Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

Thioredoxin domain containing protein (polypeptide) - C. hemisphaerica

Overview
NameThioredoxin domain containing protein
Unique NameTCONS_00001510-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length921

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001510-protein ID=TCONS_00001510-protein|Name=Thioredoxin domain containing protein|organism=Clytia hemisphaerica|type=polypeptide|length=921bp
MWALWFLFSIVATSASELTWLKLDDALSQAKEKTLPILLLSTRSKCKPCK
KLIEDFEASSEFVEQSKKFLLAKAEDKEIGKLGAYKSEGKYVPKIVFINH
NGVMMRELDNKNKKSDKTKYFYKKVSDVLISMEVCLEHQFLDSGFGKDYV
WYEWTSGLAAAKQQNKPILAVFHQDWCGACQRLKPSFAASDEIKEVADKF
IMINTDEDDIVKESDKYRADGEYYPKILFIDSDGDLIEEELNYGTKHKHV
LHYYGSGKEIRASMDRVIGNITEAQNVKDNDLGKHIKWVTYKKGLQLVKT
LKKPMMLIITKSYCGACKALKPRIQRSKEFAELSKKFVMVTVEDDDEPDE
DQFDVDGAYIPRIFFLDSNGKVDESLRNEGKSFKKSRYAYGNVDQLMTNM
NKALEMKLGERTEDHQYTQQQQQQQQQQDSQNTQQESQNTQQEQTQTQQQ
PKEEAKQKTDGFGTNIRWYNYTVGVQQVKKNHMIGLVVFYNNYCEFARYM
KEQLNESPEITELSNKFVMIRVSEEEAKETKEKYDVDGKYSPRMFFIDPD
ENVQVNLNNSLIDSPYDSTLFYYGTDKEILSMMKSAQQTMNITLGRGFGE
YIDWVAYPRALELCKEKNMPMMLIIHKTWCGACKSLKPTIKDSRPIWELS
KYFIMVNTEDSEEPHDEQYFIDGGYYPRIYFLDSQGKVHHDLHNRDPAFL
KYKFSFAYEEQILQTMKFAVGKFYNTQNTAQQNTQQQTTQQQEKQQQKQE
TKTEEGKKEKSTTLSPGKRLLSNSGLKWNNINAALEEAKESQKPIMFLVH
RTTCPACKATIKMIVRDEEFKEKSQGFILADIEDDVDDELADSFDIDGTY
VPRIYFLDPEGKIWKDLWNVGTSYLDNKFYFFESSAIYRAMEKAKEKMSA
WKPGDQSEETNRVVKKPKDEL
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000769XLOC_000769Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001510TCONS_00001510Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR017937Thioredoxin_CS
IPR013766Thioredoxin_domain
IPR012336Thioredoxin-like_fold
Vocabulary: Biological Process
TermDefinition
GO:0045454cell redox homeostasis
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0045454 cell redox homeostasis
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 423..443
NoneNo IPR availableGENE3D3.40.30.10coord: 272..410
e-value: 1.7E-14
score: 53.4
coord: 584..731
e-value: 2.7E-10
score: 39.8
coord: 137..271
e-value: 3.9E-15
score: 55.5
coord: 732..912
e-value: 6.8E-14
score: 51.5
NoneNo IPR availablePFAMPF13899Thioredoxin_7coord: 291..367
e-value: 1.7E-12
score: 47.2
coord: 603..683
e-value: 5.3E-10
score: 39.3
coord: 154..231
e-value: 1.4E-15
score: 57.1
coord: 779..859
e-value: 6.6E-12
score: 45.4
coord: 468..549
e-value: 1.9E-6
score: 27.9
coord: 20..99
e-value: 7.2E-9
score: 35.6
NoneNo IPR availableGENE3D3.40.30.10coord: 495..583
e-value: 9.0E-4
score: 18.8
NoneNo IPR availableGENE3D3.40.30.10coord: 10..133
e-value: 2.2E-8
score: 33.5
NoneNo IPR availableGENE3D2.70.70.10coord: 411..494
e-value: 0.38
score: 10.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 412..461
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 734..771
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 898..921
IPR017937Thioredoxin, conserved sitePROSITEPS00194THIOREDOXIN_1coord: 306..324
IPR017937Thioredoxin, conserved sitePROSITEPS00194THIOREDOXIN_1coord: 622..640
IPR017937Thioredoxin, conserved sitePROSITEPS00194THIOREDOXIN_1coord: 169..187
IPR013766Thioredoxin domainPROSITEPS51352THIOREDOXIN_2coord: 86..276
score: 8.623
IPR012336Thioredoxin-like foldSUPERFAMILY52833Thioredoxin-likecoord: 467..557
IPR012336Thioredoxin-like foldSUPERFAMILY52833Thioredoxin-likecoord: 150..248
IPR012336Thioredoxin-like foldSUPERFAMILY52833Thioredoxin-likecoord: 285..373
IPR012336Thioredoxin-like foldSUPERFAMILY52833Thioredoxin-likecoord: 777..870
IPR012336Thioredoxin-like foldSUPERFAMILY52833Thioredoxin-likecoord: 13..113
IPR012336Thioredoxin-like foldSUPERFAMILY52833Thioredoxin-likecoord: 602..704

Blast
BLAST of Thioredoxin domain containing protein vs. Swiss-Prot (Human)
Match: TXD12 (Thioredoxin domain-containing protein 12 OS=Homo sapiens GN=TXNDC12 PE=1 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 4.934e-28
Identity = 62/128 (48.44%), Postives = 82/128 (64.06%), Query Frame = 0
Query:  594 LGRGFGEYIDWVAYPRALELCKEKNMPMMLIIHKTWCGACKSLKPTIKDSRPIWELSKYFIMVNTEDSEEPHDEQYFIDGGYYPRIYFLDSQGKVHHDL--HNRDPAFLKYKFSFAYEEQILQTMKFA 719
            LG+GFG++I W       +      +P+M+IIHK+WCGACK+LKP   +S  I ELS  F+MVN ED EEP DE +  DGGY PRI FLD  GKVH ++   N +P+   YK+ +   EQ++Q MK A
Sbjct:   30 LGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPS---YKYFYVSAEQVVQGMKEA 154          

HSP 2 Score: 101.293 bits (251), Expect = 1.151e-24
Identity = 58/139 (41.73%), Postives = 82/139 (58.99%), Query Frame = 0
Query:  272 TEAQNVKDNDLGKHIKWVTYKKGLQLVKTLKKPMMLIITKSYCGACKALKPRIQRSKEFAELSKKFVMVTVEDDDEPDEDQFDVDGAYIPRIFFLDSNGKVDESLRNEGKSFKKSRYAYGNVDQLMTNMNKALEMKLGE 410
            ++  N      G HI W T + G +       P+M+II KS+CGACKALKP+   S E +ELS  FVMV +ED++EP ++ F  DG YIPRI FLD +GKV   + NE  +    +Y Y + +Q++  M +A E   G+
Sbjct:   24 SDGHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGN-PSYKYFYVSAEQVVQGMKEAQERLTGD 161          

HSP 3 Score: 82.0333 bits (201), Expect = 5.989e-18
Identity = 43/146 (29.45%), Postives = 78/146 (53.42%), Query Frame = 0
Query:  138 HQFLDSGFGKDYVWYEWTSGLAAAKQQNKPILAVFHQDWCGACQRLKPSFAASDEIKEVADKFIMINTDEDDIVKESDKYRADGEYYPKILFIDSDGDLIEEELNYGTKHKHVLHYYGSGKEI----RASMDRVIGNITEAQNVKD 279
            H  L  GFG    W     G   A     P++ + H+ WCGAC+ LKP FA S EI E++  F+M+N ++++   + + +  DG Y P+ILF+D  G +  E +N      +  ++Y S +++    + + +R+ G+    ++++D
Sbjct:   27 HNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEE-EPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYK-YFYVSAEQVVQGMKEAQERLTGDAFRKKHLED 170          
The following BLAST results are available for this feature:
BLAST of Thioredoxin domain containing protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
TXD124.934e-2848.44Thioredoxin domain-containing protein 12 OS=Homo s... [more]
back to top