1575043694:980119..980262Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1575043694:979636..979722TCONS_00001510-exon-sc0000010-1575043694:979636..979722Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1575043694:979089..979197TCONS_00001510-exon-sc0000010-1575043694:979089..979197Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1575043694:978657..978709TCONS_00001510-exon-sc0000010-1575043694:978657..978709Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1575043694:978334..978407TCONS_00001510-exon-sc0000010-1575043694:978334..978407Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1575043694:978015..978087TCONS_00001510-exon-sc0000010-1575043694:978015..978087Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1575043694:977810..977896TCONS_00001510-exon-sc0000010-1575043694:977810..977896Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1575043694:977454..977516TCONS_00001510-exon-sc0000010-1575043694:977454..977516Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1575043694:976838..976898TCONS_00001510-exon-sc0000010-1575043694:976838..976898Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1575043694:976426..976478TCONS_00001510-exon-sc0000010-1575043694:976426..976478Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1575043694:975996..976069TCONS_00001510-exon-sc0000010-1575043694:975996..976069Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1575043694:975207..975276TCONS_00001510-exon-sc0000010-1575043694:975207..975276Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1575043694:974314..974400TCONS_00001510-exon-sc0000010-1575043694:974314..974400Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1575043694:973734..973928TCONS_00001510-exon-sc0000010-1575043694:973734..973928Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1575043694:973160..973273TCONS_00001510-exon-sc0000010-1575043694:973160..973273Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1575043694:972369..972442TCONS_00001510-exon-sc0000010-1575043694:972369..972442Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1575043694:971884..971956TCONS_00001510-exon-sc0000010-1575043694:971884..971956Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1575043694:971348..971682TCONS_00001510-exon-sc0000010-1575043694:971348..971682Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1575043694:970937..971006TCONS_00001510-exon-sc0000010-1575043694:970937..971006Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1575043694:970400..970486TCONS_00001510-exon-sc0000010-1575043694:970400..970486Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1575043694:969448..969561TCONS_00001510-exon-sc0000010-1575043694:969448..969561Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1575043694:968686..968809TCONS_00001510-exon-sc0000010-1575043694:968686..968809Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1575043694:967467..967519TCONS_00001510-exon-sc0000010-1575043694:967467..967519Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1575043694:966950..967023TCONS_00001510-exon-sc0000010-1575043694:966950..967023Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1575043694:966389..966548TCONS_00001510-exon-sc0000010-1575043694:966389..966548Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1575043694:965417..965666TCONS_00001510-exon-sc0000010-1575043694:965417..965666Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1510915933:981203..981344TCONS_00001510-exon-sc0000010-1510915933:981203..981344Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1510915933:980874..980922TCONS_00001510-exon-sc0000010-1510915933:980874..980922Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1510915933:980597..980649TCONS_00001510-exon-sc0000010-1510915933:980597..980649Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1510915933:980119..980262TCONS_00001510-exon-sc0000010-1510915933:980119..980262Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1510915933:979636..979722TCONS_00001510-exon-sc0000010-1510915933:979636..979722Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1510915933:979089..979197TCONS_00001510-exon-sc0000010-1510915933:979089..979197Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1510915933:978657..978709TCONS_00001510-exon-sc0000010-1510915933:978657..978709Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1510915933:978334..978407TCONS_00001510-exon-sc0000010-1510915933:978334..978407Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1510915933:978015..978087TCONS_00001510-exon-sc0000010-1510915933:978015..978087Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1510915933:977810..977896TCONS_00001510-exon-sc0000010-1510915933:977810..977896Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1510915933:977454..977516TCONS_00001510-exon-sc0000010-1510915933:977454..977516Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1510915933:976838..976898TCONS_00001510-exon-sc0000010-1510915933:976838..976898Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1510915933:976426..976478TCONS_00001510-exon-sc0000010-1510915933:976426..976478Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1510915933:975996..976069TCONS_00001510-exon-sc0000010-1510915933:975996..976069Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1510915933:975207..975276TCONS_00001510-exon-sc0000010-1510915933:975207..975276Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1510915933:974314..974400TCONS_00001510-exon-sc0000010-1510915933:974314..974400Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1510915933:973734..973928TCONS_00001510-exon-sc0000010-1510915933:973734..973928Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1510915933:973160..973273TCONS_00001510-exon-sc0000010-1510915933:973160..973273Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1510915933:972369..972442TCONS_00001510-exon-sc0000010-1510915933:972369..972442Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1510915933:971884..971956TCONS_00001510-exon-sc0000010-1510915933:971884..971956Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1510915933:971348..971682TCONS_00001510-exon-sc0000010-1510915933:971348..971682Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1510915933:970937..971006TCONS_00001510-exon-sc0000010-1510915933:970937..971006Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1510915933:970400..970486TCONS_00001510-exon-sc0000010-1510915933:970400..970486Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1510915933:969448..969561TCONS_00001510-exon-sc0000010-1510915933:969448..969561Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1510915933:968686..968809TCONS_00001510-exon-sc0000010-1510915933:968686..968809Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1510915933:967467..967519TCONS_00001510-exon-sc0000010-1510915933:967467..967519Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1510915933:966950..967023TCONS_00001510-exon-sc0000010-1510915933:966950..967023Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1510915933:966389..966548TCONS_00001510-exon-sc0000010-1510915933:966389..966548Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1510915933:965417..965666TCONS_00001510-exon-sc0000010-1510915933:965417..965666Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1491911889:981203..981344TCONS_00001510-exon-sc0000010-1491911889:981203..981344Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1491911889:980874..980922TCONS_00001510-exon-sc0000010-1491911889:980874..980922Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1491911889:980597..980649TCONS_00001510-exon-sc0000010-1491911889:980597..980649Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1491911889:980119..980262TCONS_00001510-exon-sc0000010-1491911889:980119..980262Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1491911889:979636..979722TCONS_00001510-exon-sc0000010-1491911889:979636..979722Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1491911889:979089..979197TCONS_00001510-exon-sc0000010-1491911889:979089..979197Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1491911889:978657..978709TCONS_00001510-exon-sc0000010-1491911889:978657..978709Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1491911889:978334..978407TCONS_00001510-exon-sc0000010-1491911889:978334..978407Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1491911889:978015..978087TCONS_00001510-exon-sc0000010-1491911889:978015..978087Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1491911889:977810..977896TCONS_00001510-exon-sc0000010-1491911889:977810..977896Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1491911889:977454..977516TCONS_00001510-exon-sc0000010-1491911889:977454..977516Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1491911889:976838..976898TCONS_00001510-exon-sc0000010-1491911889:976838..976898Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1491911889:976426..976478TCONS_00001510-exon-sc0000010-1491911889:976426..976478Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1491911889:975996..976069TCONS_00001510-exon-sc0000010-1491911889:975996..976069Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1491911889:975207..975276TCONS_00001510-exon-sc0000010-1491911889:975207..975276Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1491911889:974314..974400TCONS_00001510-exon-sc0000010-1491911889:974314..974400Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1491911889:973734..973928TCONS_00001510-exon-sc0000010-1491911889:973734..973928Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1491911889:973160..973273TCONS_00001510-exon-sc0000010-1491911889:973160..973273Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1491911889:972369..972442TCONS_00001510-exon-sc0000010-1491911889:972369..972442Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1491911889:971884..971956TCONS_00001510-exon-sc0000010-1491911889:971884..971956Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1491911889:971348..971682TCONS_00001510-exon-sc0000010-1491911889:971348..971682Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1491911889:970937..971006TCONS_00001510-exon-sc0000010-1491911889:970937..971006Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1491911889:970400..970486TCONS_00001510-exon-sc0000010-1491911889:970400..970486Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1491911889:969448..969561TCONS_00001510-exon-sc0000010-1491911889:969448..969561Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1491911889:968686..968809TCONS_00001510-exon-sc0000010-1491911889:968686..968809Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1491911889:967467..967519TCONS_00001510-exon-sc0000010-1491911889:967467..967519Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1491911889:966950..967023TCONS_00001510-exon-sc0000010-1491911889:966950..967023Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1491911889:966389..966548TCONS_00001510-exon-sc0000010-1491911889:966389..966548Clytia hemisphaericaexon
TCONS_00001510-exon-sc0000010-1491911889:965417..965666TCONS_00001510-exon-sc0000010-1491911889:965417..965666Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
Thioredoxin domain containing proteinTCONS_00001510-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000010supercontigsc0000010:965417..981344 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.177833 0.136255 0.258881 0.112567 22.0804 19.8306 22.6346 20.4106 11.1215 4.17649 15.5331 11.869 9.02241 8.05387 11.7353 21.7662 14.9233 15.5793 0.162035 0.226077 8.38818 7.33228 3.6702 3.68101 6.40985 8.54444 1.81142 0.316003 0.0704932 0.0430929
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR017937Thioredoxin_CS
IPR013766Thioredoxin_domain
IPR012336Thioredoxin-like_fold
Vocabulary: Biological Process
TermDefinition
GO:0045454cell redox homeostasis
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0045454 cell redox homeostasis
Blast
BLAST of TCONS_00001510 vs. Swiss-Prot (Human)
Match: TXD12 (Thioredoxin domain-containing protein 12 OS=Homo sapiens GN=TXNDC12 PE=1 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 1.510e-26
Identity = 62/128 (48.44%), Postives = 82/128 (64.06%), Query Frame = 1
Query: 1873 LGRGFGEYIDWVAYPRALELCKEKNMPMMLIIHKTWCGACKSLKPTIKDSRPIWELSKYFIMVNTEDSEEPHDEQYFIDGGYYPRIYFLDSQGKVHHDL--HNRDPAFLKYKFSFAYEEQILQTMKFA 2250
            LG+GFG++I W       +      +P+M+IIHK+WCGACK+LKP   +S  I ELS  F+MVN ED EEP DE +  DGGY PRI FLD  GKVH ++   N +P+   YK+ +   EQ++Q MK A
Sbjct:   30 LGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPS---YKYFYVSAEQVVQGMKEA 154          

HSP 2 Score: 92.8189 bits (229), Expect = 8.223e-21
Identity = 58/139 (41.73%), Postives = 82/139 (58.99%), Query Frame = 1
Query:  907 TEAQNVKDNDLGKHIKWVTYKKGLQLVKTLKKPMMLIITKSYCGACKALKPRIQRSKEFAELSKKFVMXXXXXXXXXXXXXXXXXGAYIPRIFFLDSNGKVDESLRNEGKSFKKSRYAYGNVDQLMTNMNKALEMKLGE 1323
            ++  N      G HI W T + G +       P+M+II KS+CGACKALKP+   S E +ELS  FVMV +ED++EP ++ F  DG YIPRI FLD +GKV   + NE  +    +Y Y + +Q++  M +A E   G+
Sbjct:   24 SDGHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGN-PSYKYFYVSAEQVVQGMKEAQERLTGD 161          

HSP 3 Score: 82.0333 bits (201), Expect = 3.248e-17
Identity = 44/146 (30.14%), Postives = 77/146 (52.74%), Query Frame = 1
Query:  505 HQFLDSGFGKDYVWYEWTSGLAAAKQQNKPILAVFHQDWCGACQRLKPSFAASDEIKEVADKFIMINTDEDDIVKESDKYRADGEYYPKILFIDSDGDLIEEELNYGTKHKHVLHYYGSGKEIRASM----DRVIGNITEAQNVKD 930
            H  L  GFG    W     G   A     P++ + H+ WCGAC+ LKP FA S EI E++  F+M+N ++++   + + +  DG Y P+ILF+D  G +  E +N      +  ++Y S +++   M    +R+ G+    ++++D
Sbjct:   27 HNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEE-EPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYK-YFYVSAEQVVQGMKEAQERLTGDAFRKKHLED 170          
The following BLAST results are available for this feature:
BLAST of TCONS_00001510 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
TXD121.510e-2648.44Thioredoxin domain-containing protein 12 OS=Homo s... [more]
back to top