Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001505 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001505
Unique NameTCONS_00001505
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1076

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001505 ID=TCONS_00001505|Name=TCONS_00001505|organism=Clytia hemisphaerica|type=transcript|length=1076bp
AATAGATCAAATCTCCTTGTCAGGTGGACTTTATACATTTTATGGAATTT
CTGCCaaagtttcatgctttattgTACCAAACTTGAAATATTAAGATGAA
CACAATACCTTCTATGGTCAGGTCCCAAAAGTTTAGAATCAAAACTTTTC
AGACATCTTTTCAATGCTGGAGAGGAATTCTGCAAAAGCGAAGGTTCCTT
ACTGGTTGCAGTAATCCTCGTACTTCAACATCACAAAGACAATTTTTGTA
CAGAATAAACCCCATCATTTCAAAATCAAGAAGTATTACTACAGCACTGC
AAGAGAGGCATAAAACTGTTCTACTTTATTTGAGTTCAGCAGCTGTTTTG
GCCTGTGGTTTATCTTATGCTGCCGTACCTTTATACCGGCTCTATTGTCA
GGCATCTGGATATGGATCAGCTCaacaagaaattgattttggaAGTAAAA
TTGAAAGTATGGAACGTGTAGAAGACAGAATATTGACTGTAAGGTTTGAA
GCTGGAACAAGTAAAACTTTGCGATGGAAATTCAAACCCCAACAGAAGGA
AGTCAATTTAGCTCCTGGAGAGACTGCATTAGCTTTTTATACAGCCGTCA
ACTTGACGGATGACCCTATCATTGGAATTGCAACGTATAATGTCATTCCT
TTTGAAGCCGGACAgtatttcaataaaattcaatgtttttgttttgaaga
acaACAGTTGAATCCTGGAGAAGAAGTTGATATGCCTGTGTTTTTCTATA
TTGACCCTGACTTTATGGAAGATCCTAAACTGGCTAAATATGATGAATTA
ATTTTATCATATACTTTTTTCCAGTCTAATGAAGCTAATGCACCTGGATC
GTCACCGCATGTTGCACGGCAGCCACCGCCCCCACCTCCACCTAGTAGTT
GAAGCAAAAGTGAAAaggatgtttgtttttttttaaagtaaaaataaaaa
ctgaagTGGAGAAAGTTTATTTAAATTAATGTTGCTTTTATCTTGcatga
tttttttgtaaataagcATTAAAAGCatttataataattttaatggagaa
taatttgtaaaaaaattcaattcctg
Run BLAST on NCBI

protein sequence of TCONS_00001505-protein

>TCONS_00001505-protein ID=TCONS_00001505-protein|Name=TCONS_00001505-protein|organism=Clytia hemisphaerica|type=polypeptide|length=268bp
MNTIPSMVRSQKFRIKTFQTSFQCWRGILQKRRFLTGCSNPRTSTSQRQF
LYRINPIISKSRSITTALQERHKTVLLYLSSAAVLACGLSYAAVPLYRLY
CQASGYGSAQQEIDFGSKIESMERVEDRILTVRFEAGTSKTLRWKFKPQQ
KEVNLAPGETALAFYTAVNLTDDPIIGIATYNVIPFEAGQYFNKIQCFCF
EEQQLNPGEEVDMPVFFYIDPDFMEDPKLAKYDELILSYTFFQSNEANAP
GSSPHVARQPPPPPPPSS
Run BLAST on NCBI

transcript from alignment at sc0000010:838129..846950-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001505 ID=TCONS_00001505|Name=TCONS_00001505|organism=Clytia hemisphaerica|type=transcript|length=8822bp|location=Sequence derived from alignment at sc0000010:838129..846950- (Clytia hemisphaerica)
AATAGATCAAATCTCCTTGTCAGGTGGACTTTATACATTTTATGGAATTT CTGCCAAAGTTTCATGCTTTATTGGTAAGACTATTTTTAAACACGAACCT TCATGCCTAAGCTTTGTTTCTACATCAAATATGTATAGTTTAGTGTTTTA GATGTCAGTAAATGACTTGTTTTGTACCAGTAAAGTTTGGGTTATGCAAC ACTTACTTTTACTGTGAAATCAGGATCAGGTAACTTGCATCAATGGAGGG AAACTTGCATAGCCCTCAAATGAATGACCTGGCTGGTCATTAAAATACAA ATTTAAATCAAAANGTCCCGGGAGGGAAAATACCTCTTTAGCCTCTTCAA AAGGTCTTCCTTGCAAAGAGCCCAGAGAATCAAAAAAAGTTAAACAAACT TTAAACATCACTCGGTTTATTGAGACAGGGGATGTGAAATGGGCTCTTCC AGAAAAAAATTTTACATGGGGGGGGGTGGAGGATATAACAATTTTTAGTG ATTTACCCCCCGGACAGGGTGACTTTTGGCCCCCGGACAATAGGTTTTAC CCCCGGACAAGCATCTGCTGACCCCCGGACACACCAAATTACCCCGGACA GAGCAAATTTACACCCAAGTCAAATTTTGATGATTTTTTGCTACCCCCGG ACAATATATCCTCCACTCCCCATGTAAAATTTTTTTCTGGAAGAGCCCAA TACAAAGGATTTCAAGACTAGAATTTAATAGAAATAAGTTGACTTATGTA GTTTCGAAATTCAATAACCATATTGATTAGGAATATTGTATCATTGCATC GTAAATTCTGAAAAATTTACACGATTATATCTAAACTATTAGCGCAGTCA AATCCTGAGATAAAAATAAAGAAAAACCAGATAAAAAACTGAGATATAGA AAGTATTCTTCAACGATTCTACTNCTAGTGTATATGTATAAGAATTGCGA AGCGATCCAGGCAAGTCACTCGATTCGCAAGTTGCAAGCAAAATATTTAT AGGGTCACACACTAGAGATTGCAAGTTGAAATAGATTCATAATCAATTCG TAAATGTAAACCCCGCGAAACCCCGACAACTGCTCAGGTTCAGGAAGACC GAGCCTCTTTAGAGATANNNNNNNNNNNNNNNNNNNNNNAAACCCTGCGA ACCCCCGACAACTGCTCAGGTTCAGGAAGACCGAGCCTCTTTAGAGATAC ACTCAAACACTTCAGGTGTACAAACTTACGACGTTTACTTCTACGGATTT GAGAAAAATTACATGATTTTTTTCATGAATCGTTGTGAAAAGTTCAATAA TCATTTGTCTGCCCTAACCCTTGAGTATTTTTATTTCTTAGTTTTTGTTT TAGAATCGTTTTACTTCCGATTTCGAACTCCTTGCGTTCAAAATCGAACT TTCGAATCTTTCTAATTTTAAATTTCGAACGTTCGAATTAAAATAACATT CGAAAACTTTTTTCCTAACATAAACACCCCTGTGTCATAGACCCGCTGGA AAACTTGGCAAAAATTTTGTCCCGGGAGGGAAATACCTCTCTAGCCTCTT CAAAAGGTCTTCCTTGCAAAGAGCCCAGAGAATGAAAAAAAGTTAAACAA ACTTTAAACATCACTCGGTTTATTGAGACAGGGGATGTGAAATACAGAGG ATTTCAAGACTAGAATTTAATAGAAATAAGTTGACTTATGTAGTTTCAAA ATTCAATAACCATATTAATTAGGAATATTGTATCATTATATGCNACAATA TATCCTCCACTCCCCATGTAAAATTTTTTTCTGGAAGAGCCCAATACAAA GGATTTCAAGACTAGAATTTAATAGAAATAAGTTGACTTATGTAGTTTCG AAATTCAATAACCATATTGATTAGGAATATTGTATCATTGCATCGTAAAT TCTGAAAAATTTACACGATTATATCTAAACTATTAGCGCAGTCAAATCCT GAGATAAAAATAAAGAAAAACCAGATAAAAAACTGAGATATAGAAAGTAT TCTTCAACGATTCTACTAAGTAAAACCTCTAAATTTTACAGGCTGTGATT TTTTTCAAAGTTGGGAAACTCTTATCTTAAGTTTGCTGGAGGCAAGTACT TGGCAGTCTTTTACCCACTTACTCGAGTTGTTGACAAACAGGAGCAAACT CTTCACATAAAAAGTAAAAAATCTGTGACTTCTTGGCTGTAGCACAGGAA TTTAAAACAGTTAAAATGCATCCATAAACATAATGTCATGTTGTGTCGTT GTATTTCGACATTTTACAAGTCATTACCATTAATTAATTACCATTACCAA CAATAAAATCCTTTATAATACAGTCACATGTCAATGTTCTATATCTCTAA CCATCAATGCGTACTCATAAAAAACAAACAACCAAAGATCCCACATCATC GTCATCGACGGTCGGTCAAGCCAAAATTTCATAAACAACAACAAACAAAC ATTTCTCCTTCCACTGAATAAGGGGAGGAATAAAGTCTTCCAGGTTAGCT ATATCCAAAAGCGCAAAATGTTTTTGTTCCTATCAATTCAAAACATACAA AAAGTCCAGTGATGCTCACTTCAACATACTACCAAGATTCAAGCTAAACC AATTAAGGAATGGCTTTCCCACCATATGTATACAGTTCATTTCTTCAGCT TAGATCCTCTTCTTGCAATGAAGCAACGACTCTGTTGAGCCTTGCCTGTC GATGAAAGAATAAAAATTCCATCTTCTTTCTTCTCATTCCGCAAGTTCAG CTGCTTTCTTCGTTTCTTTTCATCAAGCACCATCTCTTTTCAAAACACCA ATTTCTCTTTTCAAAACAACGATAAATTGTTTGTTGTTTTTTTAGTCAAC ATTCGAATTTGGAAAAGTTCGAAAGCCCTTCGAAAGTCTTAGCTCGAGTC AATGCATTGACTTCTTGAAAAATGAGCGCCATTTGAACGCTTCTTGAACG CTTCTTGAACGCTTCCAGCCCGCGCTGATTTTTCGATCTCTTCTTTAGAT TTCCTATTTTAAACCTTAAAAGGAGATGAAAACAAGGCTTATCTAGTACC GGTAACCACGTGAATTATCTCCGTAGCTTTTAAGAATTGGTATATCTAAA CGCACGAGGCGACACTTTTTGAAAAAAACAAATTTTACCATCTGTAATTC CAGGTCTCTCCGCCGCGATTCTAAGTTTCTTTCTCAATCAATTCTGCGTT TGAAAGATTGGATATATATAGTAATTTTTCATTTGCGTTCCCCAGCGTAG GTGAGATTTAAAGGTACATATACACGATAGCAAAACTGCTTCGCTCATGT AAATTCGCTTCGCAAAAATAGTAGAAGTAGAGCTGCGAGTGTAGCTGCAT ACCGCGAGAGTGGGTATGTAAGTGAAGTTGATTACCGAACCCGATCAAAC AGCTATCGAACTTTACAAAAATTTCTTGATAAGTTGGATTTAGTTTGATG AGTTTTCTTTGTTCGATGAAGTTCGATTGATTCTACTTTTCTTTAGGCGG CAATCACAAATATCTTTGTTTCGCATCGCCCGACCGACTCTCAAAAATTG AGTAGAATTGAGATTTTTTTTTACAATTTAAATGACCAAAGAGCTTGTAA AAGCTCCAGCTTATCCCATCCGATGGGATAGATATAAGATGGCCCGCGAG AATGCGCCAATACTGTTCGGTAATCGAACAGCTATTGTTCGATAGGGTAC AGGCACCGAATGCTTCTTTCTTTAAAAGAAAGTAATAAAGATTAAAATCT TTTTTTTTACAATTTAAATGACCAAAGAGCTTGTAAAAGCTCCAGCTTGT CCCATCCGATGGGATAGATATAGGATGGCCCGCGAGAATGCGCCAATACT GTTCGGTAATCGTACAGCTATTGTTCGATAGGGTTCGATTAGTTCCGAAA ACGGCAATTTTTTTAATGATAAAATGCTGAATCATATCAGCAAAATGTGT TGTCCTTTTAAGGGCAAAGATATCATTAGCCTGGATATCCAGCCTGTAAA CTATTTCACAGTCTAGTTTTTGATATTTTATGTTCTGGTTTACAGCCTGG TCTTCCTAGAGCAATTTGCATTCTCCATATGAGAATGCAGTCCGCTTGCT TGCGCTCACCTCGCTAAAGCCGTAAGGACCAATGCTGAATGGACACACAG CGCAGAGCAATTCTCAAGAAAAAATAGGATAGTTCTCCGCTAGTGAAGAT AGAGCTTTCTGAAAACAAAGTCTGATGGTTGGTCATTGCAAACTTGTTCA TGGACTCTGGTGTAATCTTTGGATGTTAAATCTTGTAAGGCTGCTTTTAT TAAGTTCTGTTTTGCTGCCCTGGGTTGGCTAGGAAAGTTTTGGAAACATG GGTTTGCACTTTCATTCTCTAGGGAGACCAAGCTCTATAATTTTAGAACT TTGTATGTTGAGGTAAATTTTGTTTTTTCTAAAATTTTGAGCTTTGATAT CCAGGCTGAGATGTCAGAGGTGTTTGAAAATAGTAAAATTGCATCGAGAA AAAGGTTTTTTTGATTTTTACAAGTGATTTTTTCAATTTTTCGTTGCTCA ATAACATGAAAAGTTCTAAAATAATATGTTAAAAGATCCTGCATCGAGAT GCCGAAACACAGCCAGAAAGAGATAACAAAAACCCCGTTGTAAATTATTG TTTACATATGACTCAATTTTGCTATCTGCATTTCCAACAAAACCAATTGA AAACTAAACTAAACAAGGCACAGTGGGCCTACTTATCGGGAGGGTGTCAA ATACCACGTGTTCAATAATAAAATCAACTTTTATTTGCAAAAACGGCAAT AATTGCCGAAAACGACAATCAATTTTCATTTATTTACTTTTTCATTTTTC TGCTGATTCAGCATTTCATGGTTAAAAAAATTGCTGTTTTTGGCAATAAT TTCCGAAAAGAGCAATAATTGCAGCTCTACTCTACCATTTTTGTTTTGAT TTAACCTTTGTATTTTAATGACCAGTCAGGTCATTCATTTGAGGGCTATG CAAGTTTCCCTCCATCATTGATGCAAGTTACCTGATTTCACAGTAGTTCA TTTGTTTTGAAATTTTGCTGCTTTGATTACTACCGTCAACTACTCTCTAA CTTGGGACTATCTGACAAGATATGGGACGGCAATTTGGCCACCATTTCAC CGAACCACCAAAGTCATTTGATTTGACTTAATGAACGGCGTATTAAAAAA TACACGAAAACAAGTTTGTTGTCAAAAAGATTTAACAGTTAGTGAAAATA GACCAGATCAACCAGTCCCATGTTTCGACCAATCGTCCCATCGTCCCAAG TTAGAGCAGTTGACGGTAGTCATTTGATGGCTATGCAAGTTTCCCTCTAC TGATGCAAGTAAACTGACTTCACGGTATAACATTTTGGCTAGTGTAGTGG CCGCCCATCTCTCTTCTGACTTCTCATTATACCAGAACCCATTACTCAAA CTCCTCACAATTAATTTTTCAAAATAATTTAAGTAAGTGCAAGTCTGCGA GTAATATTAGCCGAACTTGCTCCAACTTTGGATTTAACAGGATTTAAAGG TCTGGATTATAGATAACGTAAGTTGGTCTAATATCGACATCCCTCGTCTA ATTCTGACACCCTTTTTTAGAGACAGGAATAATATGAAAGCTTGAATCAC TGATTGAAAAAGAATAATTCCTCTCTGACCATTAAAGCAAAGAAAAACAG TTTCAACTTTTCTATCAATTTCAGCTGATAAAACGGGTGTCAAAATTAGA GGAGGGATGTCGACATTAGACCAAGTTACGGTAGTATAGAACTAGTGTTG TTGTTTTTTAGAAAGAAGATTTTGTCTATTCTCAGTTTCAGATCTCAAAA TTATGGCAGCCAAGAAAGGTCAGCTTCAGACTTGCCAGCTTGAAATGTTC ATTTTGTGTGAGATAAAAATTTCACAAAGCAAAATCCAAGATCGTAAAAT GACCAGACAGTGTCGATCAAATGAATCAAACGCTGAATCAATTGAATGCA ATCGAACACAACCGAATAATTACAATTTGATTGTCGAACGCAATCAAATC GCAATAGAATATTACCCAGGATTTGCTGTTCGATTGTAACGATTATGTTC GATTACATACAATTGATTCAATTGTATTCGATTTTATTCACTCTCTGCCA TCCACGCTAAAAAAGCTCTAAAGGAATGATCAATTTTAATTGCAATCAAA CTTATTGAACATGATCGTAATCAAACATAATCGAAGATCAATAAAGGTAA TTTACAATCAATCGAACGTTACTCGAACGCTACTCGAACGCAATCAAACA CAATCGAATGTTACTCAAGAATCGGCTTTTCGATTGAGATTTGATTGCGT TCAACAATCGAATCTCAATTATTCTATCTTGTTCGATTGGTTCGATTGCA ATTGCAATTGTTTGAAGTTGTTCGATTGACACCGTCTGGAAATGAGAAAA AACTTGAAAATCAGGGAAACATTCTTTCTGAAAATCAGTTGTGAATATAG TAATTATGTTGATATTTTATGAGATAGAGCAAACAATAATGCATTTTAAA TCTTCCTGACAAGAAATATTGGAATCAATCTAAAGCTAATCACAACACTT TGACTTAGAATTTTTGTAGAAAAACCCAAATTATTATAAAAATGAAATTT CCAAAAGGGTCTTAAAAGTTTTTGAATAGCATTTAAGTACTGTTAAAAGC AATTTAGTTGAAGTAAGCTACTTATATTTGAGAAGATTCATCACCAAATT ATGAAAGATTGAGGCTCTTTCTGATAATATAGGCCCTGGAATGGTAGGAA AGGCCAGATGCGCTGTCTCATTATTTTTTGCACAAAATGAAGAAATCATC GTAAAATGTCATCTGTTGATGAAAATCAGCTGAAATTTTCTGCAGTTGTT CCCTTAATTCCAATGATTAGTTGGCTAGGGAAGACCAACCAATATTTTGA CACATAAATTATCCTTTAGAGCCCTTTAGTAGACCTAATTTAACATTTTA AGAAAAAGAAGCCAAAAATAGGTGGGGGCTAATGATGTTTCAATTATTTG GGGGCATTAAATGTACTTGGGGGGGAAGCTGAAATCCCGTCATTTAACGT GGGGGCTGAATACTTCATCTCAATGGTTGGCCTCAATTACTCAAATTAAA GCTCATGAAGCTGAAAATTTTTTGCCTGCAGCGCAATATTTTGTACAAAA TGAGCATAATATTTTATCTTACCCTTCAAATTGCAACACAAAAGTGTTGA GGGTCAAAAGCACTGGAGCTACCAAAAATTTCATGAATCTTTAGGGTGCC ACAGATTTATAAAGCCCAAAGGGCTAGATTTTGTGCTTTAAGTCATGGCA GGCATAAAAAAGTGAATATCAGAAAAAATATTGTTGCTATTGTAATTGAA AACCTGCAAAGCTTCTGATTGGTCAAGCCCTGAAATTCTATTGTAATGTC ACGTCACCTAGGTAGGATTTCCAACCTAACTACAGCACACTTTTCAGAAA AAGTATACCATCTAGCCCTTCAGGCTTTATAAACCTATGCTATCATCTAA AAATTAAATTAAGGGAAAAATTGCTTTACTTCTATACAAAGGGTTTATAC ATTTATATCTAATATACTGTAGTGCAGAAATGGTCAGACAATATCAGAAA AACCCCGTCCGTCTTATATAACATTATTTATAAAGACAGTTTGCTAGCTT TTTTTATCTGATGGTATCAATCTTAAGTTCTAAAATGATCTAAGGAAAGC TTATTTTGATAACCTGGTTGTATAATGGTGATCTGTTTGTATTGTTTGTA ATATTGATAATTTATTTTAGTACCAAACTTGAAATATTAAGATGAACACA ATACCTTCTATGGTCAGGTCCCAAAAGTTTAGAATCAAAACTTTTCAGAC ATCTTTTCAATGCTGGAGAGGAATTCTGCAAAAGCGAAGGTTCCTTACTG GTTGCAGTAATCCTCGTACTTCAACATCACAAAGACAATTTTTGTACAGA ATAAACCCCATCATTTCAAAATCAAGAAGTATTACTACAGCACTGCAAGA GAGGCATAAAACTGTTCTACTTTATTTGAGTTCAGCAGCTGTTTTGGCCT GTGGTTTATCTTATGCTGCCGTACCTTTATACCGGCTCTATTGTCAGGCA TCTGGATATGGATCAGCTCAACAAGAAATTGATTTTGGAAGTAAAATTGA AAGTATGGAACGTGTAGAAGACAGAATATTGACTGTAAGGTTTGAAGCTG GAACAAGTAAAACTTTGCGATGGAAATTCAAACCCCAACAGAAGGAAGTC AATTTAGCTCCTGGAGAGACTGCATTAGCTTTTTATACAGCCGTCAACTT GACGGATGACCCTATCATTGGAATTGCAACGTATAATGTCATTCCTTTTG AAGCCGGACAGTATTTCAATAAAATTCAATGTTTTTGTTTTGAAGAACAA CAGTTGAATCCTGGAGAAGAAGTTGATATGCCTGTGTTTTTCTATATTGA CCCTGACTTTATGGAAGATCCTAAACTGGCTAAATATGATGAATTAATTT TATCATATACTTTTTTCCAGTCTAATGAAGCTAATGCACCTGGATCGTCA CCGCATGTTGCACGGCAGCCACCGCCCCCACCTCCACCTAGTAGTTGAAG CAAAAGTGAAAAGGATGTTTGTTTTTTTTTAAAGTAAAAATAAAAACTGA AGTGGAGAAAGTTTATTTAAATTAATGTTGCTTTTATCTTGCATGATTTT TTTGTAAATAAGCATTAAAAGCATTTATAATAATTTTAATGGAGAATAAT TTGTAAAAAAATTCAATTCCTG

Coding sequence (CDS) from alignment at sc0000010:838129..846950-

>TCONS_00001505 ID=TCONS_00001505|Name=TCONS_00001505|organism=Clytia hemisphaerica|type=CDS|length=807bp|location=Sequence derived from alignment at sc0000010:838129..846950- (Clytia hemisphaerica)
ATGAACACAATACCTTCTATGGTCAGGTCCCAAAAGTTTAGAATCAAAAC
TTTTCAGACATCTTTTCAATGCTGGAGAGGAATTCTGCAAAAGCGAAGGT
TCCTTACTGGTTGCAGTAATCCTCGTACTTCAACATCACAAAGACAATTT
TTGTACAGAATAAACCCCATCATTTCAAAATCAAGAAGTATTACTACAGC
ACTGCAAGAGAGGCATAAAACTGTTCTACTTTATTTGAGTTCAGCAGCTG
TTTTGGCCTGTGGTTTATCTTATGCTGCCGTACCTTTATACCGGCTCTAT
TGTCAGGCATCTGGATATGGATCAGCTCAACAAGAAATTGATTTTGGAAG
TAAAATTGAAAGTATGGAACGTGTAGAAGACAGAATATTGACTGTAAGGT
TTGAAGCTGGAACAAGTAAAACTTTGCGATGGAAATTCAAACCCCAACAG
AAGGAAGTCAATTTAGCTCCTGGAGAGACTGCATTAGCTTTTTATACAGC
CGTCAACTTGACGGATGACCCTATCATTGGAATTGCAACGTATAATGTCA
TTCCTTTTGAAGCCGGACAGTATTTCAATAAAATTCAATGTTTTTGTTTT
GAAGAACAACAGTTGAATCCTGGAGAAGAAGTTGATATGCCTGTGTTTTT
CTATATTGACCCTGACTTTATGGAAGATCCTAAACTGGCTAAATATGATG
AATTAATTTTATCATATACTTTTTTCCAGTCTAATGAAGCTAATGCACCT
GGATCGTCACCGCATGTTGCACGGCAGCCACCGCCCCCACCTCCACCTAG
TAGTTGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000765XLOC_000765Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001505-proteinTCONS_00001505-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001505-exon-sc0000010-1575043694:846877..846950TCONS_00001505-exon-sc0000010-1575043694:846877..846950Clytia hemisphaericaexon
TCONS_00001505-exon-sc0000010-1575043694:838129..839130TCONS_00001505-exon-sc0000010-1575043694:838129..839130Clytia hemisphaericaexon
TCONS_00001505-exon-sc0000010-1510915933:846877..846950TCONS_00001505-exon-sc0000010-1510915933:846877..846950Clytia hemisphaericaexon
TCONS_00001505-exon-sc0000010-1510915933:838129..839130TCONS_00001505-exon-sc0000010-1510915933:838129..839130Clytia hemisphaericaexon
TCONS_00001505-exon-sc0000010-1491911889:846877..846950TCONS_00001505-exon-sc0000010-1491911889:846877..846950Clytia hemisphaericaexon
TCONS_00001505-exon-sc0000010-1491911889:838129..839130TCONS_00001505-exon-sc0000010-1491911889:838129..839130Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000010supercontigsc0000010:838129..846950 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
32.1632 30.4065 57.7295 66.8595 42.5461 31.0914 29.4086 30.3886 19.8275 24.944 20.3142 12.1819 17.7984 16.4206 15.6145 15.5099 28.0461 25.2514 10.8312 11.3796 28.2882 29.3521 72.6294 59.3337 22.3625 23.879 23.6221 15.5094 44.2827 43.6826
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR023471CtaG/Cox11_dom
IPR007533Cyt_c_oxidase_assmbl_CtaG
Vocabulary: Molecular Function
TermDefinition
GO:0005507copper ion binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005507 copper ion binding
Blast
BLAST of TCONS_00001505 vs. Swiss-Prot (Human)
Match: COX11 (Cytochrome c oxidase assembly protein COX11, mitochondrial OS=Homo sapiens GN=COX11 PE=1 SV=3)

HSP 1 Score: 224.172 bits (570), Expect = 3.099e-70
Identity = 107/180 (59.44%), Postives = 136/180 (75.56%), Query Frame = 3
Query:  300 QERHKTXXXXXXXXXXXXCGLSYAAVPLYRLYCQASGYGSAQQEIDFGSKIESMERVEDRILTVRFEAGTSKTLRWKFKPQQKEVNLAPGETALAFYTAVNLTDDPIIGIATYNVIPFEAGQYFNKIQCFCFEEQQLNPGEEVDMPVFFYIDPDFMEDPKLAKYDELILSYTFFQSNEAN 839
            + ++KT L Y+++ AV   G SYAAVPLYRLYCQ +G G +        KIE+M  V+DRI+ + F A    +L+W F+PQQ E+ + PGETALAFY A N TD P+IGI+TYN++PFEAGQYFNKIQCFCFEEQ+LNP EEVDMPVFFYIDP+F EDP++ K D + LSYTFF++ E +
Sbjct:   89 RRQNKTTLTYVAAVAVGMLGASYAAVPLYRLYCQTTGLGGSAVAGHASDKIENMVPVKDRIIKISFNADVHASLQWNFRPQQTEIYVVPGETALAFYRAKNPTDKPVIGISTYNIVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMIKVDLITLSYTFFEAKEGH 268          
The following BLAST results are available for this feature:
BLAST of TCONS_00001505 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
COX113.099e-7059.44Cytochrome c oxidase assembly protein COX11, mitoc... [more]
back to top